100% found this document useful (2 votes)
953 views241 pages

Chasing Phantoms - Carissa Conti

UFO. Carissa Conti

Uploaded by

Arturo Gonzalez
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
100% found this document useful (2 votes)
953 views241 pages

Chasing Phantoms - Carissa Conti

UFO. Carissa Conti

Uploaded by

Arturo Gonzalez
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 241

Chasing Phantoms

Personal experiences, observations and theories into the abduction/mind control phenomenon

Carissa Conti 2006-2008

Dedicated to Tom The light at the end of the tunnel!

T s ts nt en te nt on Co fC of eo blle ab Ta

Introduction ........................................................................................................i

PartIMILABSandMindControl ............................................................... 1

Aliens,MilitaryandMILABS ............................................................ 1 Causesforabductions ..................................................................... 6 Militaryabductions...................................................................... 6 Themilitaryexperimentingonitsownpersonnel............... 8 Beingfamilyofmilitarypersonnel ...................................... 11 Targetingjuveniledelinquentsandinmates ...................... 12 Themilitaryagainstthealiens.............................................. 14 Trackingthealienabductee............................................... 18 Hyperdimensionalabductions................................................. 19 Detectingabductions ........................................................................ 21 Foreshadowing .............................................................................. 21 Aftereffects .................................................................................... 22 Methodsfortakingtheabductee .................................................... 25 SmashandGrab......................................................................... 25 Drivetothem ................................................................................. 25 Beammeup............................................................................ 26 Soul/subtlebodyabductions.................................................... 26 Implants.............................................................................................. 27 Mindcontrolprogramming............................................................. 29 Traumabasedmindcontrol......................................................... 29 Screenmemories............................................................................ 32 Overzealousprogrammingattempts.......................................... 34 Virtualreality/dreamtimeprogramming ................................... 35 Blockinganderasingmemories ...................................................... 37 Drugs,ElectroshockandHypnosis............................................. 37 Memorysurging ........................................................................ 40 Dreams,realitycontext,andtheassemblagepoint ............. 41 Wavebeamingharassment.............................................................. 43 Scalar/Microwaves ........................................................................ 43 Sicknessbeams........................................................................... 45 Theworldunderground .................................................................. 46

PartIIMyOwnExperiences ..................................................................... 51 Actualmemories ........................................................................... 53 Suspicious/obviousindicatorsasakid ...................................... 56 Theobviousstuffasanadult....................................................... 64 Suspiciousstuffasanadult ......................................................... 77 Sidetrackcircusdiversionharassment ................................... 84 TheDreams .............................................................................. 104 Summary ...................................................................................... 119

PartIIIExpandedInsights ....................................................................... 129

Fearinrelationtotheabductionexperience ........................... 129 Blackhelicopters ...................................................................... 131 Thebees ............................................................................. 134 Paranoia .................................................................................... 137 Death/injurythreatsandattempts ........................................ 140 Prayingforinterventionvs.savingyourself ........................ 147 Connectingtoyourhigherpowers ....................................... 147 Revokingillegalmetaphysicalcontracts .............................. 149 NegativeentitiesinterferingwithawakeningMILABS . 151 Thwartingpsychicattacks ...................................................... 156 Endtimesprogramming ............................................................ 159 Untanglingdisinformation ........................................................ 166 Multiplepersonalitiesvs.multiplepersonas....................... 173 Residualtalentsandabilities ................................................. 180 Physicalandspiritualisolationoftargets................................ 186 Isolationandrelationshipinterference ................................. 186 ThereisnoGod/severingspiritualconnections .............. 189 Discoveringabductionschedules ............................................. 191 Sabotagingprogrammingcommands ...................................... 194 Urgestomovetocertainlocations ........................................ 198 TheHyperdimensionalandparanormalphenomenon ......... 200 Numbersightings .................................................................... 200 Eartones.................................................................................... 204 Realvs.artificialsynchronicities ........................................... 210 Theparanormal........................................................................ 212 TheChosenOnes..................................................................... 215 Aliensoulsincarnatingonamission,ormindcontrol?..... 215 Abductmeandmakemefeelspecial! .................................. 220 Thebigboyswiththeiralientoys ............................................. 222

RecommendedReading .............................................................................. 227

I n on tiio ct uc du od ro tr nt In

When it comes to abduction research its difficult to get a clear handle on what exactly is being done, to whom, how, and most importantlywhy. Were chasing after phantoms most of the time, because they, be it aliens or military black ops, are very good at wiping out nearly all memories, planting red herrings and screen memories, and covering their tracks with minimal evidence left behind. While working on this write up it got to the point where I was about to abandon the endeavor completelybecause of the inexplicable nature of it all, and the fact that I can never seem to get concrete answers to anything. It began to seem futile. Having to untangle valid information from what seems like so much disinformation, and encountering all the he said/she said finger pointing, accusations, and counteraccusations within the material can make your head spin. And when you research long enough, you may find that inevitably, you start engaging in some wacky logic what I call double reverse psychology, for lack of a better way to put it. ;) We know what reverse psychology is double reverse is when somebody becomes so suspicious of everything they read that they reverse the logic of whats being presented through multiple unravelingstotrytogettothebottomofwhatsgoingon.Iwasgiven some helpful insight though about allof this, which Ill relay here: The factthatthereissomuchdisinformationoutthereultimately,pointsto the information. So keep plugging away and trying to find answers wastheconclusion.Dontgiveup. Another issue that Ive come across while researching abductions and mind control is that there tends to be the same, yearsold, and most likely very outdated material being circulated to the mass public. I dont claim to definitively know whats going on, but what I can surmise is this: If its been declassified and released for the public to know about, then its outdated, which is exactly why it has been released. Because they dont care if you know. It may have been true and accuratedecades ago. But its most likely that they are not playing by the same rules anymore, and methods of operation would have definitely changed since many of those materials were originally written. So to say were all chasing phantoms is putting it mildly. Taking into account the outdated information, the deliberate disinformation,

ii

Chasing Phantoms

screen memories designed to disguise, random fragments and pieces that dont make sense, and erased memories so theres nothing left at all,thenwhatwehaveisawholelotofconfusion.Butdespitedouble reverse wacky psychology, I still believe there is something very real happening here, and its not all smoke and mirrors designed to get us chasing our tails. Some of what the higher realm entities and military factions are doing to humans is merely batting us around the same way a cat will toy with its prey, which I outline in more detail throughout this book; but other times theyre doing something very serious and real. So its imperative that we learn how to differentiate between the two types of activities, discover what exactly theyre doingtousasindividuals(becauseitdoesvaryfrompersontoperson) then take measures to head things off, and stop as much of it as we can. Now, a note to the reader: This write up is geared specifically towards those who already know that theyre the target of alien/military abductions and mind control and are looking for some additional insight and tactical advise on it all, rather than trying to inform those who have never read anything about these topics or to convinceskeptics.Soyoumaynoticethelackofthoroughbackground explanation on the history of military/alien abductions and mind control. There are so many other materials out there that amply cover the basics, including government documents, that I didnt want to re tread over old ground and bore readers by going over material that theyremostlikelyalreadyawareof. Also, some authors make the mistake of writing on the defensive, preemptively addressing the skeptical and inflammatory comments that they imagine the readers to be thinking as they read along. You wont see that here, because its a big pet peeve of mine! Its a disservicetothosereadingthematerialwhoalreadyknowittobetrue, and a waste of time, paper and words. The biggest chunk of the audience reading any conspiracy or paranormal book are going to be people who already believe in it. Thats why they picked the book up in the first place. Skeptical critics who cant relate usually arent going tobereadingitanyway,sotheresnoneedtoworryaboutthem. The focus of this write up evolved over time, eventually becoming what primarily amounts to tactical tips and insights gleaned from my ownexperiences,aswellasanattempttoinjectafreshperspectiveinto

Introduction

iii

the works concerning certain topics. So this write up is very personal you could say, definitely not presented in a detached, stuffy, academic manner, being that I relay stories and experiences from myself and people who have been close to me over the years. When sharing personal experiences and insights, downtoearth accessibility is the key. Serious and stuffy just wouldnt work! All of which means youre going to see some of my informal writing style mixed throughout, including emailstyle smilies and laughing faces to indicateahumoroustonethatwordssometimescantconvey.;) Sowiththatinmind,sitbackandenjoytheride

P I tI rt ar Pa
MILABS and Mind Control

Thetermabductiontendstothrowalotofpeopleoff.Thanksto decades of UFO lore, the term now has a dramatic, grandiose connotation associated with aliens. Ive met people who exhibited telltale suspicious indicators of having been tinkered with via military/government experimentation and programming, but who have shied away from pursuing the possibility or were skeptical of it all because the terms abduction and abductee sound so extreme. These terms make it seem that a person is in regular ongoing contact with space aliens, floated out of their room onto UFOs as commonly portrayed in mainstream literature. This is definitely not the case for many peopleand yet theres no doubt that they have funny things happening to them. Anomalous dreams, paranormal happenings, markings on the body that werent there when they went to bed, odd family situations, noteworthy psychic/intellectual talents and abilities that sets them apart from the average personsomethings going on with them, but the term abduction as its commonly understood doesnt really fit their more subtle situation. As a result, these people may wind up dismissing things and walking away, which is unfortunatebecauseoftentimesthereisastorygoingon. Abductions arent always alien in nature far from it in fact. So letsreviewthevariouspossibilitiesofwhostakingwhom,andwhy Aliens, Military and MILABS There are two main perpetrators in abduction literature: The aliens, and the military. (Theres also a minor third one thats emerged recently thats worth mentioning, supposed time traveling humans,usuallytallandNordic/Aryanlooking,withinterdimensional capabilities, whether it be humans from the present whove gone back you could say, and planted themselves into the past, ancient advanced humans who achieved higher density status and are tinkering with us in the now, or advanced humans from the far future coming back to the past. But whichever one it is, it supposedly involves humans, and often times with Gray cybergenetic helpers to boot.)

Chasing Phantoms

UFOsandalienabductionsreceivefarmoreattentionthanmilitary abductions however, and could even be labeled a national obsession considering the number of books, articles, movies, television specials, websites, and yearly conferences held around the world over the past thirty years. Its a topic that has become a threering circus, complete with its own celebrities, and rife with disinformation, confusion and distractions. Military abductions on the other hand could be considered the black sheep, a subject that the general public seems to have the least amount of knowledge of and the most resistance to hearing about. Somehow the idea of alien invaders taking us and probing us is easier to accept and process and certainly more fanciful than the idea of humans taking and abusing other humans against their will and zappingtheirmemories,oreven falsifyingthemaltogether.Especially whenitconcernsinstitutionsthatthepublichasbeentaughttothinkof as noble, patriotic defenders of democracy and freedom! So alien abductions get nearly all the attention, whereas military abductions/programming get the cold shoulder or flat out suppressed. MILABS, the term for military abductions, was coined by Dr. Helmut Lammer and is the title of his book by the same name. It involves civilians being tailed, harassed, abducted, interrogated and even implanted and programmed by military spooks following on the heels of their alien abductions, with the (supposed) purpose of trying to learn more about the aliens. The accepted logic within abduction lore being that the military wants to learn as much as possible about the alien presence by abducting and tracking the same people the aliensare.However,asmentionedearlier,manypeoplehavefarmore subtle situations happening, so that particular grandiose definition of MILABSwouldntbeaccurateforthem.ForthatreasonIveexpanded my usage of the term. There are the military personnel and possibly even their offspring and spouses who are being taken and used for mind control programs and various side projects and purposes, unknown to them, and probably completely unrelated to anything having to do with aliens. There are also the people who claim to have been taken by human military/government agencies and brought to either above or below ground bases where they witnessed military personnelworkingincahootswithvarioustypesofnonhumanbeings

Part I MILABS and Mind Control

Reptilians, Grays, Amphibians, etc.; a situation where the military is already well aware and quite knowledgeable about the alien presence and isnt needing to take people in order to learn something about it all. So for me personally I have expanded my usage of the term MILABs to include any situation that involves human military/government taking people whether theyre taking and experimentingon/programmingmilitarypersonnelandtheirfamilyor civilians,orwhethertheyreatoddswithaliensorworkingrightalong with them. And thats how Ill be defining and using the term for this book. In my research Ive noticed a bit of conflict regarding the alien aspect of MILABs. Researchers, including abductees and supposed survivors of military black ops mind control projects, cant seem to agree on how aliens fit into the equation or if they even do at all. I personally believe in the concept of aliens. I dont think we got to where we are today without the help of something else along the way, and all the evidence seems to be pointing to nonhuman intelligences manipulating the affairs of Mankind, and steering the direction of life on Earth in general, from behind the scenes. There have been several excellent books that offer up convincing evidence with regards to this whole subject so I wont get into it all here. But consideringwherehumanityhasgoneinsuchashortperiodoftime,it almost seems pretty farfetched to believe otherwise. Where did The Powers That Be suddenly get this technology from? I suppose we could have gotten there on our own. But to go from the gritty industrial age in the late 1800s to computers, lasers, genetic engineering, satellites and space flight just to name a few things withinroughly7080yearsseemsoh,Idontknow,prettyweird. Following are two examples of cautious skeptics who believe in covert military abductions and activity, but yet doubt the idea of a military/alien alliance. In the aforementioned book MILABs: Mind Control & Alien Abductions by Dr. Helmut Lammer and Marion Lammer, we see an interesting refusal to accept the possibility of military factions working in cahoots with aliens/Reptilians. Bolded wordsmyownemphasis:

After the description of the reptoidlike being she remembered how she was raped by this creature. We dont know what this traumatic experience means. We dont think, however, that the military

Chasing Phantoms

worked with this reptoid creature. It could be possible that Michelle was drugged with an hallucinogen, raped by a human and projected the reptoid as a kind of screen memory, although she described the skin and other features of the creature quite realistically.page49

Since manypeople havephobiasabout reptiles or snakes it would be logical that they would experience such beings if they were on a gruelingLSDtrippage50

Deloras(pseudonym)fatherwasacareerNavyofficer,inthesupply corpsShe believes that she saw aliens and humans performing medical procedures on themDelora believes that the humans in the capsules were clones. It is more probable that the humans in the capsules were used for secret biowarfare or chemical warfare experiments, since cloning technology was certainly not well developed during the 1960s. It is more likely that the supposed aliens who worked with human doctors were medical staff who covered their faces with surgical masks or wore biohazard clothes. page5556

The Lammers find it easier to accept the idea that the military was keeping people in capsules for covert biowarfare experimentation versustheideaofalienscreatingclones.Boththeoriescanseempretty far out there, and neither one is more believable than the other, in my opinion. The refusal to accept one while grappling at the other could show distress/denial, unconscious programming, or a conscious agenda on the part of the authors. What also stands out for me is the faulty, missing the point logic in the last excerpt about cloning technology not being well developed in the 1960s. Well of course humans didnt have that level of technology back thenbut aliens would have. And thats exactly who Delora was speaking of in these excerpts. Another example is an excerpt taken from the book Close Encounters of the Possession Kind, by William Baldwin, Ph.D. Dr. Baldwin is a hypnotist specializing in entity/alien attachments on people and how to rid their presence. In the following excerpt, an

Part I MILABS and Mind Control

attached alien entity harasser is speaking directly to Dr. Baldwin throughthehypnotizedsubject.Boldedwordsaremyownemphasis.

These beings were conducting some sort of mind control experiments on many humans, with permission by some human authority, and absolutely refused to cease their operations. As the therapist and facilitator of the sessions, I usually make a demand for the clients sovereign rightof individualfreedomandfree will insuch cases.Usuallyitworks,sometimesnotsowell.Thisbeingdisdainfully agreedtoreleasethisonewomanfromtheproject,butnooneelse.

ThisarousedmycuriosityandIasked:

Dr. B.: How many humans on this planet are you affecting in this way?

Theimmediate,unmistakable,andominousreply:

C.:Askyourgovernment.

Father perceived him turning his attention away from us. We were unimportant to him, as was the single female subject he had just discardedfromhisproject.

There was an unmistakable feeling of malevolence and personal threat. That was enough. While I do not concur with the conspiracy theorists regarding the GovernmentET connection, I believe the intelligence agencies are capable of covert nefarious activities involvingcitizens.

page5152.

Dr. Baldwin wholeheartedly believes in aliens and demonic entities. He acknowledges his belief in nefarious, covert intelligence agency activities, and later on in the book expands on this topic when he mentions the CIAs MK Ultra mind control experiments. Yet.he cantreconcilethetwosidesjoiningforces.Additionally,theresanot sosubtle message being conveyed by labeling such a belief as being in the realm of conspiracy theorists. Last time I checked, both a belief in aliens and acknowledgement of covert, nefarious activities on U.S. citizens by intelligence agencies was also in the realm of conspiracy theorists,accordingtothemainstreamworld,butnevermindthat.;)

Chasing Phantoms

Close Encounters of the Possession Kind is still highly recommended though, despite that lone, puzzling comment about not believing the conspiracy theorists who talk about an alien/government alliance. However, MILABs has always struck me as being a mixed bag. It addresses this clandestine topic, making it seem like its on the side of the abductees who would be reading it to get answers, only to turn around and subtly undermine peoples experiences concerning a military/nonhuman intelligence alliance, as well as the use of cartoon illustrations throughout. The comic bookstyle pictures give the book, and the topic as a whole, a silly feel. Maybe someone somewhere realized that in order for the book to be allowed out there it had to be donethatway?Or,itcouldbeacovert agenda,Idontknow.All I can do is suggest for people to be alert when reading any material thats prominently out there discussing military or joint alien/military abduction operations. Comb through it carefully, and be perceptive to possiblesubtleundermininggoingonattemptstoplaydownoreven flat out dismiss certain sensitive subject matter, skipping over material that should be covered while focusing heavily on something that doesntseemallthatimportant,speakinginblack/whiteabsolutes,etc., andsoon. Ultimately, everybody has to make up their own mind about whether there really are aliensand if there are, whether they are working with factions of the human population. I can only speak for myself, as somebody who has witnessed hyperdimensional happenings and interacted with nonphysical entities from other realms. I have my own proof that this aspect of reality is real, so its not a stretch for me to imagine a merger of those realms with humans/government/military. For this reason, Im going to approach my book from that particular point of view, addressing topics which involvethenonhuman/hyperdimensionalaspectofthings.

Causes for abductions

Military

How does one find themselves the unwitting target of military/government black ops abductions and/or experimentation? It canarisefromseveralpossibleavenues:

Part I MILABS and Mind Control

1. Beinginthegovernment/military,eitherinthepastorpresent; 2. Having indirect ties to the government/military through a parentorspouse; 3. Societys throwaway kids in jails and juvees; possibly incarceratedadultsaswellandthoseinmentalinstitutions; 4. Being abducted by something else, i.e., aliens, which in turn generatesinterestfromvariousmilitaryfactions.

And in doing the research, it seems that MILABs targets are being usedfor:

1. PSI work Remote viewing, psychic warfare, psychic experimentationtelepathy,telekinesis,astraltravel,etc. 2. Technologicalexperimentationimplants,microwavesignals, cloakingdevises,holographicreality,etc.Voicesinthehead, remote thought influencing, what can they get people to believe, how can society as a whole be influenced to go down thepaththeywant. 3. Hallucinogenic mind control experimentation testing the effects and potentials of LSD and other psychedelic drugs; Experimenting to see how the human mind can be bent and shaped and reworked. However, probably more of an interestbackinthe1950s70sthanpresentday. 4. Programmed sleeper agents, aka Manchurian Candidates. Compartmentalization of the brain via traumabased mind control, drugs, hypnosis and electroshock. Victims used as an agent provocateur, for criminal work, terrorist activity, assassinations; sex slaves, Presidential Model message couriers, the porn industry, etc. Somebody who can be programmedtosuitanyagendathatsneeded. 5. Learn as much about the alien presence as possible by interrogating, implanting and monitoring alien abduction victims.

Letsgothroughsomeoftheitemsonthefirstlistinmoredetail:

Chasing Phantoms

1. Themilitaryabducting/experimentingonitsownpersonnel

Based on my dads story, which I get into in detail in the separate corresponding Appendix section, http://www.in2worlds.net/abductions andbasedonothermaterialsIhavecomeacross,myconclusionisthat the military is always scoping for talented recruits those who have certain natural, latent abilities. One of the ways they can discover whos who is through the Military Aptitude Test (MAT). Theyre not justtryingtofigureoutwheretoassignyoubasedonyourintelligence and natural skill inclination, theyre also trying to figure out What can you do for them? Are you a good candidate for any of their side projectexperiments? AninterestingexcerptIfoundinCarlaEmerysSecret,DontTell mentionsthisverything(boldedwordsmyownemphasis):

The government was pursuing exactly that line of research: creating an artificialsplit personality out of an imaginary childhood playmate...An imaginarychildhood playmate isamarkerfor hypnotic susceptibility. It can also be a point of fracture for artificial personalitysplitting.

R.J.,aformerRangerandVietNamSpecialForcesretireetoldme,in 1991,everyone who is going intoany branch of themilitary takes the MilitaryAptitudeTest,theMAT.Itasksseveralquestionsalongthose lines: Did you have imaginary playmates? How old were you when you quit playing with your imaginary friend?Almost ever person who goes into a Special Forces unit has had a childhood imaginaryfriend.Idid.Hewasameanguy.HedidthingsIcouldnt do.page60

I have no idea if my dad had an imaginary friend when he was a youngchild,butcertainlythatwouldntbetheonlypotentialindicator theyre looking for. I didnt have imaginary friends, yet Im still extremely susceptible to hypnosis and have clearly been taken and programmed. So there are definitely other clues that can alert them that youre a prime candidate for something. With regards to my Dadssituation,herelayedtomethatassoonashetookhisMATupon enlisting in the Navy, hewas in essence, whisked away you could say. He was able to skip his two weeks of basic training based on those MAT results, which according to him is pretty much unheard of as far

Part I MILABS and Mind Control

as he knows. Then he was immediately assigned to be a Tech Personnel, translating Morse code into type. A very difficult task that most people cant do. Many people can barely type adequately.let alone be able to simultaneously translate Morse code...let alone translateitatover8090wpmtypingspeed.Butmydaddid.Andhis next four years in the military found him experiencing what could be consideredpreferentialtreatment,strangeincidentsofpsychicsurging, close calls with death where he always seemed to have a bubble of protection around him, and even a close encounter with a UFO that appeared over a base in southeast Asiawhere he was standing directly underneath it. Based on further details my dad provided, it seemed that he was definitely being used for something on the side duringhistimeinthemilitary,anditprobablydidntstopafterheleft. Following is an excerpt from a message board posting that was addressed to me on August 19, 2003, regarding one mans experiences when first enlisting in the military. He had been posting his strange and unusual experiences plaguing him throughout his life, including psychic phenomenon and funny phone calls from unknown sources, with a male voice saying very pointed things to him. For someone who has never researched this topic his stories would go right over their head, but after reading some of his posts I recognized what seemed to me to be military mind control experimentation. I took the chance and posted something back to him, broaching the subject, mentioninghowhisstorieshavethetrademarkofsuchwrittenallover them. Here are the relevant excerpts from the more detailed response that he posted back, (content kept as is, including any writing errors, boldedwordsmyownemphasis):

Iftherewaseveradirectinvolvementwithwhatyouarespeakingof, I know exactly where and when it would have occurred.I will start by saying that I was not in the military for any length of time beyond 12 weeks of basic training. There was some medical problems and I had to be released.I had scored extremely high on my ASFAB aptitude test before entering the service. I was going to go Marines, but opted for the Army at the last minute with a friend. I specifically was going for Airborne and whatever that would lead to. One day, one of the Drill Sgts. read some names aloud and told several of us to get on a bus with blacked out windows. We were driven to a remote location and told to enter some building. We were put in a

10

Chasing Phantoms

roomandthisguycomesinandtellsusthatweweregoingtolistento some tapes of a man talking over a speaker system. He was going to speak a foreign language and the tests were going to see if by just listening to the cadence and inflection in the mans voice, whether or not we would be good candidates to go to interrogation or linguistic training. I am an excellent test taker, but never had an affinity for foreign languages. I mean, I like them, hearing people express themselves,butIreallyhadnointerestinlearningone.

I remember that I stopped answering the questions after only 3 or 4 as I really wasnt interested in speaking a foreign language, but after that, everything else seems blank. Seriously, I dont know if I took the opportunityto go to sleep or what,but I dont remember getting back on that bus to go back to the barracks some couple of hours later.ThisisabouttheonlyinstanceIcanrecallofmissinganyperiod oftimefrommylife

I think its safe to say that the military has many secondary layers toit,andnationaldefenseisonlyonebitofwhattheyreactuallydoing with their recruits. And its a shame too that so many nave young menandwomenenlisteveryyear,notrealizingwhatsreally goingon behind the scenes. Theyre signing away their bodies and lives, in more ways than one. And even worse is the fact that once you sign yourselfaway,itapparentlydoesntendafteryourtimehasexpired.It seems that the military believes they own their personnel forever. It really is like signing a contract with the devil when you think about it. Even if you somehow manage to back out, or find an excuse to be dischargedbeforeyourtourisuptheyvealreadygotyourinformation and have your MAT/IQ test results, and youve possibly already undergoneoneormoreprogrammingsessionswhetheryouknowitor not. You become permanently on record, and theres no undoing that. At this point, considering the documents that have been declassified whichflatoutadmitto thegovernmentandmilitary experimenting on unwitting personnel and civilians over the decades it amazes me that people would still enlist at all! MK ULTRA, Projects ARTICHOKE, CHATTER, BLUEBIRD, OFTEN, and the list goes on when you do the research.Andthosearejusttheonesthatthepublicnowknowsabout.

Part I MILABS and Mind Control

11

2. Beingfamilyofmilitarypersonnel

Its my theory that if themilitary finds a particularly useful subject for their side projects they would therefore be interested in keeping tabs on that persons offspring down the line in case the children inheritsomeofthesameorbettertalentsandabilities. In addition, for those people who are working in the capacity of nationalsecurityandintelligence,theiroffspringseemtobemonitored andprogrammed.Forwhateverreason,Idontknowexactlywhy,but its something Im beginning to realize through my research and personal experience. Time and again youll find that so many abductees/mind control targets have parents, (usually fathers) in the military,andoftentimesworkinginthecapacityofnationalsecurity and intelligence. My own father was Navy, reporting to the NSA for intelligence, aka spying, during Vietnam, and several female MILABS/military targets that Ive known over the past few years, and ones that I had suspicions about, all had dads and sometimes even grandfatherswhowereintheNavy. I received an email from a woman recently while doing this write up who was wondering if her fianc could have mind control programming. The fiancs family fits the profile of my ex boyfriend Steves family, nearly to a T: The father working for the government with nuclear weapons engineering; the fanatical Christian/Catholic mother who was mentally unstable while simultaneously trying to uphold the image of the Perfect American Family, and the son with the compartmentalized mind, who cant remember his dreams and believesthathedoesntdream,butyet,talksinhissleep.Bothfamilies did have differences, and the story of her fianc is more like a combination of my brother Joe and my ex Steve if you were to mix both together, but the fact that there could be such a similar profile of sorts was utterly amazing to me. What are the implications of that? The biggest question she asked though, which got to the core of the issue, was Why? Why would the kids of these military personnel be targeted for programming? What purpose does it serve? What are theybeingusedfor?? All I can do is theorize, because only the people instilling the programming know why theyre doing it and what long range purpose it servesif any. It always reminds me of the 1997 movie

12

Chasing Phantoms

Cube, where its revealed that there is no point to the Cube experiment, and there is no one person in charge of it all within the government. Ive actually had the thought that its almost as if theyre just creating nonsenseworkattheexpenseofpeopleslivesinorderto keep themselves busy so they can remain on the payroll. Another major possibility is that somebody out there would like to create whats known in mind control research as an army of sleeper agents, each individual programmed to fulfill the agenda of TPTB years down the line. The only problem with this theory is that to program thousandsofindividualswhoeffectivelyserve asa programmed army means that its organized, and the programmers know what the long termagendaactuallyis,andhowitwillallunfold.Itseemsfarfetched. The future holds too many unknown variables, and nothing ever goes asplanned,evenforthem. Sothemoremoderatetheory,whichsitsneatlyinthemiddle,isthe concept of guinea pigs. Forever testing and experimenting on personnel and their families to refine mind control techniques so that later down the line, (meaning, right now, and beyond) when these techniques are needed as the agenda unfolds, they will already knowthemostefficientmannerinwhichtogoaboutthingsfrom their yearsofresearchandwork.Thisisbasicallysayingthatsomebodylike my ex, and the fianc of the woman who emailed me, as well as hundredsoreven thousands of others over the past few decades, were justdisposableguineapigs.Andthatcouldverywellbethecase,since often times, it seems as if these people are tossed aside and forgotten aftertheyvebeenexperimentedon.

3. Targetingjuveniledelinquentsandinmates

Several years ago I came across an article that I now highly recommend, Operation Open Eyes: Mind Control in Amerika 5 Easy Steps to Create a Manchurian Candidate by Gunther Russbacher, who apparently used to be second highest in command in theCIA. http://www.rumormillnews.com/operation.htm In Gunthers piece he outlines the governments process for selecting and programming societys throwaway kids and juvenile inmates to become Manchurian Candidates programmed sleeper

Part I MILABS and Mind Control

13

agents designed to be used as assassins, criminals, and all around agent provocateurs. The reason this piece jumped out at me was because I recognized what I was reading as being my younger brotherssituation,throughandthrough.MybrotherJoespentages14 through 17 locked up in various juvenile detention centers and mental hospitals in Connecticut, after going on a convenience store robbing spree at the age of 14. The Joe that emerged from his time in lock up wasnotthesameonewhowentin.TheoldJoewasspaceyanddrifty, in his own world, and struggled in school. He had the criminal potential, obviously, or he wouldnt have been locked up in the first place, but his skills certainly werent honed by any means. The New Joe was somebody that I consider to be a killing machine: proficient in hand to hand combat and not afraid to kill. This new Joe saw and noticed everything, and when he was out and about in public he was always on, ready to pounce. He also had inexplicable knowledge of all things relating to electronics even though hes never studied the subject a day in his life, was pulling straight As like it was nothing once he was mainstreamed back into public high school, displayed a split off multiple persona named Shawn Hill (which I get into later on in Part III) and now experienced abduction flashback memories, missingtime,andwasbeingfollowedandmonitoredbyThem.Our long distance phone conversations were being listened in on, with the accompanying noise disturbance and they would apparently follow him around in cars and such. Something happened to Joe while he was locked up, and when I read Gunther Russbachers piece so much ofitmatcheduptoJoessituationthatInowreferpeopletoreadit.Joe was later given agent provocateur assignmentsthings I had to talk him out of. He would tell me with glassy far away eyes and a dazed smile what he was supposed to do, for them, to prove that he was ready for the next level. It was exactly what Gunther outlines in his article. As with my own situation however, there was not just one thing going on with Joe. In my opinion he was already an abductee, going backtochildhood,andwhateverhappenedtohimwhileinlockupwas just one more layer of a multilayered situation. In Joes case, he said thatatVitamheconnectedupwithasecurityguardwhowasaformer Navy SEAL and chose Joe, along with several other specially selected boystotakeunderhiswingandteachhandtohandcombat,andother skills to on the side. And possibly the guard may have referred Joe

14

Chasing Phantoms

on to something higher, I dont know, because all of a sudden something became VERY interested in monitoring and keeping tabs on Joe once he was releasedand then interested in me, for being so closely involved with him in life as his sister. And of course it was after he was released that he has abduction flash back memories, missing time, and also when he developed his splitoff alternate persona, Shawn Hill. So Juan, if he was really real, seems to be one piece of the puzzle anyway, although certainly not the only one. But this does seem to be a very real thing happening in Americas incarceration system, for both youths and adults, and needs to be mentioned. If you do the research, you will find articles and declassifiedgovernmentdocspertainingtothissubject. ***** On a side note: Tying this back into items 1 and 2, many many people are probably being taken and used, (see the section called Multiple Personalities vs. Multiple Personas for more on this) and out of all those people that are taken and tinkered with, probably only asmallpercentagewillwindupbeingusefulfortheminthelongterm. Most will have to be sifted out, due to any number of reasons which will cause them to fall to the wayside programming doesnt stick, or has damaged the psyche beyond what they can use; maybe their profile isnt right, and so on. So what happens to all the ones that are rejected, discarded, or who just got phased out over time? Well, theyre still out there in the world, living their lives. And they probably have a few observant friends, family members or significant others who notice strange quirks about them, which initially make no senseunless theyre lucky enough to stumble across books or articles about mind control which describe these people and their situations to a T, allowing for the observant person to begin making some aha! connections. Unfortunately though, most people wont cross paths with material about mind control and abductions, so most ofthesepeoplesstoriesnevergotresolved.

4. Themilitaryagainstthealiens

There are two types of alien/military abductions being reported: One where both sidesare working together, and one where they are at odds. Regarding the latter, some military abductees claim to be

Part I MILABS and Mind Control

15

abducted by the aliens first, with the military spooks following close on their heels. This type of abduction often involves military personnel intensely interrogating the abductee for any information they may have regarding their alien abductors. The use of force, intimidation and threats are reported, with the interrogators berating theabducteeintorevealingwhattheyknow. Taking excerpts from several books regarding MILABS, we see this:

After this confrontation the men in the lab coats and military man took her [Melinda] to an interrogation room. She described in detailhowtheywalkedthroughhallswithvideocamerasonthewalls and metal doors. Inside this room was a table and chairs. Melinda was forced to sit on a chair and one man in a lab coat gave her a shot in the arm and a strange drink. After this she felt high. She was very frightened as she felt one of the men grasp her on the cheeks. A man in a white lab coat stood behind her and a spotlight shone on her chair. A redhaired military officer asked her questions concerning her alleged alien experiences. Strangely, it appeared that they wanted information about UFO technology. He asked her, What have they asked you? Tell me about their technology? Tell me about the drive system, the drive mechanism? You tell me about what they told you todo!Whatdidtheytellyou?Whatdidtheyaskyoutodo?Tellme, tellme,tellme.Youknowyouarenottheirs,youareours! Afterthesessionshewasbrainwashedbythesameperson.

MILABs:MilitaryMindControlandAlienAbductionsDr. HelmutLammerandMarionLammer,page140.

It was sometime in the winter of 1993 when they went the farthest theyd ever gone. I lived alone in my own apartment on Milwaukees east side, when I had one of those waking dreams. But thistimesomethingwashighlydifferentandnotverydreamlikeatall. In fact, I was wide awake in the middle of the night, in a place that wasnotmybedroom. Iwasinasmallofficewithalargepanewindows,andIknewthat this place was located underground somewhere. There was vomit green pain bordering the room with a pale yellow or offwhite paint onthemainpartofthecementblockwallsthatsurroundedme.Iwas

16

Chasing Phantoms

sitting in an armless chair, in front of desk where a man in his mid thirties stood. He wore a white shirt with a navy blue tie, and closely cut hair. He was leaning over the desk glaring at me, pounding his fist and demanding at me, You have to tell us where they are! You got to help us find them! There was a guard standing directly to my right who was dressed in a typical, military camouflage uniform, holdingarifle. Help you? Find who? It then began to sink in that something wastrulywronghereandIexclaimed,Holdon,whereamI? Immediatelyfollowingthatstatementoneofthemsaid,Oh,shes wakingup!ThensuddenlyIwasoutagain.

TheSecretWarHeidiHollis,page131

A third controversial topic avoided by many researchers focuses on military involvement with aliens and abductees. For Lisa, as is so oftenthecasewithabductees,thefirstmemoryofapossibleencounter withthemilitarysurfacedinadream. I was being interrogated by the military, she said, pushed and made to lie crouched on the ground. In the back were some trucks, and beside them were guys in black uniforms standing watching me. The men asking questions were in regular military clothes. They held me down with the butts of their guns. They told me to give them the knowledge and they said at any cost. I told them I didnt know what theyweretalkingabout,andtheyjustrepeatedthemselves

TakenKarlaTurner,PhDpage75

Intheseexamplesthereseemstobeacleardelineationbetweenthe aliens and the military. Neither group seemed to be working together, and the government interrogators were obviously out of the loop in regards to what was going on. They were always a day late and a dollarshort.Anotherfeatureistheantiquatedmethodsofinformation extraction drugs,threats andintimidation,pounding onthedesk and waving a gun around. But if these memories accurately represent what really happened, and these military factions truly had a need for interrogations to extract information, then its safe to say that they wereprettybottomrunglevelbasedontheirmethods. Of course when it comes to this subject nothing is what it seems to be, and there could very well be a strong possibility of games, and

Part I MILABS and Mind Control

17

reverse psychology going on here. When I read these interrogation scenarios they always strike me as being so goofy and over the top. Something seems wrong and off about them, and I wouldnt be surprisedtolearnthattheywereallanotherlevelofmindgamesbeing playedontheabductees. Whenlookingatthisissuecloser,whatIvewonderedis:

Doesthemilitaryreallybelievethatbyholdingaguntoanabductees head, screaming at them and threatening them that this will elicit coherent, calm, indepth answers about the aliens? I dont know aboutanybodyelse,butIdprobablybeabitshakyandhavemymind goblankifIfoundmyselfinthattypeofsituation.

Do they really think that a female abductee whos been flat on her back on an aliens examination table, being poked and prodded, is going to be able to tell the military spooks what sort of UFO drive technologythesealienspossess??Again,Idontknowaboutanybody else, but even if I hadnt been flat on my back being examined I still wouldnt be able to tell you anything about their propulsion technology. The average human, female OR male, would never understandthatsortofthing.

Then theres the fact that most alien abductees dont remember their abductions, period, unless under hypnosis. And even then its tricky business. But the military expects that the target will remember these detailswhileawakeandwithaguntotheirhead?

So sure, maybe the military really is that stupidor maybe these interrogationscenariosarearuse. One purpose these interrogations serve is to reinforce and prove the idea that there really is a war between the aliens and certain factions of the U.S. military. But what if there isnt? What if the military is in full collusion with them but doesnt want the public to realize this? How convenient would it be then to have abductees running around with memories which they were allowed to remember proving that See, the military really is in the dark about the aliens. Theyre always a day late and a dollar short! They dont have a clue, but theyre working hard to get answers! Again, its all about that double reverse psychology mentioned in the opening introduction. So much of whats going on in the world of abductions

18

Chasing Phantoms

requires multiple unravelings to untangle whats really happening here. Games within games within games. More researchers and abduction targets could benefit from learning how to think in this manner, scrutinizing and unraveling material and not just taking thingsatfacevalue. As an abductee I can say that its not common to have actual clear, coherent abduction memories. Were lucky if were left with a three second snippet flash, let alone something as complex as the above three excerpts. So that says to me that maybe, possibly, these women were allowed to remember these incidents, in the hopes that it would somehow make it out there and help prove the idea that the government really is at war with these beings. Because when you do the research, the real story seems to be that not only is the U.S. governmentworkingwiththesebeings,buttheysoldofftheAmerican publicinexchangefortechnologyandpersonaladvancement.

Trackingthealienabductee

A subissue regarding the topic of the military taking alien abductees for interrogations is: In order to even chase down the abducteeforinterrogations,howdidthemilitaryknowthatthealien abducteewastakeninthefirstplace?Thatpartisskippedoverinthe sources Ive read and is an actual plot hole of sorts. Maybe nobody actuallyknows,ortheyfeelitsalreadyimpliedandunderstood. Themajorpossibilityhereisimplants.Anyalienabducteeisgoing to have some sort of implant designed for monitoring and tracking them. So its possible the government has technological capabilities to sniff out these implants. What sort of technology could be used by even the low rung military factions to locate any abductee, anywhere on the planet? When I thought about this it took me all of about two seconds to come up with satellites, which is one decent, manmade technologythatsbeenaroundsincethe1950s.Stillanotherpossibility is that the government has developed their own technology to detect a disturbance in the grid, and so when UFOs and nonphysical aliens are popping in and out of 3rd density, plucking people up and dumping people off, then the military spooks are sure to follow close behind. From there, its almost a given that the government/military abductors would in turn implant the abductee using their own

Part I MILABS and Mind Control

19

implants for their own monitoring purposes. It basically becomes a tugofwar. The third possibility is that there is no war between the military and the aliens, which means that if both sides are actually working togetherthenitwouldbeknownwhenanyperson(intheU.S.atleast) isabductedbyaliens.Sothatwouldnegatetheentireissue.

Hyperdimensional

Causes for abduction by hyperdimensional entities can be due to anyofthefollowing:

An individuals particular energy frequency. Many people, due to who they are frequencywise/soulwise, may gain the attention of stuffinotherrealms,forgoodorforbad.

Requestingtobeabducted.The35+yearalienandUFOcampaignin the media has done an excellent job of indoctrinating the public with the images of aliens as something cool. There are New Age/proalien authors and researchers pushing the idea that these beings (whatever theyare)aregood,sothereforeinvitethemintoourlivestoabductus. And their readers often oblige and follow along. Big mistake. And in some cases it makes many of these people feel good to be one of the specialchosenonesselectedforabduction.

Genetics/family line. Stuff also seems to have a keen interest in particular genetic bloodlines. As noted by the late alien/MILAB researcher Karla Turner, in her book Taken, particular racial nationalitiespopupagainandagaininabducteeprofiles.Irish/Celtic, and Native American are two biggies. I read an interesting theory on a message board as to why the big interest in those of Celtic and Native descent namely, take a look at what these groups and their ancestors were like. Back in the days of the Romans, the Celts would go into battle wearing nothing but silt/clay in their hair and blue dye ontheirbodiescalledwoad,andgoldnecktorques,whippedupintoa crazed, trancelike frenzy, totally befuddling their enemies. It was as if they temporarily slipped out of 3rd density and went someplace elseyoucouldsay.AndtheNativeAmericansasawholecanalsobe very much the warriors, and known for their shamanic, psychic, trancestate abilities. So something maybe has a big interest in these

20

Chasing Phantoms

particulargeneticbloodlinesfortheirnaturaldisassociative/tranceand psychiccapabilitiesandabilitytoslipintootherrealms.

For myself, Im Irish, English, Hungarian, Italian and Scottish, and may even have a smidgeon of Asian apparently, via the Hungarian line. Irish and English are the dominating nationalities. And Ive been independentlytoldbytwoverypsychicwomenthattheressomething goingonwithregardstomybloodline.Oneofthemspecificallynoted that there was a convergence of bloodlines with me. I have an idea of what both women were talking about but wont side track onto it here. Another theory I have about the cause for abductions is that when somebody pops up in the 3rd density grid acting on behalf of the light, the nonhuman entities, of which includes aliens, are probably able to spotthis,andthenunfortunatelythesepeoplemaybetakeninorderto receivethesmackdown. Originally I had been tossing around a theory that every (souled, real) person out there is taken at some point during their childhood and tagged in some way, (implanted) then released. Everybody. In the same way that a farmer monitors and controls its herd, the negs andaliensandwhoknowswhatelsearemonitoringandattemptingto control us. But then I realized that might be thinking too human, because an alien entity who can pass through walls and who bounces back and forth between this realm and others at will is an alien with the technological capability, or innate ability, to scan the populations frequenciesforanysignofadisturbance.Sothismeansatbest,theyre probably relying on etheric implants and etheric scanning to track the population. I think possibly at this point that maybe its only the military black ops who use any sort of physical implant that can be detected in an Xray or removed from the body, but I could be mistaken. Its just theories Im putting out there for consideration at thispoint.

Part I MILABS and Mind Control

21

Detecting Abductions

Foreshadowing

Abductions are not completely unavoidable and undetectable. And when you become adept at reading the clues surrounding an impending abduction then youll probably become very good at dodging them, as well as not succumbing to the programming that comesaboutasaresult.TraditionalmaterialthatIvereaddoesntput an emphasis on how to spot and thus dodge an impending abduction.Forthatreason,thisisaveryusefulsubjecttogetinto:

Number sightings/ear tones/synchronicities. Can be hyper dimensional precursors as well as postabduction markers. An abductee may begin noticing that during particular times, certain numbers will keeping popping up around them, or that theyll get ear tones, a spate of synchronicities, deja vus, and so on. Ear tones if you can rule out tinnitus and other possible explanations may often be the result of monitoring if youre an abductee. And number sightings, deja vus, synchs and so on can indicate hyperdimensional timeline maneuvering/manipulation. Being that abductions are often hyperdimensional in nature, they leave markers in their wake happenings that seem beyond 3rd density. I expand on number sightings,synchronicitiesandeartoneslateroninthiswriteup.

Urges to go lie down, sleep, or even drive somewhere. Feeling uncharacteristically tired out of nowhere with an urge to go lie down can be a tip off to an impending abduction if you know that youre an abductee. More unusual and suspicious is the urge to drive someplace youd never normally go, with no logical explanation for whyyouredoingthat.IgetintothisabitmoreinPartsII&III. Also gettingtheurgetotakeanunusualroutewhentraveling,alonelyroad lateat night,etc. Thats why beingaware andalert is so important, so we can question urges or ideas that we get, instead of just blindly respondingtothemlikepuppetsonastring!

Intuition/SixthSense.Somepeoplehaveanaturalpsychicabilityand a highly attuned third eye that can clue them in when something is wrong. Ive experienced the bad feeling before an attempted abduction or when an entity was around in the area, lurking in the

22

Chasing Phantoms

wings.Soalwayspayattentiontoyourgutintuitionifsomethingfeels offorwrongbeforegoingtobed,orinanysituation.

Pets acting strange. Cats, dogs, horses, etc. have been known to exhibit out of character behavior when something unnatural is amiss. Manytimeswhenanentityhasbeenaroundinthevicinitymycathas beenknowntoactwacky.Animalsarehighlytelepathicandpsychic cats especiallyand havethe ability tosee things that humans cannot. So if youre an abductee, pay attention when and if your animal companion(s)exhibitstrangeandunusualbehavior.

Patterns to your abductions. Discussed later on in this piece, but often times, especially for MILABS targets, their abductions seem to run on a schedule. So if youve discovered what yours is, then be on theballduringthosetimesofthemonth.

After effects Since abduction memories are zapped and/or naturally or artificially compartmentalized, you have to look for other indicators after the fact that show something has happened. The following list includes a few of the main symptoms to be on the look out for, and runs the gambit from physical to psychological. Some of these items will be familiar to those whove studied up on the subjectsome however will not. I havent seen some of these things mentioned anywhere else, although they are compiled from my own personal experienceorfromotherabducteesexperiences:

Heightened psychic abilities/psychic surging. Reading minds of those closest to you, knowing about things before they happen, premonitions, etc., but specifically when youre suddenly doing this all day long out of nowhere, and/or when it lasts for several days in a row.Canbetheresidualaftereffectsofbeingusedforpsychic/remote viewing work in the instance of MILABs. Could also be the natural residualsofabductionsingeneral.

Psychological agitation and stress. Feeling traumatized and stressed out, nerves on edge, being skittish and jumpy when nothing has happened that youre consciously aware of that could explain the feelings. On a side note, if your pets are unusually skittish, jumpy or agitated at the same time youre experiencing it as well, this means

Part I MILABS and Mind Control

23

something. It may not always be in regards to abductions, possibly you (and your pets) are psychically tuning in to something else thats nonabductionrelated.Butifyouareanabductee,thenitssomething tokeepinmind.TherehavebeentimeswherebothmycatandIwere jumpy/traumatized during the same several days time period. It alwaysmakesmewonderwhethershecanrememberwhatIcant.

Programmingurges.Coveredmoreindepthlateroninthiswriteup, but feeling urges to do things that are out of character. An urge to drive somewhere or go someplace you wouldnt normally visit, or engage in an action that is unlike your normal behavior. Can be indicative of posthypnotic, postabduction programming commands.

Personality shift. Feeling markedly different from your normal self fornologicalreason.

Being in a blank daze, stupor. Feeling like you could just lie around and stare at the walls and do nothing for abnormally long stretches of time, no motivation, creativity or will to do anything, with no reason for it. Repeatedly slipping into a trancelike state way too easily throughouttheday.Thesecanallbesignsthatyouwererecentlyina deep trance and may not have fully emerged from it, and/or were drugged,programmed,orreceivedelectroshockprogramming.

Physicalailmentsandanomalies.Wakingupfeelingdrugged,orlike youwererunoverbyatrainasIputit;havingpinkeye,nosebleeds, and pains in your body; anomalous bruises and geometric shaped markings, punctures, scoop marks, rashes, lumps, burns or scratches that werent there before you went to bed; if youre a female, experiencing pains in your uterus area and other abnormal problems with your reproductive organs. There is a section on my website that expands more in depth on these anomalous markings, and includes photos of some of my own marks for illustration: http://in2worlds.net/anomalousmarkings

Missing time. One of the most commonly known indicators. Either arrivingsomeplacewithseveralhoursmissingthatcantbeaccounted for, or waking up feeling as if its only been several seconds/minutes since you went to bed, when in fact it may have been 1012 hours and you have no dream memories in between. And more so if you normally dont sleep for that long and normally have dreams, and

24

Chasing Phantoms

especially when you have some of the other telltale abduction indicatorsgoingoninconjunction.

Strange dreams. Having strange and unusual dreams and I put that in quotes for a reason can be an indicator of having been taken. Dreams are sometimes anything but, so examine your dreams closely, and if they occur in conjunction with any of the indicators on this list, thenitsdefinitelysuspect.

Reversedinbed.Littlekidsseemtoexperiencethismorethanadults, but it seems something either has difficulty getting the coordinates rightwhenputtingsomebodybackintheirbed,ortheyredeliberately puttingpeoplebackintotheirbedsoutsidethecovers,andreversedin their bed. Related to this is when abductees wake with their clothes on backwards and/or inside out, items of clothing missing that they werewearingwhentheywenttosleep,orevenhavinggrassandmud ontheirnightclothes,asiftheyhadbeenoutside.

Waking up suddenly, gasping, as if just plunked back into your bed; Waking up with a cold body even if the room is warm, or feeling as if drugged, even though youre not sick and havent done anything to create that feeling; Waking with residual images of aliens and other suspiciousimagesinyourmind;Wakingupafterhavingonlysleptfor several hours but feeling as if you never slept at all, full of clear headed energy, with no memories of dreams. (This last item is a definitely an indicator of being taken if youre somebody who normallydoesdream,and/orfeelsgroggyandtireduponwaking.)

Number sightings/ear tones/synchronicities. Can be hyper dimensionalprecursorsaswellaspostabductionmarkers.Ivegotten numbersightingsandearringingsbothbeforeandafteranabduction.

Things tampered with. Noticing that stuff around your living quarters has been moved around or tampered with in some way, and you know that you didnt do it; extra miles put on your car as if you were driving it even though you have no memories of doing so. I havent experienced the car thing luckily, but its been mentioned in otherpeopleswritingssoImmentioningithere.

Part I MILABS and Mind Control

25

Methods for Taking the Abductee

There are several methods that Im aware of for taking an abductiontarget.Thefirsttwothatyoullseeinthefollowinglistseem to get all the focus at theexpense of the other two which are actually theonesthatmaybemorecommonthanwerealize.Letsreview:

Smash and Grab

Pretty much the only method Ive seen mentioned with regards to MILABs but which I know is not the only one is what Ive nicknamedthesmashandgrabmethod.Thisiswhere,accordingto the research, military Special Forces type personnel burst silently into your home, guns drawn, and stealthily make their way over and grab you. From there, they haul you outside and toss you into an awaiting van,thendrive to ahelicopterandflytothe base,or justdrivedirectly tothebaseitself. It seems like a lot of work, but yet, thats practically all we ever hear. For the past several years I scoffed at this idea only because to me, it seemed rather antiquated. Later I did eventually recall my own possible smash and grab memory from 1995, which confirmed that maybethisdoeshappen.ButmoreonthatinPartII.

Drive to them

Another snagging method Ive discovered entails getting the abductee to come to them, or at least, as close to them as they can get. Theabducteesuddenlyexperiencesanurgetotakeatriptosomeplace onawhimthatjustsohappenstobelocatednearabase.Nowthatthe target is in such close proximity to them, possibly the targets gets a smash and grab visit. Its something to keep in mind if youre an abductee, and a good reason to pay close attention to all your thoughts, urges and ideas, which I reiterate several times throughout thiswriteup.Itsbecausetheymaynotbeyourown.

26

Chasing Phantoms

Beam me up

The most interesting method of taking a MILAB is the one were not hearing about. Its the one involving Beam me up technology. Maybe abductees just arent aware of it, or possibly its deliberately being suppressed. But I believe it exists and that its in use, and its one way in which I, and my brother, (back when he was still alive) have been taken. I do have one experience that occurred in Portland Oregon in 2001/02, which seems to illustrate the existence of this technology. And a few times while living in Florida I had the roundaboutindicatorsofhavingarrivedsuddenlybackintomybed. Beam me up technology wouldnt work in the sense of breaking somebody down to the molecular level and then moving those molecules to another location. When I thought about it several years ago I came up with a (very basic) scenario that seems to better represent how this technology might actually operate. And keep in mind that this is coming from a person with absolutely no science or physics background, so, Im not professing to understand it on a complicated level. ! But possibly what happens is they tune in to your body and change your frequency, shifting you to a frequency that matches the receiving end, allowing you to slip through a doorway or portal, and emerge on the other side. How that portal is created is in itself a whole side topic, implying some nifty high tech quantum physics capabilities. I had an intuitive insight/image in my mind that accompanied this realization, which I doodled on a notebook at the time, showing portals in realms lining up enabling the person to slip through. So possibly its all about frequency adjustment, like changing the radio dial. The dial has to be changed if theyre going to pullyoutothem.

Soul/subtle body abductions

Growing up, the only type of abduction Id ever heard of were physical examinations taking place onboard a UFO. Later on, it was physical smash and grab style military abductions. Only at the age of 27 did I hear for the first time about something called soul abductions, where your subtle body/astral essence is removed from your body and brought to another realm. From there, etheric implants

Part I MILABS and Mind Control

27

can be attached, programming can be done, and so on. At first it sounded so farfetched that I was immediately skeptical, like, yeah, right, sure. How to you implant and program energy?? Eventually I had to consider the possibility once I began experiencing more overt abduction harassment that involved me clearly being pulled out of my body, (discussed in Part II). And then I eventually did come across some better material on the subject, namely the work of the late Karla Turner who talked about aliens plucking peoples energy essences, transferring them to cloned bodies, and so on. So, while people very well may be taken onboard a UFO during an abduction, soul/subtle body abductions seem to be a very real concept as well, but you wont find reference to it in most sources. Having knowledge of this mode of abductions may fill in some holes for people out there who know that theyre being taken, but yet, know that their experiences do not fit in with the standard UFO lore as weve been taught. Im also wondering if the advanced human black ops factions have figured out how to do this, being that they seem to be involved in some other, reallyfaroutstuff.

Implants
I believe that every abductee is implanted. It goes with the territory, so its a useful subject to look into. But admittedly, I know next to nothing about the subject, other than there are both physical and etheric implants, and that they serve a variety of purposes. Some of those purposes include: monitoring the abductee, influencing or controlling their behavior/actions, implanting thoughts into their mindswhicharenottheirown,and/orevencreatingthe voices inthe head phenomena, and affecting a persons energy/chakras in order to impact their health or even their psychic abilities. Other than that, Im notmuchofa help.AllIcandoisreferpeopletosomestartersources thatseemtohavesomethingusefulandinsightfultosayaboutitall. As with any material that I recommend, it doesnt mean I agree 100%withwhatsbeingsaid,orthewayinwhichan authormaywrite or present their material, or even that I support their views on other things they write about. It just means there was enough of something interesting and informative that it was worth passing along. The works that I mention here represent what I felt was a sampling on the

28

Chasing Phantoms

topic, from very different people who tackle the subject in their own unique ways, but who all have the common goal of educating the public about whats happening. But as always, the reader needs to discernforthemselves. On a side note as with all things relating to MILABs, were probably going to have very little current and accurate information on the cutting edge technology being employed with implants. So when you embark on implant technology research, keep that in mind you maybegettingoutdated,decadesoldinformation.

Microchip Implants, Mind Control and Cybernetics by Rauni LeenaLuukanenKilde,MD.

http://educateyourself.org/mc/implantsmcandcybernetics06dec00.shml

Implants:LocationsProblemsSolutionsbyLillyOchescu

Personalized article written by a female abductee regarding both physicalandethericimplantwarfare.

http://educateyourself.org/ww/implantsAlocation04may06.shtml

RogerLeir

Site devoted to investigating and removing alien implants. Includessurgeryphotosofimplantremoval. http://www.alienscalpel.com/main.htm

Casebook:AlienImplantsbyWhitleyStrieber Book that investigates implants which have been removed from abductees.Includesphotos.

CloseEncountersofthePossessionKindDr.WilliamBaldwin.

Interesting book that delves into the subject of alien entity attachments, and their etheric implants and techno gadgets that they attach to their abduction target. A good book for those who believe themselves to be an abductee, but hadnt realized this componentofitall.

http://www.amazon.com/gp/product/0929915224/qid=1151184587/sr=1 1/ref=sr_1_1/10346174251547042?s=books&v=glance&n=283155

Part I MILABS and Mind Control

29

Mind Control Programming

In this section I will review the basic methods for programming and compartmentalizingatarget.

Trauma-based mind control

Once we know whos getting targeted, and by whom, and the possible whys, we have to look at how programming of a subject is accomplished. There are enough (now outdated) materials floating about in the world which amply cover the subject of the governments secret mind control programs over the past few decades, so Iwont re treadoverawellwornarea.ButIdowanttoprovideabriefoverview into what government/traumabased mind control is, taken from my website and based on various materials Ive researched, for those who arenewtothetopic:

The premise of governmentsponsored traumabased mind control is to compartmentalize the brain, and then use techniques to access the different sections of the brain while the subject is hypnotized. Entire systems can be embedded into a persons mind, each with its own theme,accesscodesandtriggerwords.Someofthemostcommonand popular symbolisms and themes in use are Alice in Wonderland, Peter Pan and The Wizard of Oz, mirrors, porcelain/harlequin masks,thephoenix/phoenixrising,rainbows,butterflies,owls,keys, carousels, puppets/marionettes, willow trees, tornadoes, spirals/helixes, castles, rings, hallways and doors, elevators and stairs. (The halls, doors, elevators and stairs represent accessing compartments in the mind.) Numbers, colors and music are also heavily used for additional programming and accessing specific compartmentsofthebrain,andarejustasimportant.

Programming centers around the concept of inverted reality and illusion,wherenothingisatitappearstobe,whereupisdown,yesis no, pain is pleasure, and reality and dreams are blurred. Not being abletodeterminewhatsrealandwhatsillusion/dream/fakeisabig theme used in mind control to get targets to give up on reality and succumb to alterego programming. Word play and puns also factor in heavily, as they engage areas of the brain that are used during programming.

30

Chasing Phantoms

A mind splitting into alternate personas usually occurs when the victim is subjected to repetitive abuse and horrors it cant cope with. Themind fractures into compartments designed to house the traumas that the main personality cant handle. These alternate personas can be brought to the forefront of the mind when needed to take on whatever trauma is happening. The abuse can happen to a person (usually child) in the every day real world, (usually at the handsofabusiveparentsandcaretakers).

However there are certain Powers That Be who have perfected the technique of artificially splitting and programming peoples minds through the use of technology, drugs, hypnosis, electroshock and trauma. In this case, the targets are said to military personnel (usually Intelligence) and their immediate family used for experimentation, and the closely intertwined MILABS (military abductees); societys throw away kids, teens and young adults who were plucked from detention centers, the streets or sold into programs by their own parents; entertainment industry performers, etc., among the various peopleandgroupsused.Theartificiallysplitmindisrunexactlylikea computer program, complete with its own theme and trigger codes and access words. It can be turned on and off like a switch, and the programmer/handler has complete control over what the system themesandtriggerwordswillbe.Thealternatepersonawontemerge unless the trigger word/song/phrase is given. The victim is fully functional in society and wont even know they have this aspect of themselvesburiedwithintheirsubconscious.

In addition to all of the above, mind control programming will often times involve instilling repetitive commands into the targets mind, with reinforcement of the commands. And as overly simplistic as the method sounds, its actually pretty effective. Any hypnotist knows and can demonstrate the power of a posthypnotic suggestion, so imagine that in conjunction with drugs and even electroshock reinforcement.However,thistypeofprogrammingdoesnthavetobe accomplished in person, apparently. In Part II I mention my own instances of waking up and catching them in the act of instilling repetitive programming in my mindwhile I slept, taking advantage of my suggestible sleep state, possibly via implants or beaming technology.

Part I MILABS and Mind Control

31

When you do the research, youll come across a LOT of references totraumabasedmindcontrolintheoldergeneration,theMonarchs, if you will. When reading books on the subject as well as perusing messageboardthreads,Ivenoticedaproliferationofpeoplewhowere being taken and programmed this way as kids back in the 1950s and 60s. Parents selling their kids to government programs thinking they were being patriotic, stories of being herded out of school in the middle of the day and put on busses to be taken to secret programming facilities, kids who were abused through their churches and high up Illuminati circles, people who claim to have been programmed by Josef Mengele himself, aka Dr. Green and so on. Really eye opening, shocking stuff. Project Monarch is a biggiebut its also going to be outdated, keep in mind. We need to find out how theyre doing their operations now, in the present. While some groups/factions may still be using the old fashioned, Project Paperclip/Nazi holdover style of handson trauma programming, keep in mind that technology has come a long way in the past 3040 years,andhasprobablyreplacedmuchoftheoldmethods. On a side note, this is probably as good a sectionas any toaddress the fact that those whove undergone programming, as covert and under the radar as it may be, will probably still have various personality quirks and behavior/mood issues going on. So one of the things Ive wondered is whether mind control and being messed with in general may cause many of the same traits as various psychological disorders. And I dont say this to try to blame mind control and abductions on everything, invalidating the idea that some people out there really do have chemical imbalances going on. But maybe some people whove been diagnosed as having certain disorders really dont, and in fact, are MILABS and mind control targets. As noted elsewhere in this write up, mind control utilizes technology that allows voices to be beamed into targets minds, mimicking a trait commonly associated with schizophrenia. Residual amped up energy from abductions, depression from negative programming, delusions of infallible grandeur due to criminal agent provocateur programming, etc. all mimic various traits of bipolar disorder. Theres also the idea that programming possibly could be cleverly hidden behind preexisting chemical/hormonal/psychological issues withinthe target,or,genuinechemical/psychissuesmayinturn

32

Chasing Phantoms

be aggravated by programming, becoming magnified when they otherwisewouldnt. Then theres the issue of deprogramming. I dont even touch on that in this book, because honestly I know nothing about it, and its a hugesubjectthatsbetterlefttopeoplewhoknowwhattheyretalking about. I still have yet to go under hypnosis to try to retrieve my own abduction memories. Im not entirely sure that one can be fully deprogrammed and patched back up. An attempt at something like that would require enormous amounts of time, money and energy with a skilled hypnotherapist whoswell versedin navigating through compartmentalized systems and alters. Not to sound pessimistic but, goodluckthere.Itsnotexactlylike youcanfindsomeonelikethatby flippingopenyourlocalYellowPages. My belief is that if somebody would like to get started right now, forfree,makingsomesortofprogressonthemselves,thenstartfirstby removingsourcesoftriggeringfromyourlife,beittoxicsituationsand people,themedia(whichisaBIGavenueoftriggering),etc.Thoseare two important biggies right there. Also check out a write up I recommend at the end of this book called Letting Go of Programming by Jerry Fallenberg. It gets into recognizing potential negative programming and commands that may have been given to a person,andsettingouttoreverseandundothem.So,thatsatleastone more thing that anybody can do whether theyre an abductee or not, because weve all received some form of negative programming in life from some source, whether purposely or inadvertently. And then work at becoming alert and aware of all thoughts, ideas, and urges. Question and analyze everything you think or do in order to make sure youre not acting on programming. The more you do this, the more you strengthen your mind, and the more control you gain over yourself.

Screen memories

Theres another notableaspect to military abductions: usingaliens as a screen memory to cover their actions. This seems to be a big one thats heavily in use, and Ive come across talk of an increase in rogue military units abducting people, programming/abusing them, then using alien screens to mask the activity. If the military black ops want

Part I MILABS and Mind Control

33

to snag youbut they dont want you to remember anything that might incriminate them, then using an alien screen is perfect cover. Some people actually enjoy the idea of being taken by aliens, and so if they believe theyre being taken by the Grays, then they may willingly allow it to happen again and again and put up no resistance to being abductednot realizing of course, that theyre actually being taken and programmed by humans. For others its the exact opposite the idea of coming forward and admitting to anybody that they were possibly taken by space aliens is so humiliating and unacceptable that they will just keep quiet. Its alien screen memories as built in notalkinsurance. Thiswholesubjectcangetalittlescrewy,becauseascreenmemory couldbeanyofthefollowing:

Amilitaryabductionusingaliensasascreenmemory; Analienabductionusingthemilitaryasascreenmemory;

Andevennuttierpossibilities:

Themilitaryusingascreenmemoryof thealiens pretendingto use a military screen (so it looks as if aliens are framing the military) The aliens using a screen of the military pretending to use an alienscreen.(!)

Oh, the confusion. ! Its wild stuff, but, rumor has it, this wacky doublereversewhateveryoucallitgoeson.Thisiswhywerechasing phantoms so often. Its a situation of stuff tricking people into believing they had experiences that they didntwhich then can lead to abductees going out into the world to propagate what they believe theyknowtobetrueabouttheirsituation,andthenpromotethethings they were told or shown during their abductions. Its in my opinion that this is actually a big part of whats going on with regards to the proalien authors and channelers out there in the world. I dont think theirexperiencesarealwayswhattheydliketobelievetheyare. Ive had my own experience with what seems to be Gray alien screen memories following my first ever consciously realized abduction in October, 2001, coming up in Part II. The images of Gray alienfaceswerelikeliteralwallpaperinmymindseye,andeverytime IclosedmyeyesIwasinundatedwithimagesofGraysfromallangles.

34

Chasing Phantoms

This lasted for several days before finally trickling off. I knew something had happened and that Id obviously been abducted, but something felt off and wrong about these nonstop images. It seemed forced. Like something desperately wanted me to believe that Id been taken by Gray aliens! They were trying too hard, and in their overzealousness to get me to see Grays! they overshot it and only woundupmakingmesuspicious.Whichleadsto

Overzealous programming attempts

Sometimes Ive encountered programming attempts that left me shaking my head, like, Did they actually think I would fall for that?! Wow.ButthenI hadtorealizethatthereasontheydiditwasbecause itdoesapparentlyworkonothers. The modes of operation of humans in abductions often times reminds me of the way neg entities operate. Neg entities have a formulaic blue print that they go by, using the same tactics on everybody across the board. They lack creative capabilities, and so dontvarytheirattack/harassmentstrategiestocustomfityou,thefree thinking individual with a complex personality. I noticed this on my own regarding neg entities, and later read confirmation for this in the highly recommended book Practical Psychic Self Defense by Robert Bruce. And the same mode of operation often times goes for humans/hybridsinmilitary/blackopsabductionssurprisingly. My aforementioned Gray screen memories that went overboard to thepointofridiculousnessareprobablytypicalofhowtheyattemptto brainwash a subject to have images in their mind that will reinforce particularideas. Several days after another abduction in 2002, which Ill expand on in Part II, I discovered a painless lump on the base of my skull; I unconsciouslywenthuntingforit,myfingerssearchingundermyhair until I found it. And when I did, I had the very loud and immediate commanding thought that ITS JUST A SPIDER BITE! accompanied by a very large and sudden image in my mind of ablack and yellow orb spider. !! Talk about obvious. Hello. But again, the reason they did that is because it means it does workon other people. People, somewhere, are obviously just believing what theyre being programmed to believe. Theyre lacking thealertness and strong

Part I MILABS and Mind Control

35

conscious mindset required to stop and notice and question things. Oh, okay, yeah, huh, spider bite, okay and theyre off to the next thing,inadazedstupor. Ive also woken up to catch them in the act of programming me with negative thought patterns, also outlined in Part II. This can be accomplishedviaimplantand/ormicrowavetechnology.So,beonthe lookout for their overzealous programming attempts. Theyre not as all powerful as one might imagine them to be if theyre blatantly getting caught like that. So keep your mind alert, and question everything. Get in the habit of scrutinizing and questioning, if you dont already. They dont like aware, alert people, because an aware alert person is one with higher instances of failed programming attempts, and who can even wake up in the middle of programming, as well as consciously overriding programmed urges. So be that person.Itispossible.

Virtual reality/dream time programming

In the article MILABS Operations by James Bartley, listed in my Recommended Reading section, he gets into one component not often heard the virtual reality/dream time programming of MILABStargets.Igetintoitmorelaterinthisbookwithregardsto how its used for end times programming, but for this section I want to talk about MILABS who claim to have memories of being used for dangerous black ops reconnaissance type missions. Ive come across several references now to MILABS whove supposedly had this sort of thing happening to them, where the shadow government is using its mind controlled subjects to do illegal dirty work in other countries in Central and South America for instance. The MILABS are supposedly used to go after drug lords, or to do some sort of rescue operation, wielding automatic weapons where they get to put their training to use, dodging bullets in crazy shootouts, and so on. On the surface it sounds plausible these peoplearebeinggiventraining,so,itmustbeforareason.Andthe government cant use its own legitimate paid personnel for illegal clandestine operations in other countries. So, thats what the MILABScouldbeusedforright?

36

Chasing Phantoms

Well,Idontknow.Ihavemydoubts. Inreadingtheseaccountswhicharealwaystakenatfacevalue by the targets as having been real experiences that they lived through in their alternate double life my intuition always kicks in and leaves me thinking, ummm.nooooo.I dont know about this. I dont believe these women are lying, you can tell that they really believe these things happened to them, the accounts are very detailed and full of high action. Its just that I dont think that they really happened. Call me skeptical, but I just dont think that these women, even with the best secret training, could survive through what they supposedly are put through. In one book in particular, the female authors high action secret operative account had a very dreamlike quality about it to me as I read it, it didnt feelrealtomeatall.WhichbringsusbacktoJamesBartleysarticle wherehediscussesthedreamtimeandvirtualrealitycomponentof MILABSprogramming.

A grey area exists as far as determining whether certain training experiences are conducted in the dense physical state or in the astral state or in the dreamscape. Sometimes the training may be a literal theater of the mind wherein the milab is physically sleeping in his bed but a complex and vivid virtual reality scenario is playing out in his or her mind that seemingly involves a lot of physical activity. The milab controllers, like the aliens and reptilians before them, can create extremely vivid stage managed dreams within the minds of sleepingpeople. Evenseasonedmilabswithahigh degreeofconsciousawareness anddreamluciditycantalwaysbesureifaparticulartrainingsession is in the dense physical state, astral state or if it is a virtual reality scenario.

Furtherinthearticlehewrites:

One milab described running up a hill with two female milab friends. They were being pursued by two men wearing dark woodland pattenr camouflage uniforms with black ski masks pulled overtheirfaces.Theywerearmedwithautomaticweapons.Themale milabreceivedthetelepathicmessagethatthetwogunmenarepartof a Serbian Assassination Group. [.] As the milabs ran uphill

Part I MILABS and Mind Control

37

towards a large number of boulders and relative safety, one of the milabwomenwasshotinthehead. The male milab looked down at his close friend and noticed that the top of her head was blown off and was clearly dead. The other female milab was wailing in anguish and wanted to stay with the bodyofherfriend.Themalemilabknewtherewasnothingtheycould do for their friend [.] As much as it pained him, he grabbed the surviving female milab by the arm and pulled her up towards the safety of the boulders. A couple of days later, the three milabs spoke on the phone about this training experience. The gal who had her head blown off didnt remember the experience while the two survivors did. (This training exercise was obviously some kind of virtual reality training experience.) The two who remember their friend getting killed were emotionally overwrought during the training scenario. The male milab even remembers telling himself over and over during the experience that he hoped it was some kind oftrainingscenariohewasinvolvedinandwasnotreal.

I bring attention to this because the virtual reality/dream time aspect of MILABS programming isnt really being discussed by anybody else that Im aware of, and for that reason it needs all the highlighted attention it can get. Most MILABS arent aware of it either, as evidenced by some of the books Ive read where authors tooktheirexperiencesatliteralfacevalue.Soitssomethingtokeep in mind when reading MILABS supposed accounts of clandestine black ops reconnaissance missions in exotic countries being presented as actual physical experiences that they really lived through.Thingsarenotalwayswhattheyseemtobe. Blocking and Erasing Memories

In the case of MILABs, the research is showing that drugs, hypnosis and electroshock are the common modes of operation not only for programming, but for wiping out the abductees memories of the event. However, memories do manage to make it through despite that.InmyownexperiencethereswhatIcallmemorysurging,which I havent read about anywhere so far. Its where you know that something has happened, and the memory repeatedly tries to surge

38

Chasing Phantoms

forth, but it cant fully come out due to blocking techniques that keep thingscompartmentalizedandunderthesurface.Stillothertimes,bits andpiecesofmemoryflashesdomanagetoleakthrough. Lets start first with an overview of drugs, electroshock and hypnosisineliminatingmemories,andtheirprosandcons: Drugs.FromFritzSpringmeiersTheIlluminatiFormulaforCreating a Totally Undetectable Mind Control Slave The CIA/Illuminati programming centers have more than 600700 different drugs at their disposal...they can make a person feel like he is in heaven, or burning in hell. The drugs are at times used with elaborate light, sound and motion shows that produce whatever effect the programmer wants to produce.Theycanmakeapersonbelieveheisshrinking,orthatheis double (with mirrors) or that he is dying Fritz goes on to name a comprehensive list of drugs that are supposedly in use, notes that there are new synthetic versions now available for some, and also mentionsthatCannabis,akaMarijuana,isnotusedmuchinMonarch ProgrammingbecauseitIMPEDESmindcontrol.Interesting.

The cons of drug use in programming and memory erasing is that an abductee who is put back into the real world may have residual after effects of drug usage, which would clue the target in that something has happened to them. Not good, or practical, if the abducteeneedstoworkandfunctionintherealworldand/orifthey intend to keep the situation as covert as possible. In Part II I recount how residual drug leftovers seems to have happened with me on at leastoneoccasion.

Electroshock. Again, from Fritz : Stun guns, staffs with hidden electriccattleprods,andcattleprodsarefrequentlyusedontheslaves. Electroshock is used to create the dissociation from trauma during the programming, and later it is used to remove memories after the slave hascarriedoutamission,ortoinstillfearandobedienceinareluctant slave. A slave often shows electroshock marks on their feet, or back, or buttock or legsafter they have beenused. An owner ofa slave will ordinarily carry a stun gun. This is perhaps a 120,000 DC volt stun gun to erase & compartmentalize memories, but some of the stun guns go up to 200,000 volts DC .After giving programming instructions they will usually give a high voltage shock to the base of the skull to imbed the instructions deep in the subconscious. They often use hypnotic cues along with the shockThe shock

Part I MILABS and Mind Control

39

destroysandscramblesthememorywhichisstillstoredintheshort term memory section of the brain. They must shock the person within 24 hours, to insure that the short term memory doesnt get into thelongtermmemoryasacoherentmemory

I bolded that last part in light of my own aforementioned post abduction situation where I was in a blank stupor for a whole week, leftwithalumponthebaseofmyskull,andhowwhenItouchedit,I immediately had the very loud instruction/cue of ITS JUST A SPIDER BITE!!! complete with an image of a black and yellow orb spider in my mind. So this matches up to what hes saying. He goes on to describe one way that these electroshock prodmarks canappear onthebody:Thebruiseonthebuttockswillbeblackandbluespots about 1 diameter each. I found all of this interesting because of my own anomalous circular, deep purple colored bruises that have periodically appeared on (hidden) areas of my legs, usually following a suspected abduction. My bruises are a little smaller than what Fritz describes though. On one occasion, one of them was coincidentally surroundedbyhighlysensitiveleghairstubblethatwaspainfultothe touchandstickingstraightout.Theotherlegstubblewasnormal.

The cons of subjecting a target to repetitive electroshock treatment is poormemoryfunction.ThiswasmentionedintheCarlaEmerybook, Secret, Dont Tell. A person will become terrible with names, dates and so on due to their brain becoming fried, which may not be advantageous over the long haul depending on what the abduction target is being used for. When I had a lump on the base of my skull with the accompanying programming command, I was in a mental stupor at the time, lying around all week staring at the wall, not eating, not showering. Normally my mind is really sharp, so if that was indeed the after effects of some sort of electroshock programming then I can only imagine what it would do to someone experiencing it on a regular basis. Ive met several abductees and/or suspected abductees in life who were admittedly terrible with names, dates and overall detail recollection. So this is a big side effect indicator to look for.

Hypnosis. Hypnosis is a very convenient way to instill programming into somebodys mind, requiring trigger codes to access the blocked offareasbutitmaynotbethebestwaytoensuretotaleliminationof the programming session memory. As mentioned in Carla Emerys Secret, Dont Tell, unless the programmer covers all bases, every

40

Chasing Phantoms

time, they are bound to slip up sooner or later, allowing for memories to get past the target. For that reason, drugs and electroshock are added to the mix with a military abductee, and possibly the joint military/alienendeavors,toensurepropercompartmentalization.

Itkindofsurprisedmetoread(andhavepersonalevidenceforthe fact) that they would have to resort to good old fashioned drugs, zapping and commands considering the advanced technology at their disposal. I would have thought that they would have devised more sophisticatedmethods.ButIguessifitsaintbroke,thendontfixit.

Memory surging

As mentioned earlier, theres what I call memory surging. This is when the memory of an abduction event is trying desperately to break through to the surface of the conscious mind, but feels as if its repeatedly running into a roof or ceiling. The knowledge of the eventisthere,anditnearlycomesthroughyoucanevengetafeeling around it, manufactured positive, or outright negativebut its impossible to access the actual memory. Ive experienced this on two particular occasions, and it creates a maddening feeling. Im not sure what causes surging, versus memories being completely wiped out withouta trace.Possiblyitsthetechniquebeing usedmaybecertain techniques for memory erasing are more effective than others, and havedifferentresults. In other cases, actual memory flashes do manage to pop through, not triggered by anything in particular only to immediately disappearback underthesurfaceagain.Iveexperiencedthisacouple of times and have heard other abductees describe it. And these memoriesmayspontaneouslypopbackuptothesurfaceyetagainata later time,remindingyouthatHey!....youhadthismemorybefore,but lost it! Its just amazing to see the effects of programmingat work like that,andthetugofwarstrugglegoingoninthebrain.Mysuggestion is to carry a little notebook and pen with you wherever you go in case you experience spontaneous memory recall, this way you can jot it down before its lost againwhich it usually will be. You may find, like I did, that you have strong programming instilled to deter you from focusing on the fact that youre having this recollection but I

Part I MILABS and Mind Control

41

think this can be conquered. Once youre aware that youre occasionally remembering random flashes, but have programming instilledtellingyoutoignorethem, thenits justamatterofcombating itbyhoningyourawarenessandmentalalertness. Admittedly its not going to always work though, like the incident that happened to me recently. I was lying in bed and started to remember something about another life that I lead, (possibly programmed compartmentalized alter?) It was there, popping to the surface, a veil of amnesia was lifting and I could touch the beginnings of memories of another double existence. The impression I got in that brief moment was like dreamtime compartmentalization. When Im over there in that life, whatever it is, this life here is like a dream thatsnotreal.AndwhenImoverhere,Ihavenoconsciousmemories of that one over there. But then just as suddenly as it rose to the surface it was gone, and I couldnt get it back. Totally maddening!! All I was left with was the intellectual knowing that this had happened. And then Ive had my own actual abduction memory flashes that emerged due to something triggering the recall, which is detailed in Part II. How can this happen, how would a memory make it past the erasingprocess?Well,whatIvenoticedisthatinmostofmymemory flashes, what defined these flashes was that something very specific was attracting my total focused and curious/frightened interest, independent of their direction. And maybe that pulled me back up into conscious awareness during the abduction just long enough to make an indelible stamp onto my brain that even the erasing techniquescouldntlatereliminate?Imnotsure,itsjustatheory.

Dreams, reality context and the assemblage point

An interesting concept relating to abduction memory loss that ties into metaphysics, and may be something that occurs during MILABs/alien abductions, is whats known as shifting the assemblage point. The assemblage point, as taught by those who practicetheToltecpath,iswhereournormalawarenessliesduringour every day lives. Through our lifelong experiences, as dictated by our parents, peers, school and society as a whole, we become locked into a particularsetviewofrealityknownasourassemblagepoint.Itsthe reason we arent usually able to see the other realms, or why some

42

Chasing Phantoms

children start out being able to see spirits and auras, and over time, lose that ability. We get squelched down and stifled, discouraged and pushed into a box that locks us into a set way of seeing and viewing reality. When we dream however, our assemblage point naturally shifts slightly, enabling some of the strange nocturnal experiences that many people experience. A Toltec warrior, through the help of a nagual (similar to a shaman) practices being able to shift their assemblage point at will while they are awake to be able to access those other realms that are not normally available to us. Theres one catch though, as noted by author Carlos Castaneda when shifting back into the normal assemblage point position, the memories of everything that was done, said or experienced while in the altered assemblage point position state is forgotten! Only when shifting the assemblage point back again can those memories be accessed. And then it becomes a situation of How could I have forgotten everything I did the last time I was here! Carlos experienced that amnesia split andmentionsitinseveralofhisbooks. Does this sound familiar? Sounds very much like the whole compartmentalized mind thing to me. So possibly another aspect of whats happening when an abductee is taken during alien/MILABs encounters involves a natural shifting of the assemblage point. If abductors are taking targets to bases or locations that are straddling different densities or realms, putting the abductee into an altered state of awareness and consciousness, then those targets may very well experience a natural shifting of their assemblage point, which would furtherhelptocompartmentalizetheirmemoriesandexperiences. I tendtoactually think thismaybeabigpartofwhatshappening, and my boyfriend Tom, a lifelong abductee, remembers experiencing this as a young child. At the start of his abductions he would be confusedastowhatwashappening,butassoonasthingswouldbegin kicking in,allthe previousmemories wouldcomefloodingbacktothe surface, leaving him with the feeling of I cant believe that I forgot! Eachandeverytimethiswouldhappen.Kindoflikethatotherreality is put on hold while he was back in the real world. Its identical to what Carlos Castaneda describes when remembering his compartmentalized experiences while in his various assemblage point positions.

Part I MILABS and Mind Control

43

If the concept of assemblage points is too weird for you then think of it this way when dreaming, how often are you able to become lucid and have full conscious awareness of your waking self and realize that you are currently in a dream? Probably not that often, if youre like most people. People usually have complete amnesia regarding their waking lives when sleeping. We become so absorbed in our dreams that our waking life and everything we do in it and everything we believe we are as people no longer exists. Poofgone. Or even weirder, some dream realities are so real that its difficult to shake them off when waking and inserting ourselves back into this realworld.! So its like being in two realities, literally, completely separated and compartmentalized from each other. Some sort of naturally inducedamnesiabarrier.Onarelatednoteisrecallingdreamsweeks monthsmaybeevenayearafterhavingthem,whichmeansthatthe memory of the dream has been in your brain the entire time, but not accessed until the right trigger pulled it up. So, this is another way that natural abductionrelated compartmentalization and memory loss canbelookedat. Wave Beaming Harassment

Scalar/Microwaves Microwave/scalar targeting/harassment is another component of abductions. In my own life, my boyfriend Tom and I experienced this while living in Fort Lauderdale Florida, both in his apartment and my ownwhichwewouldlaterjointlyshare.Thesituationwassobadthat it was causing headaches, lethargy, impaired mental state, and even disrupted sleep and nightmares. The dull aching in my head and disrupted sleep state was especially distressing for me being that I normally dont have issues with headaches, as a lot of other people apparently do, and I very much enjoy my sleep! Tom has a little gadgetthatdetectselectronicsignalsandhewasabletodeterminethat theelectronicwavesizematchedthatofcellphone/microwaves.Butit turned out to be a lot more than just random cell phone wave pollution,asIwillshowinasecond.

44

Chasing Phantoms

Because of the debilitating mental and physical effects these microwave/cell phone waves were having on us, up went the electrically grounded, aluminum Mylar sheeting on some of the walls. We purchased the Mylar space blankets (emergency blankets) for camping that anybody can buy for $2.99 at their local sporting goods store, and Tom already had the wires and alligator clips on hand to ground them electrically into the wall sockets. And while I was dismayed at the prospect of how this would cause my apartment to look forget the idea of cool decorating when your walls are lined in Mylarwehadnochoiceinthematter.Thesituationwasthatbad. Two main walls of my apartment had to have this Mylar sheeting, because those were the angles that the waves were getting us from. The third wall was shared with our next door neighbor. And we couldnt do anything about the fourth wall in the kitchen, or the kitchen area in general, because of the way things were set up. That was alright though, the most important area was where we slept, worked on the computer, and did our reading, writing and research. From thefirstnightthat webufferedtheapartment withtheMylar the disruptedsleepandnightmaresstopped.Isleptcalmlyandpeacefully, was headachefree, and back to my usual energetic self, able to focus clearly. I cant imagine if Tom didnt have awareness about this and didnthavetheelectronicgadgettodetectthewaves,ortheknowledge of what todoaboutitall. Howmanyotherpeoplearebeingtargeted like this every day, effectively being put out of commissiondue to lackofawareness? But whats even more interesting is the experiment that Tom performed back when he lived in his own apartment, where he used his signal detector to determine a) that there were waves beaming in, and b) wheretheywerebeamedintheapartment.Thenhegot onthe floor, sandwiching himself between the stove and the counter to hide. Giving it a few minutes he finally got back up and checked around withthesignaldetector. Therewerenomicrowavescominginanymore. However, within several minutes of being back up and moving around his apartment, the signals came back, as indicated by the detector.Itwaslikehewasbeingtriangulated. Now, what are the implications of that? This is showing that these are smart signals, with an intelligent source driving them. It means

Part I MILABS and Mind Control

45

that it wasnt just random cell phone pollution. They were definitely being beamed by somebody or something, and for a specific reasonand only when that something could sense Toms presence movingaroundintheapartment. Another experiment involved determining the source angle for where the waves were coming in, putting up Mylar sheeting, then waitingforaboutadayortwoandcheckingagain. The signalshad shiftednow, attempting to go around wherethey were being blocked. So again, proving theres an intelligent source behindthesignal,whetherautomatedtechnologyoractualhumans. Microwaves being beamed at abduction targets seems to be a classic harassment tactic that Ive encountered when doing research, butwedonthaveto bevictimsofit.Peoplehavenoideawhatjusta couple of three dollar sheets of Mylar can do. Ive read cases where people had to keep periodically moving once the harassers located them and resumed their beam attacks. But it doesnt have to be that way. A noteworthy mustread for further information on this subject would be the following, which also includes links for where to obtain thesignaldetectormentionedhere.http://montalk.net/conspiracy/55

Sickness beams

For lack of a better term to refer to this, sickness beams are something youll hear about when you do the research into MILABs harassment. They can be beamed in various ways, but one technique involves hovering helicopters. The target in question will soon find themselves developing some debilitating, and/or life threatening ailmenttostopthemintheirresearchandtakethemoutofthepicture. To many, this is the ultimate in fear. The sense of powerlessness it creates, and the Godlike abilities that these military spooks wield is incredible.Youcantbeatthatright??? Wrong. Formoreelaborationonthis,pleaseseePartIII,Fearinrelationto the abduction experience. I elaborate in full detail about this, and other fear/harassment/elimination tactics. We are not the helpless victims they would have us believe. We have full control over what happens to our bodies and our lives, not them. Even when it comes to sicknessbeams.Idontcarewhatyoubelieveyouknowabouthow things are, Im here to tell you that weve been programmed with self

46

Chasing Phantoms

defeating limitation, living in a reality that has been carefully manipulatedateveryturntostripusofournaturalabilities.YouCAN fight back against even sickness beams, in my opinion. And if the reader remembers only one thing out of this entire write up, let this beit.SkipaheadtoPartIIIifthisisatopicofinterestforyou.

The World Underground

Ah,noalien/militarywriteupwouldbecompletewithoutmention of the underground bases and tunnels. Hyperdimensional realms aside,thereis supposedlyawholesecondarylayerto our reality going on now, right under our feet. Literally. Theres the lala land surface world where were kept amused and distracted with entertainment, the media, drink/drugs, materialism and consumerism, debt, poverty and daily struggle, political distraction and wars, and then theres this whole other behindthescenes reality going on that most will never even get a glimpse of. If the reports of the dozens of underground bases with their crosscountry connecting subterranean tunnel transportsystemsandalienhieroglyphicsonthesignsarecorrect,then itssafetosaythatsomethingelsehasofficiallytakenover. Thisisatopicthatfascinatesmethemost.WhenIwasroommating withmybrotherJoe(aMILAB)inPortland,Oregonin2001,herelayed an experience of an abduction that he claimed took place in an undergroundbaseinOctoberofthatyear. Heres what he relayed to me about what he saw, but as I mention in my section about Untangling Disinformation, Im not endorsing what he said or promoting it as gospel. I simply relay it for the readers consideration, and also in case anybody out there has experienced something similar. It also needs to be mentioned as well that Joe wasnt a normal MILABs by any means, so when Im recounting things that he saw, keep in mind he wasnt just some innocentwideeyedMILABtarget.Itappearsthathewasreanimated, and piloted by other stuff, making his situation above and beyond anything that most people will ever experience. It means he was a pawnofsorts,andforthatreason,Idontgettoomuchintohisstoryin this book only because I dont think the average abductee has somebody in their life thats to the level that Joe was. It was pretty

Part I MILABS and Mind Control

47

extreme and out there, and would be considered the fringe of the fringe.MaybeinfuturerevisedadditionsIllgetmoreintoitall. At any rate,Joe claimed that he was taken to a base instant beam transport from his apartment in Portland where he recalls seeing aliens and humans working side by side. The temperature in the base was cold, and he was being escorted down a hallway by two human males.Theypassedbya6foot+tallAmphibiancreaturewhoeyedup my brother suspiciously as they passed by. It was more like an Amphibianhumanoid,andcameacrossasbeinghighlyintelligent.Joe even imitated the way this thing eyed him upwith eyes that were more towards the side of its head. He said that everybody seemed busy, everybody had something to do. I asked him if he recalled seeing any Graysor even Reptilians, since thats what I had just recently been reading about in David Ickes book. He said no, just theseAmphibianbeings.ThatsurprisedmebecauseIdneverheardof such a thing as amphibian aliens. It sounded ludicrous. But, the idea of amphibian beings would later be corroborated in my research, as well as bizarre genetic crossbreeding experiments in underground basesusinghumanDNAandvariouscreatures.Sowhoknows. He also recalled being taken into a room where the lighting situation was unusual. He couldnt find a source for the lighting, no light bulbs or fixtures like you might find in the real world. Instead the walls themselves seemed to glow, lit up from within. That was interestingtome,butagain, Ihadno waytoproveanyofit.Notuntil last year, when Tom came across a channeling source called Cosmic Awarenessthatcorroboratedthisparticulardetail: All is controlled by advanced magnetics. That includes a magnetically induced (phosphorescent) illumination system. There arenoregularlightbulbs

This Awareness indicates the lighting system used as that which is painteduponthewalls,orplacedonthewallsinakindofpaintwhich is affected by an electromagnetic charge that is applied, which causes the wall to light this affecting the paint on the walls and the substancesthatareinthatpaintedmaterial. There were also hieroglyphic characters on the walls my brother reported, various symbols that he claimed to have been doodling for

48

Chasing Phantoms

awhile. Later on I would find myself talking on the phone to an old blind psychic woman named Maryann that Tom had put me in touch with. She was very knowledgeable of the UFO/abduction subject and underground bases, and she asked me, Does your brother ever doodle triangles inside circles? I was sitting on the floor with the phone to my ear, and as she asked me that, my eyes traveled upwards to the wall in front of me with all the graffiti stuff my brother had scrawled everywhereincluding a big spray painted circle with a triangleit.Yeah,hedoesactuallyImlookingatonerightnow So whether his experience happened or not, I cant verify, consideringthathewasareanimatedpawnofsorts.Possiblythebase he was at was nothing like what he thinks he saw, and he was implanted/programmed with false memories to corroborate what they knew I would later come across. Double reverse wacky psychologyandallthatfunstuff,asmentionedintheintroduction.;) All that aside, the idea that there is an entire secondary world happening, underground cities and roadways and the whole set up, right under our feet (or within mountains), is pretty significant. Keeping that in mind actually explains a lot of whats going on in this world. You hear people complaining about how bizarre things have gotten in the world zoo we occupybut guaranteed, most people are not keeping the idea of this other layer of reality in mind as they complain. The average person wouldnt know about it anyway, but even the conspiracy researchers tend to forget. Until I had a dream that took place in an underground base back in 2000, I had absolutely no comprehension of surface world versus underground world. So what were seeing on the surface isnt all there is, and it helps to keep that in mind when trying to make sense of why things are the way they are in the world. As I mention at the end of Part III, stuff has 95% of the population herded into one reality option, and its a realityoptionthatinvolvesdistraction,liesandfeedingthefeeders. I would recommend looking into this subject if it interests you underground/underwater bases, tunnels and highways, and bases built into mountains as its always good to expand our view of what wethinkweknowaboutreality.Onegoodauthorinparticulartostart with is Richard Sauder, whos written a couple of books on the subject including,UndergroundBasesandTunnels:WhatistheGovernment Trying to Hide? and Underwater and Underground Bases. Its

Part I MILABS and Mind Control

49

another step in detaching from the herd and gaining the much needed biggerperspectiveaboutthings.

P I II tI rt ar Pa
My own experiences

Ive learned that the best way to get to the bottom of things is by tradingpersonalexperiences.Puttingwhatyouveseenandheardand learned out there for others to read, so they can compare it to what theyve gone through. For myself, reading abductees personal stories were always the most helpful and useful, due to their wealth of specific details, versus the emotionally detached, intellectual dissertationsonthegovernmentsProjectThisandProjectThat. In adding my own experiences and theories to the pile maybe somebody out there will read what Ive written and experience that light bulb aha! moment, and get possible needed corroboration, answers, or realizations, or at least use it as a launching pad of sorts. This is how you begin to figure out whats what, and find those missingpieces. When trying to get answers to whats happened to you, you have to first know what questions to ask. The biggest issues to figure out are:

Whosabductingyou?(Andistheremorethanonesource?) Whendiditbegin?Whichleadsto Howwereyoudiscoveredortargeted? Whyareyoubeingabducted?Whatsbeingdonetoyou?

Maybeyoureoneoftheluckyoneswhohasclearanswerstowhen and how it all began for you. Some people seem to have what I call a bythebook abduction scenario, where its clearly defined that a) abductions are happening to them, b) whos doing the abduction, c) how theyre taking them d) whats being done during the abductionanditseemstobethesamestoryaseverybodyelses. These people seem to have way more memories and far less plot holes going on than I do. Whether positive or negative, at least they rememberandknowwhatshappenedtothem. I,unfortunately,amnotoneofthosepeople. My first known and overt abduction experience didnt happen for me until October of 2001. (Coincidentally the same month that my brother was also abducted and taken to a base for his first ever fully realized and remembered abduction/meeting with Them, as relayed

52

Chasing Phantoms

at the end of Part II.) I was 27 years old by that point. Talk about arrivinglatetothegame. OrdidI? As I later had to realize, this stuff usually doesnt just erupt for a personovernight.Iftheywereabletofindmeandsnagmeat27,then it means they were already well aware of who I was before that. And thatswhenIhadtoreallystartlookingovermylifeandbegintotryto make sense of what was basically a bunch of mish mash indirect evidence. As it was, even with the one overt abduction experience, I still didnt have clear answers as to who took me, how, to where, and why. I certainly know what they wanted me to believe that it was Gray aliens, and it was good, so invite this into my reality so it can happenagain!butitdoesntmeanthatwasthetruthofthesituation. And thats where things got frustrating. The very basic questions outlined earlier Whos taking me?? How was I targeted, and when did it start?? Why am I being taken?? I had no answers for. Totally clueless. The abduction and mind control books I began looking at to help in my research and quest for answers were great and all, but I couldnt help but notice how the people being featured in these materials were so confident about what their situation was. They had concrete answers. When you have answers you can speak with some authorityonthesubject,oryoucanatleastbeheldupwithconfidence bytheauthorswhoarewritingaboutyourstory. Additionally, my situation didnt exactly fit or match up with anything Id been reading about in my research, since most research tends to be focused on aliens, with little mention of human/military rogue abductions and programming. Thats slowly changing though, as this subject begins to get more exposure. For the most part though Ive had just a whole lotta confusion in my journey, as do most MILABstargets. What I eventually wound up doing,avariation ofwhich youll see in this particular section, was to sit down and begin documenting everything and anything I could think of that was either obviously abduction related, or highly suspect. And this is a good idea for any abductee to do. In doing so, youre rounding everything up and getting it all organized, which can help bring up other memories and incidents that may have been forgotten. For me, I typed up anything I could remember going as far back as I could, putting my memories

Part II My Own Experiences

53

into loose categories, and then looked over everything to see what it wasallpointingto.Patterns,thebiggerpicture,andsoon.Peoplewill be different though, so use whatever documenting system/method works for you. You have to start somewhere, and writing stuff down, (or typing it up, or talking into a hand held tape recorder, etc.) is probably the best place to start. And then if you still cant get definitiveanswers,orhaveholesthatneedtobefilledin,thenpossibly consider other avenues meditating in a contemplative state, hypnosis with a trained and trustworthy person who is familiar with abduction cases(andwhowontaskleadingquestions)andsoon. You may notice though like I did that once you begin the process of trying to document your experiences, more memories will begin to surface. So as mentioned earlier in this piece it can be a really good idea to carry around a little notebook or pad of paper with you in caseyouremembersomethingwhileoutandabout. Actual Memories

(Note: The key to these memory flashes is either something directly triggeringthem,orbeinginarelaxed,open state,notthinking about anything, which seems to be conducive for allowing stuff to come uptothesurface.Andasyoucansee,therearentthatmany.But,Im gladforwhateversnippetsIdohave.)

MetalGangways.Backin2000,whilelivinginSoCal,Ihadaflashone eveningwhereIsuddenlysawmyselfstandinginwhatseemedtobea windowless installation facility thing that has these metal grating walkways/gangways and stairs and stuff. It looked similar to the NORAD facility in some ways, featured in the movie War Games. Same sort of look to it. In the memory Im standing on the metal grating walkway at the top of some stairs, looking around in a (drugged?hypnotic?)daze. I had this flash while resting, and notthinking of anything at all. I wasnt sleeping, just relaxed, and then I spontaneously saw myself in that scene, which surprised me. I was embroiled in paranormal happenings at this point, as documented in my write up called The Vortex on my website, but I didnt realize at this time that I was an

54

Chasing Phantoms

abductee, and certainly had never heard of anything concerning MILABs, so I didnt understand why my mind would generate an imagelikethatoutofnowhere. (Note: An excerpt that I later came across several years after this memory, taken from the book MILABs: Military Mind Control & Alien Abduction by Dr. Helmut Lammer and Marion Lammer has thistosay:

Diane (pseudonym) has had ongoing alien abduction experiences since her childhood. As she grew older she got flashbacks of human kidnappings where she was taken to military underground research facilities. She reports elevators, halls and gangways, like many other MILAB abductees. She also reports that she was taken on a tour of partofsuchafacilitybyamaninawhitelabcoat

Reading that was interesting in light of some of the memories or suspicious dreams Ive had of people in white coats, elevators, gangways,hospitalsandsuch)

The sun mug. In another flash Im sitting at a table in a small windowless room. Everything seems to have a slight yellowish tint to it. Im sitting across the table from a (white) woman wearing glasses, with dark brown hair, pulled back tightly. She seems to be wearing somethingwhite,possiblylikealabcoat?Andsheswritingsomething down, not looking at me. For that reason I dont know exactly what her face looks like. I get the feeling that whatever shes writing concerns me. Im just sitting there passively, as if in a drugged state. My eyes slowly drift aimlessly around until falling on the coffee mug that sits next to her, to her right. Its dark in color, like a navy blue, with a gold sun/rays on it. Suddenly I realize, heeeeeeyy thats an illuminati symbolism and this is what triggers me to start pulling outofmystupor,andwherethememoryends. I remembered this flash while stopped at a red light on Broward Boulevard in early 2003. I glanced over and saw the sign for a Sunoco gas station. And it was the word sun in Sunoco that triggered me to remember the sun image on the coffee mug, and that entire flash of memory justcame out, right there, as I sat in my car. This image was an actual memory, but the woman in the memory has also appeared in two of my dreams. I was able to see her face a little

Part II My Own Experiences

55

better in one of the dreams, and she seems to have thin lips, big eyes, andafixedexpression.

Residualarm rash. Sitting on a chair in a room with that same yellow hue to everything, although here the yellow tint was even more pronounced. Again, I seem to be in a passive, drugged state. Im slowly scratching at a spot on my lower left arm with my right index finger. That spot is irritated, and as I scratch at it in a daze, a spotty rashappears. I had this flash while sitting at Einstein Brothers Bagels (Fort Lauderdale) on March 22, 2003. This was the afternoon following an abduction, and I had been receiving indicators that something had definitely happened. And as I sat at my table spacing out, boom, this memory just flashed into my mind. Without even thinking about it I immediatelygrabbedatmyleftarmandturnedit,lookingfortherash, fully expecting to see itand it was there. It was fading, but it was there, in that exact spot, and it was real. I was stunned, like, Holy shit

Flashback.Aflashonemorningbackinearly2004maybe,whilelying in bed.I saw myselflayingdown,possibly onatableorsomething,in a brightly lit room, and there are several guys standing over me, leering and jeering at me. One leans in, hes white, with brunette hair, and hes right up in my face, laughing and mocking, and then scratches under my chin. [In the writing of Fritz Springmeier he mentionsthesexkittenprogrammingtriggerofscratchingunderthe females chin. Whether thats what was going on here, I dont know.] I just lay there in a daze, although I feel that even in my muted state Im scared. But I dont seem to be able to do anything about it, like maybeI cantmove.Theirfacesareblurred,andIseemtobedrugged ingeneral. The flashwasintenseandsudden,very unexpected, and jarred me out of my relaxed state. I didnt like it at all, andmy first thought was WHAT THE HELL WAS THAT?!? Although I did know what it was,evenifIdidntconsciouslyremembertheincident.

56

Chasing Phantoms

Suspicious/Obvious Indicators and Dreams as a Kid Something I noticed straight away was how many of my logged incidents began with the words When I was five Around the age of four About five years old when Four and five years old, over and over again. And recently, I just came across some corroborating insight about this that made me want to fall out of my chair. In the book Future Memory by author P.M.H. Atwater, she says fascinating that between the ages of four and five is when most childhood cases of alien abductions and alien sightings are reported to occur WOW! No doubt, I had a LOT of activity at those ages, something was definitely happening. This is also the time when the lifelong issues between my mom and I really kicked in. I never realized that until doing this write up though, which is why writing stuff down is such a good idea. My entire life Id just tell people, Oh, me and my mom have NEVER gotten along, going back to when I was really little, we just always hated each other But when I did this write up I began to realizethats not true. It started whenIwasaboutfourtofiveyearsoldasfarasIcantell.

Reversedinbed.Anincidentataboutfiveyearsoldwhenwelivedin Westfield, Massachusetts my mom had a funny feeling about me in the middle of the nightso much so that she got up to check on me and found me lying outside the covers, reversed on my bed, arms at my sides, with my eyes open, unblinking, staring at the ceiling. She leaned in close, watching me to see if I was breathing or blinking, and then I came to. I blinked a couple of times, and turned to look at her. She gasped and jumped back and said OH MY GOD I thought you were dead! She was really weirded out about the whole thing. Tucked me back in the right way, looking scared. I had no memory of why or how this happened, I only remember it from the point where I came to and turned to look at her, like, huh? whats going on? and seeing her jump back away from me. There would be several times throughout the years when we later lived in Connecticut where I would wake up as a kid reversed in the bed, outside the covers, not surehowIgotthatway,butnomorethatmymomwaseverawareof. Itdoesnthappenasanadultthough.Beingreversedinthebed,isone

Part II My Own Experiences

57

of the noted child indicators when you do the research. It seems like something cant get the coordinates right when putting people back in their beds. Factoring in my moms funny feeling and this incident definitelyindicatessomethingunusualgoingon.

Iodine fromprocedure?Wokeuponemorningaroundtheageoffive feeling something funny going on down there. When I inspected myself,Ifounda strangeambercoloredstuffonme.I picked itall off, mystified. And its never happened again since. Later I reported it to mymomwhofrownedatme,completelytaken abackby me reporting such a bizarre thing. I was only five, too young for gynecological issues. It made no sense. She looked, but found everything to be normal, with nothing at all unusual happening down there, and gave me more frowny looks, like thinking, What are you talking about?? TechnicallyIshouldhaveleftitallontheresoshecouldseeforherself as proof, instead of picking it off, but I was only five and didnt think aboutthat. While living in Portland in late 2001 to early 2002 with my brother Joe I relayed this story to him, and he immediately nodded knowingly andsaid,Yeah,thatwasdriediodine. REEEEaally,Isaid.Whatfor?!?!Helookedoffintospace,hiseyes glossing over as he saw something play out in his mind, and said, Theyimplantgirlsthroughthatareasometimes.See,theresthislong silver stick with a ball at the end of it, and the implant is attached to theball.Theyinsertitin,injecttheimplant,andwhentheypullitback outagain,theypushabuttonthatsonthestick,anditsquirtsiodineto disinfecttheareaastheyremovethestick. When he was done relaying this, there was silence. Finally I broke it by asking the obvious. How do you know this? He turned to look at me, shaking himself out of it. Then furrowed his brows and had an intense look on his face. I dont know. I just know. He paused, thinking about it. Ive seen it done, he realized. Ive seen them do it. He explained that they do this to females, especially female children, because it will go completely undetected on their body.

People in white coats. Memory of being on a table lying on my stomach in a windowless room with doctors? in white coats about

58

Chasing Phantoms

two or three years old? Im nervous, but alert and awake. Now, I had meningitis when I was one and a half years old, this could be the memory of me just prior to getting my spinal tap, where I would have been lying on my stomach. But the fact is, I dont remember ANYTHING about when I was first sick with meningitis and admitted to the hospital. From what I was told, I had a fever of 104, I was vomiting, lethargic, in and out of consciousness, and couldnt turn my headbut I dont remember any of it. My memories of my bout with meningitis dont start until I was recovering in my hospital room. At the point where I would have had my spinal tap, I was literally, near death.Andinthismemory,Idontseemtobesicklikethat,atall.So, is this a memory of when I was going to get my spinal tap? Or something else? I have come across one lone reference to MILAB abduction programming that describes something like this, where programmingisdonetoabducteechildren.

Theroominsidethewarehouselikebuildingissetuptoworkonthe subjects. It has a table, a light, and equipment. The room is apart from the activities going on outside, so that others will not be distractedbywhatwedohere. http://www.greatdreams.com/political/media03.html

Interesting.Especiallyinlightofmy warehousedream, relayed belowwhich had somebody in a white coat. There were several details mentioned in this womans write up that stood out for me, surprisingly. But the fact is I was on my stomach, just like I would havebeenformyspinaltap.Sowhoknows,maybethatsallitis.

Abduction programming facility? This was a dream, but Im going to put it in this section, to keep all these incidents from this age together.ButIhadadreamabouttheageoffive,whereIminsome large (warehouse type, in retrospect) facility, standing around, waiting for some adults nearby in white (coats?) to lead me where to go next. And my Mom is there, (!!) Shes talking to one of the people in white. To me it sort of seems like a supermarket, because its so big with the tall ceilings, but I guess its not. Im just standing there, calm, looking up and around at everything. Up where the wall meets the ceiling thereisarowofsquaresthatareshinysolidblack,eachsquareframed in shiny silver/chrome. It gets my attention because of the geometric

Part II My Own Experiences

59

pattern,anditsthereasonthatIevenrememberthissceneatall.This always felt more like a memory to me rather than a dream, due to the realistic feeling it hadand the unusual subject. It doesnt seem normal forakidtodreamaboutsomethinglikethis. When I ran this by my brother Joe in Portland in 2001, he said it was indeed a base/facility that I was in, and that the black squares were made of mica, designed to filter ultraviolet radiation. Since people living in these bases have no exposure to the sun they have to give them artificial doses of it to prevent sickness, and it was passed through these mica block/filter things. My first response was a big scrunched face, very doubtful since the mica Id seen growing up was pretty transparent.Notblack.InfactIwassodoubtfulaboutwhathe reported that I didnt even include Joes explanation of this in the original versions of this book. But when I later researched mica I later found pictures of it that showed thick sheets of mica.that were a smoky gray to black color. The thicker the sheets, the blacker it gets. But most importantly, years after being told this dubious piece of information,it wasconfirmed to me by somebody else that theidea of mica filtering UV rays is actually validyou can do a search on Googleandturnup researchpapersonit. Apparentlymicafiltersout the harmful spectrum of UV rays, and allows the beneficial ones to passthrough.So,yetonemorethingthatJoetoldmewaybackwhen, which was put on the backburner, until surprising confirmation eventually did come in. And as mentioned in other places throughout this book, Joe wasnt somebody who was educated or who spent time reading the sorts of material that would have taught him this stuff, or usedtheinternettogaininsight.Hehadnointerestintheinternet,and spent a lot of his free time engaged in criminal pursuits, not being academic.

Frequent heavy nosebleeds as a kid in Massachusetts. Frequent nighttime nosebleeds as a child have been mentioned in abduction researchas a possible indicatorof stuff. Theydalways onlyhappen for me in the middle of the night, spontaneously erupting out of nowhere. Never once did I have one during the day that I can remember.

60

Chasing Phantoms

Skin scraping. Had a flashback at the age of four or so while eating vegetables at dinner one night, of a skin scraping on my left arm. There were these little red pepper pieces in the vegetables, and as I stared at them on my fork, I suddenly had this flash of a memory pop intomymindofseeingabrightredscrapethingonmyupperleftarm. And I think something about a stainless steel table, the same room fromthepreviousentrywiththepeopleinthewhitecoats.ButwhenI lookedatmyarm,therewasnothingthere.Itwasconfusingtomeasa kid, to have a memory of something and not know where it came from. But as an adult, I of course now know about abductions and skin scrapings. Im not sure how skin scrapings work, if theyre supposedtoactuallydrawbloodlikethat,oriftheyjustlightlyrubthe skin to take dead surface cells or what. I have no scar on my arm for this. (although any scratch or scrape scar Ive received in the last fifteen or so years is already gone, faded out to where I cant find it anymore, so the fact that I dont still have this particular one from age four doesnt disprove anything.) So who knows. Id be liable to dismiss it, except for the manner in which the memory appeared it was triggered, and appeared in a flash, exactly as buried memories resurface. And also, where does a four year old even come up with somethinglikethat?

Thelittleghostgirl.AndBurgerKing(!)Westfield,Massachusetts. Thiswasprobablyaboutagefour,sinceIwasnowsleepinginabed.I was lying in bed in the middle of the night when an all white little ghost looking girl floated into my room. I wasnt scared for some reason. But she looked about my age, and was dressed to match just how I looked at that time Tshirt, little shorts, and pig tails on each sideofherheadwithbangs.Shecarriedaballwithher.Shefloatedto astopinsidethedoorway,lookingatme,smiling.Thenshetossedher white ghost ball at me through the air. I smiled and reached my arms up from where I lay in the bed and caught this ball as it floated towards me, in silent slomo. I could see that I caught it and was holding itbut I couldnt feel it! What fun! I smiled and tossed it back to her. It floated in silent slo mo through the air and she caught it, and tossed it back. We went back and forth like this three times..but then I dropped the ball. It went over my head and landedsilentlybehindtheheadboardbetweenthebedandthewall.

Part II My Own Experiences

61

Thatswhenthingsturnednegative. Her whole face changed, and it went from looking like a smiling littlegirltogettingtwisted,likeamonster.Shechargedstraightatme, silentlyandquickly,enraged.Myeyesbuggedoutlike,AHHH!As she got near, several feet away, I ducked under the covers to hide. I didnt know what else to do! I stayed under there for a little bit, listening, waiting. Nothing seemed to be happening so I finally peekedouttoseeifshewasstillthere.Shewasgone.Whew! Some may say this was a dream, but I know for a fact I was wide awake. This was not a dream. Nor was I one of those kids prone to fanciful visions and hallucinations. I didnt have any imaginary friends because I didnt need any, I had lots of real friends. And I just didnt have the mindset for that whole deal. And I was definitely not a kid who got carried away in fantasy make believe. I was very practicalminded.(waymorethanmostnormalkidsinfact.)So,thats why I know that I didnt just invent this fanciful hallucination of some onetimeimaginaryghostgirlfriend.Itmakesnosense,basedonwho Iwasasakid. Right aroundthistimeperiod IwasvisitedbytheBurger King another all white smiling ghost figure who floated into my room unexpectedlyinthemiddleofthenightasIlaidthereinthedark,wide awake. (my mom put me to bed way too early at that age, so I would periodically find myself wide awake in the middle of the night, just looking around the room like, doo dee doo dee doobored.) Burger King had the robe and the crown and the beard, smiling all pleasantbut when I looked at his feet from where I laid in my bed, I saw that he wasnt walking, he was floating, which was interesting to me. Hmm, I thought. And I dont remember what happened after that. Theres no conclusion to this incident. One minute he was floating into my room, and the nextnothing. Blank. But I do remember trying to tell my mom about it in the morning at breakfast, Mommy, Burger King was in my room last night! But she paid me no mind. ;) Just the crazy ramblings of a goofy little kid is what she thought, Im sure. She looked at me like, Yeah, whatever, and continuedwithpreppingandarrangingbreakfast.

Split mind crying. Strange incident in kindergarten, five years old when we lived in Massachusetts. I would walk home from the

62

Chasing Phantoms

elementary school every day since it was only a few blocks away. Sometimes I walked with friends, sometimes I was alone. And one day after walking home by myself, I got in the door, then spontaneously started cryingbut I had no idea why. My mom kept asking me what was wrong. But I didnt know! I felt like part of me was upset and traumatized, but yet I didnt know why. Another time when I was about six this happened at school. We were getting ready to leave to go home, putting on our coats and gathering up our lunch boxes and stuff, and I started crying with that weird split thing happening. I was watching myself cry, but not knowing why. One little girl asked me what was wrong was I crying because I was happy maybe? The teacher had just been reading a story to us, so she figured maybe the story was affecting me and I was crying with happiness? (future psychologist. ;) ) I shook my head no, confused. I feltembarrassedbecauseIdidntknowwhatwaswrongwithme,why I seemed to not be in control of myself. Those are the only two incidents like this that I remember. The one thing these two incidents do have in common is that they both involved walking home from school.Eitherhavingjustarrivedhomefromschool,or,abouttohead out to walk home from school. So.something very upsetting and traumatizing happening or maybe about to happen but which I couldnt remember during the time I left school alone and arrived home.

Bedposts. I was terrified of my bed posts around age three? Four? CalledthemTheWoodens.Theyweresmall andround,andlooked like bald headed creatures to me, and if I looked at them long enough at night while lying in bed, Id get hysterical and start screaming and panickinguntilmyparentswouldcomeandcalmmedown.Whatdid they remind me of aliens of some type? Even my dad later questioned this, said he thought that my terror of the round bedposts was indicative of something. He stopped short of saying aliens, even though he totally believes in aliens and UFOs. Probably because to say that out loud is just too weird. Its a place that most people arentcomfortablegoing,eveniftheyintellectuallyknowittobetrue. [Update: After the original writing of this book Ive since had a memory involving being a little kid in Westfield, in my bed in the dark, surrounded by little bald headed aliens around my bed. The

Part II My Own Experiences

63

memory popped up out of nowhere one night while I was in bed, and in this dream/memory thing I WAS a kid again, I was back in my little kid body with my child mentality and all. I could feel myself lying there in the dark in my old bedroom, seeing these bald headed creatures moving aroundme. A couple of faint whimpers came out of meandIthoughtiwantmymommyIdonttakeanythingatface valuethough,sothismayormaynotbesomethingreal.]

The butterflies. Weird incident about the age of five when butterfliesappearedonmybedroomwall.Mymomwasdownstairs with the TV on, talking to somebody who was visiting. Meanwhile, Im upstairs in my room, lying awake in bed, and suddenly what seemstobealltheseblackandwhitebutterfliesappearonthefacing wall, moving and fluttering about. I immediately went totally HYSTERICAL. I jumped out of bed and stood there, facing the wall, screaming and going ballistic at the butterflies until my mom came runningupstairs.Idontknowwhythesebutterflythingscausedsuch an immediate hysterical reaction from me, but my attitude was I wanted NO part of it. But they stopped as soon as she got there. Of course. She finds me crying about the butterflies on the wall!! The butterflies!!andofcoursetheresnothingthere. My bedroom was on the second floor, so it was impossible for the fluttering butterflies to have been caused by car headlights or something coming in at ground level. Its also interesting to note that years later, at the age of 27, I would find myself decorating the wall over my bed with dozens and dozens of butterfly cutouts. Butterflies arealsooneofthosethingsIvebeenattractedtoingeneral,andoneof thosethingsthatpeoplegivetome,forwhateverreason.

Spirals. I became obsessed with elevators and spiral stairs at the age of thirteen. To the point of ridiculousness. Always doodling DNA looking ribbons and spirals on my notebooks at school, dreams about spiral stairs and elevators, obsessing about riding in elevators and wishing to find a pair of spiral stairs. Spirals, helixes, ribbons, and elevators are all major symbolisms/systems/techniques used in mind control programming.

64

Chasing Phantoms

The Obvious Stuff as an Adult The following incidents are not actual memory flashes, but, they areprettyobvious

My first known, overt abduction October, 2001, Orange County, CA. I had recently come across a really realistic picture of a Gray which intrigued me. It was fun to stare at and contemplate the idea of meeting Grays, and the pictures realistic nature made that easy to do. I sat on my couch with the picture in my hand, staring intensely at it forwhatwasprobablylike20minutes.Istaredsohardandforsolong that I was pretty much almost in a selfimposed trance. After the 20 minutes or so I noticed that the background noise had muted. I couldnt hear my roommate Todds TV down the hall anymore. Curious,Ilookedup. Snapping out of my thoughts didnt make the sound of the TV come back. In fact, there was now the feeling of a veil of control descendingonme.Ijumpedup,alarmed.Iwaswideawake,standing inthemiddleofmyroom,andliterallyfeltmywillpowerandabilityto controlmyselfslippingawaywitheverysecond.ItwasVERYquickand verypowerful,whateveritwas.IstillcouldnthearToddsTVthough, due to the muting effect around me. I spun around wildly, and inside I yelledNO! NO!! RUN!! RUN!!! LEAVE THE ROOM!! GET OUT OF HERE NOW!! But I couldnt do it. I was actually arguing back andforthwithmyself: Justgoliedownandwait.Theyllbehereshortly. RUN!!GETOUTOFHERE!!!NOW!!!GO!!! Goliedown.Itllbealright.Theyllbehereshortly. I had this back and forth panicked argument, my fightorflight reflex attempting to be overridden by this calm thought form telling me to go lie down. Itll be okay. Theyll be here shortly. Just go lie down. IntheendIconceded.IwishIhadnt,Ishouldhaverunlikehell. I changed into clothes to sleep in as fast as I could, knowing that I was under control, and not able to even fight back. No willpower. I was literally like a puppet, and I knew it. I knew I was acting like a crazy person. But I obeyed anyway, turned out my lights save for my

Part II My Own Experiences

65

purpleChristmaslights,andclimbedintobed.Ihadafullpotofgreen tea in my system, (translation caffeine) and so I was wide awake. I peaked out from under the covers, feeling like a crazy person. It was 11p.m. And that was the last I remember. I blacked out after that, despite thecaffeine. Tenhourslater,Saturdaymorning,Istartedtowakeupinmybed, feeling like I had been run over by a train. Felt like absolute crap! I kept resurfacing like I was in a drugged out stupor, then Id fall back under again, unconscious. This resurfacing and sinking back down went on for several hours. This is not how I normally wake up. I was finallyabletowakeupafter11a.m.Ifeltlikeitwas5a.m.thoughand I was STUNNED when I finally looked at my alarm clock. My first thought was Where did the night go?!?!? The sun was out and the daywasinfullswing.Isatupinbed,likelalala.Noconcerns. I got up from my air mattress bed and saw my cat sitting in the middle of my floor, and I reached out to pet her, saying Hi. She recoiled from me, her back hunching up, then hissed. Shocked, I tried to pet her again. Now she actually took a swing at me, trying to scratch me and hissed even louder and darted under my desk, hiding from me. Shed NEVER done that before, to me or anybody. ! She was normally a very friendly, affectionate, sociable kitty who likes people. Still oblivious I was like, Huh. Okay. I left her alone, and proceeded to get dressed and set about my day. I was feeling neutral and emotionally calm. I did not question anything that had happened thenightbefore,oranythinghappeningrightnowthatmorning,didnt makeanyconnections.Justtotalprogrammedoblivion. After brushing my teeth and getting dressed and all that I sat on my couch and saw the alien pic still sitting on the arm of the couch, whereIdleftitthenightbefore.Ipickeditup.ButwhenIlookedatit I instantly recoiled and tossed it aside. I had this knee jerk reaction and thought, Dont EVER look at that picture again! My subconsciousknew. So, I reached for a book to flip through instead. lalala. Oblivion. As I read I noticed that my glasses were blurry. Kept taking them off and wiping at them. After awhile I began to realize the problem was

66

Chasing Phantoms

withmyactualeyeitself.Mylefteyewaswatery/runny.Inthemirror Isawitwaspink.FunnybecauseitwasfinebeforeIwenttobed. At this same time I also began to realize there were pains happening in my uterus and ovaries area. But I wasnt getting my monthly. I had never had pains like that in there before. So this was certainlyafirst.Icuriouslypressedinonmyuterus/ovariesareatotry toalleviatethepain. Then the images started. I soon realized as I went about my day that there was a constant barrage of Gray alien faces in my mind anytime I closed my eyelids. Gray faces from ALL angles, three dimensional. Staring straight ahead, faced to the left, to the right, large, small, all kinds. Sometimes just the large, black slanted eyes. Anytime I blinked or closed my eyes, it was there. Nonstop. Like internal wall paper for the mind. At first it was a novel thing. By the end of theday,twelvehourslater,Iwasawreck,becauseitwouldnot stop. I ran into one of my roommates, Denise in the kitchen in the afternoon. She smiled and apologized for the fight that had happened the night before outside my door between her and Todd. I looked at her blankly, and shook my head back and forth. I had no idea what shewastalkingabout. She frowned and said,You know, the fight we had. You couldnt have missed it. We were right outside your door! She told me how Todd had come home at 3 a.m., loudly throwing open the front door, going down the hall to his room and turning on the TV full volume and leaving his door open so he could hear it while he cooked food in the kitchen, banging pots around all over the place, whistling super loud. He woke her up and she came out of her room, pissed off, and theytotallygotintoitthereinthehallrightoutsidemydoor,yellingat eachother. IhadNOideawhatshewastalkingabout.WhenItoldherso,she started to get annoyed, thinking I was jerking her around. She was really sensitive and didnt like people playing her.Carissa...dont lie, you HAD to have heard it. Come ON! Please! She said they even tried to call me through my door, saying Carissa? Carissa? Sorry about all the noise... but I never answered. They thought it was a littleweirdbecauseImalightsleeperandheareverything.

Part II My Own Experiences

67

By this point in the afternoon I was putting things together and starting to realize what had happened the night before. As Denise stood in front of me telling me about this huge ruckus that had happened, which I somehow missed, I realized I wasnt there. Thats why I didnt hear this. I wasnt even there. But what was I supposed to say to her?! So I just played dumb and quickly changed the subject anddivertedherattention. Bynighttime,around11:30p.m.Iwasawreckbecausetheimages of Grays would not stop in my mind. It was as strong as ever, every timeIblinkedorclosedmyeyes.Iwascurledintoaballinthemiddle of my floor, crying silently, because I thought I was going crazy. I believed I was truly losing my mind and descending into madness. Something was trying very hard to convince me that what I had experienced involved the Grays. Yet, I somehow knew that it was all wrong. Something felt off. I KNEW deep down that I hadnt been abductedbyaliens!eventhoughIvesoheavilyresearchedthematter andhadallthesymptomsofanabduction. Two days later, on Tuesday night, all of us roommates got into it with Todd, yet again. He was always making problems and we were always mad at him. He had me SO annoyed that I stomped off to myroomandwenttobedallangryandriledup.Ilaythereinmybed, totallyfuming,andsuddenlyinmymind,Iwasntinmybedanymore. I was laying flat on my back, on a table, under a lightsurrounded by three Grays. It wasnt a still frame image, it was a moving flashback memory. They were surrounding me, peering down at me. I saw one tilt his head slightly to its left, (my right) and lean in slightly, peering at me closer. They werent gray in color, and they didnt have those exaggeratedroundheavylookingbulbousheads.Theywereporcelain white, with the black slanted eyes, the slit for a mouth, and thin necks andbodiesandarms.Theirfaceswerelong.Veryelongated,butwith that slight upside down teardrop shape to them. And they seemed so WISE. I just lay there, completely blank and passive, like I was in a druggedstupor. I was so scared at this sudden shift in my mind that I gasped and yanked myself out of the flashback. WHAT the HELL was THAT?!?! My first memory of what happened on Saturday night, thats what! Finally, a memory! Something to confirm all the other roundabout evidence.Itwasaboutdamntime!Interestingthatitdidntoccuruntil

68

Chasing Phantoms

I was emotionally worked up about something else. Like my mind needed to be diverted and focused on another emotionally intense experiencebeforeslippinginaglimpseofthatone. During the week when I was at work, I had the most wonderful feeling that something fantastic had occurred the past weekend, something which was there just under the surface of my brain, but which I couldnt access anymore. It drove me NUTS. I wanted so badly to remember the experience, and I could feel it, right there, but justcouldntpullitup. The only way to get to it and get it back was to do it again. Have anotherabduction. I mentally asked for one several times, wishing to do it all again this upcoming Saturday night. Also, the mild case of pink eye lasted mostoftheweek,inmylefteye,butfadedoutonitsown,interestingly enough. The pains in my ovaries/uterus persisted off and on during the week. The images of the Grays in my mind lasted fully into Tuesday. And my cat refused to let me within several feet of her until well over a week later, something that my roommates noticed and commentedon.Butagain,whatcouldIpossiblytellthem. However, by Thursday, I changed my mind about being abducted thanks to some outside input. I had told Tom, via email, about this experience, and he warned me about the negative nature of Grays and abductions.Whatsinterestingisthatoneconcernedwarningwasallit tooktosnapmeoutofit.Mysubconsciousknewandrecognizedthe truth of his warning right away, even if my conscious brain was programmed to think otherwise. So I mentally changed my mind aboutit. Saturday night arrived, and I wasnt even thinking about the abduction anymore. I figured I had changed my mind and that was that,thatsallIneeded.Itsover. Nope.Sorry.Doesntworkthatway. Isatthereonmycouch,readingagain.Toddwasdownthehallin hisroom,hisTVgoingloudly.Histwolittleboyswereoverforavisit this weekend, since he was in the middle of a divorce. I listened to their voices as I read. Then suddenly I realized that Todds TV was being muted and all background sound was now gone. Alarmed, I tossed my book aside and instantly jumped up without even thinking. Ilookedaround,panicked.

Part II My Own Experiences

69

The veil began descending on me, and I felt the same identical thing as the weekend before. My willpower was being squelched down.WitheveryseconditslippedawaymoreandmoreandIknewI didnthavemuchtime.Fight!!Fightback!IhadthethoughttoRUN!! GETOUTOFHERENOW!!!followedbythesameargumenttojustgo liedown...liedownandwait,theyllbeheresoongoliedown SoIran. I flung open my door and ran down the hall and into the bathroom,closedthedoorandlookedaround.ButIcouldstillfeelthe veil. Panicked, I thought about hanging out with Todd and his kids across the hallway, but I knew that was useless. I knew that they could and would get me anyway, even in Todds room. I ran out of the bathroom, back down the hall and peered into my room. Nothing had arrived yet. But I could still feel that blanketing pressure veil thing on me. I ran into the kitchen. Still there. Everywhere I went in the house, it was there on me. I kept mentally screaming NO! NO! NO! the whole time. I REALLY did NOT want this anymore. Finally in desperation I threw open the front door and ran down the steps, down the walkwayand halfway up the street, like a crazy person, tryingtoget awayfromthatveilofcontrolthing.Igothalfwayupthe street and I felt it sloooowwly subsiding. I would have kept running as long as I had to. I wasnt going ANYWHERE that weekend, with anybody. I was determined. I did what I should have done the weekend before. Cautiously, I turned around and headed back to the house.Theveilwascompletelygonenow. Such an overt attempt to take me while I was wide awake never happened again. It only works if you allow it to and cant/wont fight backandresist.Afterthattheyresorttocovertmethods.

The laser beam me up line. While living in Portland, Oregon, and roommatingwithmybrother,IglimpsedwhatItheorizeistechnology for beaming somebody up. It happened around 7 p.m., when my brother was at work and I had the tiny apartment all to myself, along with my cat. Kitty (her name) was uncharacteristically scared and clingy that night, sticking close by me wherever I went. If I got up to go to the sink she followed and jumped up on the counter just to be as close to me as possible. When I went back to my bed and sat down, she jumped down and ran with me, and crawled into my lap, curling

70

Chasing Phantoms

into a scared ball. I noticed this, and thought huh, I wonder whats up?asIpether.Hertailflickedaroundwith agitatedenergy.After a few minutes of me reading my book while petting her, we both had the urge to look up at my brothers bed at the same exact momentand thats when I saw this white laser line looking thing appear about a foot over his bed, horizontally over the spot where he wouldnormallylay.Mycatfrozeupwhenthathappened,andhertail stopped in midflick, and she just stared at it, bug eyed. The line appeared out of thin air, was about 23 feet long, glowing white, and slightly thicker in the middle than at the ends. It glowed brightly for several seconds over Joes bed, reaching its peak intensity, then faded back out again. It never made any noise. No other phenomenon accompanied it. Afterwards, I called my brother at work to tell him about it, and see what he thought it was. He just laughed and said Damn!Imissedmyconnectingflight!

Astral Pow Wow/Abduction. April 2002 I believe Tom was still backinIowaatthispoint,andIwaslivinginFortLauderdale.Hewas going to be moving down to Florida in June, after school finished, but by that point I just couldnt wait to see him. The feeling of wanting to see him was so intense that I apparently made it happen. I brought him to me. I woke up in the middle of night, finding myself lying on myleftsideonthecarpetinthemiddleoftheroom,withmyrightarm aroundhim.HewasphysicalbutIwasntinmybody.Isoonrealized this when my hand touching his skin was buzzing. My whole body wasbuzzinginfact.Irealizedthisstraightoff,butdespitebeingoutof my body, and despite the situation something I had NEVER experienced before I kept my wits about me and had my usual sense of humor. I joked to myself, Well, I went to bed alone, and woke up with a guy in my apartment! :D Words dont convey the level of happiness I felt though. I sat up in my astral body, gazing down at him, feeling the most incredibly pure love I think Ive ever felt for anybody. I reached my hand out and laid it on his chest, and thats when he started to wakeup. His head moved suddenly from his right to the left, taking a big breath, and as he awoke, the connection broke. I started involuntarily floating up and away from him, towards the ceiling, with my hand reaching out to him. Rapid scene switch, and now hes gone from the apartment, and Im sliding backwards from

Part II My Own Experiences

71

that spot on the middle of the floor, back into my body. I felt and watchedasIslidandadjustedmywaybackin!!Hadtowigglearound afew timestogetbackin.Andthen Iopenedmyphysical eyes,but Icouldntseeclearlyforafewseconds.Myvisionwasdistorted,andI had to blink blink blink to get my proper vision back. I just laid there, SO happy. Even if I was only able to see him for a few seconds, that was okay. The next day I emailed him and asked him if anything unusual happened to him last night, and he said Yeah, actually, it didhe woke up with the remnants of a nosebleed, and the feeling thatsomethingreallysublimehadhappened. Well, if youre an abductee and you do something like this, dont think they wont notice and come for you. A stunt like that is absolutelyoffthecharts. The very next time I laid down to sleep, which was the following night, they apparently took me. And whatever they did to me put me outof commissionforanentireweek.Ihadnoactual memoriesofthe events,Ionlyhadthephysicalaftereffects. I was able to go to work just fine and drift along through my day, but when Id go home, I would just lay and stare at the walls and do nothing for hours. I dont recall eating some of the food I had in the fridge went bad as a result I dont think I even showered. I had no desireorwilltodoANYTHING.Iwasfried,blank,numb.Idjustlay there and stare at the walls or ceiling, for hours, day after day. On Thursday of that week I was in the bathroom standing at the sink, staring at nothing in a blank stupor, feeling lost, when my hands absentmindedly reached up like they had a mind of their own and started hunting around under my hair, at the base of my skull. Like I was searching for something. And I knew it when I found it. A large lump on the base of my skull/top of my neck, about the size of a quarter. It didnt hurtbut as soon as my fingers touched it, Ihad the immediate commanding thought,ITS JUST A SPIDER BITE! with thecorrespondingimageinmymindofablackandyelloworbspider on a web to reinforce it. The image in my mind was large, like seeing apictureoranimageonascreen. As soon as I saw that image in my mind I knew. Thats programming.Someprocedurewasdonetome,andmysubconscious remembered and knew EXACTLY where to find the residual lump without my conscious even having to think about itand as soon as I

72

Chasing Phantoms

found it, the programming kicked in to try to convince me it was just a spider bite, complete with convincing spider imagery and everything. Move it along folks, nothing to see here, move it along, nothingtosee Atanyrate,afterafullweekIbegantofinallypulloutofmyblank stupor and come back to life, regaining my personality and energy, backtoeatingandlivingnormally.

Unexplained cold. Woke up another time in the morning very suddenly with my body all cold, as if Id just been standing in a refrigerated room, or someplace with some mega air conditioning going on. My blood flow was fine, and I wasnt cold internally, it was just the surface of my skin that was cold to the touch. But I was in south Florida. In August. With no A/C on. There was no logical reason for me to be this cold in my hot and humid apartment. It seemed to be another case of being plunked back from someplace that possibly was very cold or air conditioned, or possibly the transport processinitselfcandothis,Idontknow.

Nocturnal programming commands. Woke up one morning in Florida right in the middle of somebody programming me. Heard a male voice saying in my mind, YOU WILL ONLY SEE WHATS WRONG AND UGLY IN THE WORLD! YOU WILL ONLY SEE WHATS WRONG AND UGLY IN THE WORLD! It was alarming, thats all I can say. And Im glad I woke up in time to catch it, and be awarethatthistypeofprogrammingwastryingtobeinstilledinme. Woke up another time hearing a male voice repeating over and over, kind of loud and intensely YOU WILL NOT REMEMBER WHO YOU ARE NO MATTER *WHAT* ANYBODY SAYS TO YOU!! YOU WILL NOT REMEMBER WHO YOU ARE NO MATTER*WHAT*ANYBODYSAYSTOYOU!!Yikes.

More programming. This ones weird it seemed to be a (very vivid) dream of an actual abduction occurrence, and because its very obvious, I decided to group it in this section. But around April 2002 I dreamed that I was lying on a table under a light, feeling like I was in a drugged daze, and hallucinating on top of it that I was seeing all these little gecko lizards pouring out of my Xyphoid Process area of

Part II My Own Experiences

73

my chest. I could feel that there were humans standing around me, butIcouldntseethem.Ijuststaredatallthelizardsrushingoutwhile a male voice off to the side informed me in a hypnotic voice that these lizards represented my reptilian genetics. When I pendulum dowsed this Ive always gotten that No, I dont have reptilian genetics and that Im not a hybrid either, howeverI have, supposedly,beenanonhumaninotherpast/parallelincarnations.But the fact that I was lying on an exam table, drugged up and hallucinatingaboutlizardscomingoutofmychestisenoughformeto know that its not true. So its important to point out that there is programming to get abductees to believe things about themselves that are not true including that theyre alien or Reptilian hybrids, or have those genetics in some way. Its a huge avenue of deception because itcanbeusedformanymaliciouspurposes. Remote viewing? Woke up one morning, hearing the voice of a guy saying 14141. 141 is a number that has followed me everywhere since my brother back in 2002, documented in detail on my website in the Number Sightings write up. And here it was being used like a codealmost,programming,atrigger,notsure.Isortofsaw,oratleast imagined, the source of this voice as having a beard and glasses, neutral personality, not angry, not happy, just neutral and non emotionalinapleasantbutfirmway.Igettheimpressionthatinthis dream I was remote viewing for somebody. I can feel that just beforeIwastriggeredtopullout,Ihadbeendoingsomething,looking for, or at, something, for somebody elses benefit. Its just a fragment that I can remember, but thats definitely what I know of from what littleIcanremember. When I was halfway in and out of consciousness, slowly waking up after hearing the 14141 command, sensing the guy behind the voice, rightthenathoughtformcutinon thelineyoucouldsay.Very distinctly, sounding like me (in my higher self way) and in a neutral but firm way it told me, They have the ability to use you now when youre sleeping without having to physically take you. It sounded like it wanted me to know this, as a heads up FYI. I filled in the blanks and concluded it would be due to implant technology, so they might be able to connect to my brain while I sleep, using the program trigger codes to activate whichever portion of the mind they

74

Chasing Phantoms

need. Tell me what to look for, and then, due to the two way implant, they would see whatever I see in my minds eye. What I see, they see, instantly and automatically. VERY ingeniousif thats whats going on. This type of technology was actually later confirmed for me in the writingofFritzSpringmeier.

Programmingscript.IwokeupanothermorninginFloridacatchinga male voice in the middle of doing what I can only describe as reading from a script, telling me something that Im not going to repeat. He was calmly, methodically telling me that certain things had happened to me in life, which I highly doubt, especially considering thefacthesoundedlikehewasreadingfromascript.Buttheeffectsof believing something like that would be absolutely devastating on the psyche. Most people could not mentally handle being told what he was telling me.in fact, were you to do the research, such ideas couldanddocauseaninvoluntarymindfracture. Later on after the fact I came across Carla Emerys Secret, Dont Tell, her book regarding unethical hypnosis and government mind control projects, and surprisingly discovered that the concept of reading a script to a drugged and vulnerable target is absolutely something that is done, and involves related subject matter of what was said to me. And its done with the intention of causing the mind tofracture.SoIimaginethesametechniquecouldapplytoatargetvia their implants. Im sure it wouldntalways have to be done inperson, with the target drugged, possibly being in a susceptible sleep/trance statewouldsufficejustaswell.

Outof body. Foraperiodoftimein 2003, February the summertime I was having trouble staying in my body when Id lie down to sleep, andalso,Iwouldperiodicallywakeupnotknowingwhere,orWHO,I was. ! When Id lie down, as soon as my body would relax, I could feel myself slipping out of it and rising up several inches over my body. Id have to pull myself back down, only to slip back out again thesecondIstartedtodriftofftosleep.Curlingupinthefetalposition would finally thwart it. I was being abducted a lot during this time period it seems, so maybe this was having an affect on being able to stay in my body. Ive since learned that an after effect of being out of

Part II My Own Experiences

75

the body like that will, for me anyway, involve temporary amnesia whenbackinthebodyagain,lastingabout30seconds.

An Almost Soul Abduction. Had an incident where I went to lie downforanapandsomethingtriedtoyankmeoutofmybody.As I lay there, a rapid spinning in circles sensation began, with wind blowing around and the feeling of being tugged upwards, out of my body. Id pull myself out of it and try to fall back to sleep again, only to have it repeat. This yanking went on like six or seven times in a row.IallowedittogoonaslongasitdidbecauseIwasntscared,and was curious to see if this was going to lead anywhere. Was I finally consciously witnessing an abduction?? But then, I heard something funny, some kind of audio, this voice, noise, something, that sounded like it was coming from the end of a tunnel or tube, and THAT got me alarmed.ItdidntsoundlikeanythingIcandescribe.I just knowthat the second I heard it, my eyes bugged out in my mind, there was subconscious recognition going on, and thats when I freaked out. I mentally yelled out NOOOO!!! NONONONONONONONO!!!!!! I abandoned the nap plans. As I sat up in bed I noticed that my body had an electrical tingliness happening, mostly centered in my arms. Andwithinanhourafterwards,Idevelopedanotheroneofthosesmall purple circles, (EM energy surge burns, according to the Cs) on my lower left arm. I grabbed a photo. http://in2worlds.net/anomalous markings

Astral Giraffe. Went to bed one night in early 2003 while living in FortLauderdale,butsomethingdidntfeelright.Hadaslightlyfearful feeling, although I did my best to squelch it down. Did a small intention for protection, then zonked out. Well I awoke like an hour later(layingonmystomach,myheadfacedtotheleft)tothesoundsof wind whipping around, and me spinning clockwise, around and around and around. Everything was getting faster and faster, the spinning, the wind, all the while as I lay there, paralyzed, unable to snap out of it. The wind got so crazy I had the sensation of my hair blowing all over the place, and I was actually getting physically sick from all the spinning. It finally culminated with me screaming out in my mind NOOOOOOOOOOOOOO!!!!!!!!!!!!!!! (which actually had this bizarre, echo effect happening on top of the wind!) Then I was

76

Chasing Phantoms

finally able to pull myself free from the spinning and wind, and unparalyze myself. As I did so, I turned and looked over my left shoulderandwasstartledtoseeabiggiraffeface,staringrightatme.I mentally jumped. At first I thought it was a deer, then I realized as I stared at it that nothats actually more like a giraffe. [NOTE: Giraffes, owls and deer are all screen images common in abduction scenarios.] When I say turned and I jumped, I didnt do it physically. I wasnt fully in my body, because I didnt feel the covers or the bed. It was astral. Then I was back in my body again, feeling the bed and covers. When I snapped back in, I didnt know where I was for a second or two. I didnt even recognize my surroundings. Talkaboutdisorientation!Ittookmeasecondortwotoadjustbackin, rememberwhereIwas,evenwhoIwas,andwhatwashappening.My heart was racing and my nerves were all standing on end, and I could STILL HEAR the remnants of the wind around me, and feel the effects on my body, even though I was now awake. Very loud, surrounding me over my head, whooshing this way and that. I pulled the covers over my head to drown out the whooshing wind noise, like, AHHHHH!!!ShutUUUUP!!!Ineedtogetbacktosleep!!Ihavetoget upforwork!!!IdonthaveTIMEforthis. So I wonder what would have happened had I not fought this off, and allowed myself to be taken out of my body. Where would I have gone? This experience resulted in yet another one of the round purple circlemarksthatIsometimesusedtogetonmy(left)arm.Isnappeda photo of it, which can be found on my website in the Anomalous Markings section. http://in2worlds.net/anomalousmarkings For me, the small round purple circle marks on my arms always seemed to happen after fighting off something trying to pull me out of my body. On one occasion, the purple circle was accompanied by a tingly electricalsensationinmyarm.

Practiceconfrontation.Inthemiddleofthenight(February6,2005) Ifeltmybodystartingtoswirlandmoveabout,andpullupwards,like asoulabductionpossibly,whereIbegantogetpulledoutofmybody. Then I mentally connected with the presence behind it, which was VERY frightening. When feeling it face to face so to speak, I was overcome with fear. Couldnt get a grip on myself and combat it with

Part II My Own Experiences

77

nonfear, love,neutrality,positivethoughts,oranyofthetacticalgoals Id had in mind at that time. I just fell apart and panicked. Was also slightly paralyzed. I mentally thought no!no!no!no!no!no!no! and forced myself out of the paralysis and the panic, my heart racing, nervesonend. But I immediately heard a friendly, kind, warm thought form cut in, which sympathized and told me, Dont worrywith practice you can do it. It, as I telepathically understood it to be, was the ability tooverridethefearandfacetheabductorsheadonandpullmyselfout of their grips without completely losing it. REALLY interesting and weirdtogetthatfeedback Suspicious Stuff as an Adult

When looking for indicators of whether or not youve been abducted, you have to look at everything, no matter how seemingly trivial or stupid it initially appears. This is because they wipe out memories, so all there is to go on are the covert, very subtle indicators that something is amiss. Its all we have. So really nitpick and scrutinize. Dont forget, weve all been raised on Hollyweird movies, whereeverythingisDRAMATICandEXAGGERATEDandOBVIOUS. Well,reallifeisalotmoresubtle.Whichiswhypeopletendtomissso much of it. Theyre waiting for big exaggerated drama and stuff to be spelled out for them that they completely overlook stuff thats happening right under their nose. (myself included, Im definitely guilty of having done this too many times to count, which is why I knowenoughnowtopassonthetip.)SoIrecommendmakingalistof ALLsuspectevents,nomatterhowsillyitmayseemtobe.Sometimes even the littlest things can point to something. Some things will turn out to have a logical explanation and can be either discarded, or at least put on the backburner. But some may not. And those are the incidents and events worth focusing on. From there, look closer, and expand your scrutiny into the rest of the aspects of your life. Ive experimented with a pendulum, dowsing answers to confirm whether my own incidents were what I thought they were. For your experiences,dowhatworksforyou.

78

Chasing Phantoms

SmashandGrab.InAprilorMayof1995,age20,Iwasatthatpoint living in one of the rooms at the hotel I was working at. It was a temporary situation, being that I was planning to leave on a cross country road trip with my thenboyfriend Gary in June. I was renting one of two full size, regular nice hotel rooms that happened to be locatedinthebasementlevel,downthehallfromHousekeeping.They were there for employees to use, basically. The hallway led to the parking garage, giving it outside street access. It was a bizarre time periodforme,fullofemotionalhighsandlows,periodsofexhilaration anddepression/despondency.SoonenightImlyingonmybed,inthe dark, going through another one of my extreme emotional lows, feelingsuicidalanddespondent.Theonlylightintheroomcamefrom the parking lot lights that shone through the small window up by the ceiling,whichwasontheleveloftheparkinglot.Butitwasenoughto see around the room. And as I was lying there, wishing to die and feeling very despondent, I had this sudden hallucination of what appeared to be a military looking guy silently bursting into my room, automatic rifle drawn and pointed at me, rushing silently right up on meand thats where I pulled out of the hallucination, gasping and sitting up in bed, like AHHH! WHAT WAS THAT!!! I had NO explanation for this, as I was NOT somebody prone to hallucinations. Itmadenosense.ButIsoonputitoutofmymind,thenforgotaboutit altogether. Years later while reading up on MILABs research, I continually cameacrossreferencestowhatItermthesmashandgrabmethodof taking an abductee, discussed in Part I of this write up. And as mentioned, I always thought this method of operation seemed a bit ridiculous. My hotel memory was still obviously buried, forgotten. Until one morning in 2004 when, while questioning my Flagstaff Arizona incident (following this incident) I wondered whether I had ever had any telltale funny happenings in any of the hotels Id ever stayedatduringmytravels. Then this memory resurfaced. A full ten years later. And I literally pulled a Home Alone in the mirror. My eyes got HUGE, my mouth dropped open, my hands involuntarily went up to my face, clutching it, adrenaline surging. It was a look of horror that I cant duplicate now, funny enough. It was like the floor dropped out from under me. IjustcouldnotBELIEVEthatIcouldhaveforgottenthisincident!!!Id

Part II My Own Experiences

79

been reading about MILABs for the past two and half years by that point, and never once did I remember this hotel incident. If ever they weregoingtosnagmeviaSmashandGrab,thatperiodoflivingatthe hotelwasabsolutelyopportune.Iwaslivingatahotel,inthebasement, with a hallway that had parking garage/street access. Hello. Coming in through the unlocked parking garage door in the middle of the night, down the hall and into my room which at that point used the old fashioned metal key locks not electronic and then grabbing me and hauling me out, unseen, would have been a piece of cake. It was almosttooeasyinfact. This hallucination of a military guy bursting in to my room was probablynotsomethingthathappenedtomeatthetimethatIsawitin my mind, while lying on my bed. Rather, it was more likely a flashback memory of something that had recently taken place, and it was bubbling up to the surface as I laid there, in a blank, numbed, depressed stupor. In fact, Id theorize that abductions/programming was causing me to fluctuate into these inexplicable depressed stupors in the first place. Upon quick glance the emotional ups and downs I described sounds a lot like Manic Depression/BiPolar Disorder. But I dont think that was the problem, since I was/am very functional, unlike how Manic Depressives tend to be who often require meds to get through life. As mentioned elsewhere in this book, I wonder if the side effects of mind control and abductions masquerade as known brain/psyche disorders Manic Depression. Schizophrenia. Etc. 1995 1996 was a time period where I obsessed about my death, as well as continually putting myself into dangerous situations that would get me killed. I went through another similar period back in 1991 1992, always fantasizing about guys having a gun to my head and killing me. Not normal! Sounds like MILABs stuff to me, now that Ive studied up on it all. In fact theres a cartoon illustration in the book MILABS by Dr. Helmut Lammer showing a girl sitting in a chairwith military guys surrounding her, guns pointed at her head. Interestingcoincidence.

Possible Flagstaff/Sedona, Arizona abduction. In July of 1996, while living in Orange County, CA I decided one day on a whim that I was going to drive out to Flagstaff/Sedona Arizona on my two days off from work. I had no idea why I wanted to do this, the idea just

80

Chasing Phantoms

popped into my head, and I went along with it. My coworkers, roommateseven my boss Edwin, who I was buddies with, were all like,Why?!?Idontknow,wasmyresponse.Soundslikefun!Why not! And so I did it. Drove the eight hours from Orange County to Flagstaff, and got a room for the night at a Motel 6. I got dinner at McDonalds, then wandered around outside the motel on the train tracks, kicking rocks around, looking up at the stars, wondering huhnowwhat??WhatamIsupposedtodo??Irememberlookingat thestarBetelgeuse,ormaybeevenMars,redandprominent,hopingto seeaUFO,sinceIwasinUFOcountry.Nosuchluckthough.Itwas ten p.m. and I didnt know what the point of all this was. I was tired, and so decided to just go to bed. Once in bed, I remember lying there, doing some sort of praying, trying to see if I could feel a connection to any sort of anything spiritual, Godish, angellike, or whatever. Felt absolutely nothing, which was a bit of a let down. I realized I really am completely alone here in life, totally on my own. Oh well. No surprisethere.Thenthatwasit,Iwasoutforthenight. In the morning I was unable to wake right away, feeling unnaturally groggy and wiped out. So much so that I couldnt get out of bed in time for the 11 a.m. checkout. Had to get an extension to 1 p.m.andeventhenIhadtoforcemyselftogetup.AsfarasIcantellI had no memories of waking during the night, although that may be incorrect, Im not 100% positive on it. At the time I didnt think anything of it, figured I was just tired from all that driving the day before. Finally just got up, got dressed, and checked out. Took a spin down the17, but nothingtooexciting.Ididntknowhowtogettothe actual town of Sedona, so never got that far. Bought pair of earrings from a roadside Indian woman, and finally left to make the eight hour trekbacktoOrangeCounty. Knowing what I know now about the Flagstaff/Sedona area, and the fact that there are bases and a huge amount of alien/military activity happening there, and how sometimes stuff will get you to drivetothemmakesmeseriouslyquestionthisentireepisode.

Gray overlay? After moving up to Portland to roommate with my brother Joe, he had made me aware of our joint status as supposed alien abductees. There was a strange incident that occurred one night while I was lying on my sleeping bag. Joe was sitting on the edge of

Part II My Own Experiences

81

his bed to my left, flipping through something that he was reading, while I lay in my own bed, under the covers, staring at the ceiling. AndthatswhenIsuddenlyfeltlikeIwasslippingunderwater.Itfelt like I was sinking down, slipping away, and through my eyes things looked as if they were moving away from me. It became hazy and heavyanddream like.AsIslippeddown,Isawmybrotherglanceup at me as he readthen do a Holy shit!! double take, eyes bugging out. He had genuine shock and actual fear on his face as he looked at me, like he couldnt believe what he was seeing. And this was a kid whowasabsolutelyfearlessbythatpointinlife.Finallyhemanagedto sputteroutsomethingabouthowhedseenmeturningintoaGray! Hisvoiceyankedmeoutofthisdreamy,slippingunderthewaves trance stateand for a split second I felt slight annoyance, for some oddandinterestingreason. I turned to look at him, coming back into myself, and he excitedly explainedwhatitlookedliketohim.Iwaslyingthere,andthen.my face morphed into a Gray face. I knew my brother long enough to know when he was being sincere and when he was bullshitting, and right now, he was being sincere. Whether I really had actually started toturnintoaGray,Idontknow,butIknewthathetrulybelievedthat hed seen that. And I definitely felt something really strange going on at the exact same time that he did that Holy shit!! double take, so, I dontdoubtthatthishappened. Shortly after that incident I was handing something to my brother, and for the first time I consciously noticed my fingers as I reached toward him. I was gripping the object with only three fingers, my pinky and ring fingers bent down, as if they were superfluous. I stopped in midair, frowning at my hand. Then I resumed giving it to him and mentioned it to him. I realized that Id been doing this with everything in fact for a little bit of time nowsince my October abduction two months before, actually. I didnt like it, because what was THAT supposed to mean?? Gray attachment? Also I only recently remembered that during this particular time period of living in Portland I was experiencing constant facial muscle discomfort. I was always rubbing andmassaging at my face, particularly my cheeks and the sides of my face. Something felt off with my face. Whatever it was,itsgonenowthough.NomorethreefingersorGrayoverlays.

82

Chasing Phantoms

The pen from nowhere. A great example of an artificial synchronicity: It was the final week at my temp job up in Portland, and several of my coworkers who liked me had suggested that I should apply to work for the company permanently. For kicks, I went to the HR department to get an application even though I was planningtomovetoFlorida.IntheelevatorridebackuptotheofficeI stood there against the right wall, holding the application, wondering What exactly am I doing here? Am I going to stay in Portland and use my money to get an apartment downtown somewhere? Or am I going to move to Florida? Should I fill this out or not? I mean seriously,whatamIdoinghere?? And right then as the elevator stopped to let a guy out, a silver Cross brand pen slid across the elevator floor, spinning with force andcomingtoastoprightatmyfeet,perfectly. Ilookeddownatthepenatmyfeet,myeyeswide. I looked behind me, from where it came the back left corner of theelevator. Nobody was standing there. The only other person in the elevator wasawomanstandingagainsttheoppositewall.Shetoolookedatthe back corner, wide eyed with disbelief. It was she who said, Its the penfromnowhere! Ibentdownandpickeditup,like,Huhwillyoulookatthat.Im standing here contemplating whether to fill out this application, and something tosses a pen at me, landing at my feet. It was such a government agent Them pen too. Heavy weight, smooth silver Cross pen. Nice. ;) [And on a side notethe exact kind of pen my dadalwayslikedwhenIwasgrowingup] I debated about the meaning of this unbelievable coincidence. EitherTheywantmetofillouttheappandgoforthejobandstayin Portlandbecause its actually bad for me so, sabotage or, this really isa signfromsomethinggoodthatI shouldstayhereand forfeit theFloridaidea. hmm. I decided to go to Florida. As I now know, positive forces dont workbygeneratingartificialsynchronicities.Plainandsimple.Ifitsa farfetchedartificialsynchthenitaintgood.Moveon.

Part II My Own Experiences

83

Power outage phobia. Not too long after moving into my new apartment in Fort Lauderdale, I realized I had an actual phobia about the power going out. Id never experienced that before in my life. But on one occasion when the power glitched I had an immediate anxiety attack, looked around wildly, heart racing, and made a beeline for the front door, bursting outside like a nut. Getting outside was safe, I knew. I could run to freedom. Being caught in a closed in apartment inthepitchblacknesswasvery,verydangerous.Thisbecamesomuch ofan issue that Isetupflashlightlanternsaroundtheapartment inthe event that this ever happened while I was not near the front door. I hadNOintentionofbeingcaughtinthepitchblack,unabletoknowor see what was going on around me. So I had lanterns in the bathroom, in the kitchen, and another right next to my bed. This isnt normal! But interestingly enough, I encountered another alien/MILAB female on a message board who was the exact same way. She also had flashlights set up around her apartment, due to an issue about being suddenly caught in the dark. This means something, in my opinion, and is indicative of something possibly very negative happening at night, in the dark, or something cutting the power and swooping in, I dont know. I once had a dream, relayed in the Dreams section, regarding insectoid aliens cutting the power in my old house in Connecticutandstealthilyswoopingintocomegetme.So,thatseems tobeapossiblemodeofoperation.

Symbolisms. Have a penchant for being attracted to all the Illuminati/Brotherhood (dont know what else to call it) and mind control symbolism pyramids, suns, eyes of Horus, white owls, phoenixes, Alice in Wonderland, shrooms, butterflies, etc. etc. At one point I had surrounded myself with many of this imagery in my apartment, it was all over the place. Until I learned what it all meant, then most of it came down. Dont know if this means anything or not, but mind control targets supposedly have that tendency to surround themselves with the imagery, which helps reinforce their programming.

Sudden return. Had several incidents back in Florida of waking up very suddenly, gasping, at 6:59 a.m. on the nose, like I was put back literally a minute before my alarm was to go off. One of those times I

84

Chasing Phantoms

came back with my adrenaline still going. Couldnt remember anything, yet, I had total residual after affects of MAJOR stress, anxiety,andtrauma.FeltREALLYfrazzled.Itstayedwithmeallday, and even my coworkers knew something was wrong with me. When IwassayingsomethinginafrazzledwaytomybuddyRyan,hejoked, Hey, calm down, before you give yourself an aneurism. My personality by this point in life is normally very easy going and relaxed.Sothiswascompletelyoutofcharacterforme.

Residual drugs? Woke up one morning in Florida in 2003, feeling drunk except I hadnt been drinking. I was SO dizzy, I could barely stand up, and it lasted for half the day, well into the afternoon. There was nothing else wrong with me, just a feeling of being drunk, but, without the drunk. I didnt even think to take a pee sample first thing after waking, because I had no idea where to go with it or what to do with it. Now I know to do thisso of course, now they dont let this happen anymore. Things openly happen when they know youre not ontheballandwontdoanythingaboutit. Sidetrack Circus Diversion Harassment

In the opening introduction to this piece I mentioned that oftentimes, higher realm entities are toying with us in the same way a catwillbatarounditsprey.Butsometimestheyredoingmore,andso its important to learn the difference. And thats where this section comes in. In February 2002 after I made a break in life from my brother (who was a heavily programmed MILABs target) and moved to Florida, I hooked up with my current boyfriend Tom of four years, and life became.very strange, to say the least. Life had already been strange anyway, but before all this it had been more paranormal strange, with the beginning glimpses of MILABS. Now, it was getting aliensandUFOstrange!Tomrunsawebsiteonallthingsrelatingto metaphysics, conspiracy abductions, and hyperdimensional manipulation in human affairs. Because of who he is, hes been a lifelong target of alien abductions, and possibly MILABs as well. So when I hooked up with him in life, stuff took a huge interest in our affairs and I suddenly became a marked target as well. Not just

Part II My Own Experiences

85

because of my involvement with Tom, but also for parting ways from my brother and possibly breaking from programming. I apparently wasntsupposedtodothat.Sosuddenly,eyeswereonme. All throughout 2002 and into 2003 we both began experiencing what Ive now termed sidetrack circus diversion/fear and paranoia generator! incidents (cue circus music here) designed to do exactly as it sounds send us into a tailspin of fear and paranoia, obsessively going in loops about these distracting incidentsand even hopefully break us up, if all went well. Had we been different people, and had the situation been left unchecked, it could have easily disintegrated into the type of paranoia and craziness one sometimes finds with abductees. The thing that ultimately saved me was also one of my weaker points my ability to tune stuff out, turn away and go back about my business and put it all out of my head. Its one of my big downfallsbecauseitskeptmeinastateofobliviousnessordenialover the years with regards to certain things waaaay longer than necessary, but yet its also the same response/behavior that kept my frequency leveled. Being relatively level (regardless of the reason), versus being worked up, paranoid and terrorized probably prevented far worse thingsfromhappeningtome,whichcarriedmethroughuntilIfinally gleaned my big moment of insight regarding the fear frequency in Aprilof2003.http://in2worlds.net/thehigherself Once I was told about the fear frequency, and heard that this is whatwasbeingdonetomeallthosemonths,IstoppedwhateverfearI didhaveliterally,overnight.Andconsequently,mostoftheserandom weird events stopped as well, reflecting that shift in awareness. I couldnt take any of it seriously anymore, and so they no longer had a use for doing that stuff. And as of this point, Tom and I rarely if ever get incidents like this anymore. Thats pretty astounding in its implications. To go from there to here means something pretty big changed. That something was our mindsets, and its something more abductees could benefit from realizing. I want to stress again though that remaining in a state of denial ie, head in the sand about things wouldnt have worked forever. Ignoring stuff will only get you so far, as I outline further in Part III. But again, it at least helped carry me through until I could get to a place of awareness that enabled me to tackleitallstraighton,withnofear.

86

Chasing Phantoms

So with that in mind, the following incidents are the kind of random, crazy sounding, harassment/fear generator/distraction tactics oneoftenhearsaboutwithMILABSabductees:

Alien in the Cloud. March of 2002. Not too long after moving to Florida I was lying on the beach one late afternoon with my head resting on my backpack, just relaxing and enjoying the sound of the waves and the ocean breeze rustling the palm fronds. I had a thought form as I call it go through my head, urging me to look at the clouds, saying,Youcouldlookforshapesintheclouds! In response I thought, (before even realizing that I was arguing with a thought form in my head) Uh, yeah, I could, but, thats not something I would normally do. Just kind of sarcastic. Im not into fanciful stuff like looking for shapes in the clouds. ;) To which it respondedback with, Look!!Youllseeanalienface!!So,Ilooked. Still very calm, not questioning this whole exchange at all. And sure enoughthere it was. Straight up at 12:00, an absolute perfect alien face sculpted from a cloud that was connected to a neighboring cloud. A white tear drop head, big slanted blue eye cut out of the cloud, a blue blip nose and blue slit mouth. Absolutely stunningly perfect, in everyway.ManaliveifIdonlyhadacamerawithmetograbashot!! The thought form voice was happy and giddy about this too, proud in achildlikeway. Likeitwas saying,WOW!!!This issoCOOL!!Look what I did! Look! Look! Hehehehehe! The alien dissipated away veryquickly. This incident may sound nuts, but the work of Fritz Springmeier has been the only source that Ive found which confirms within back tobacksentencesnolesstheirabilitytosculptcloudsusingenergy, and to communicate to their abductees using ELF waves. These externallygeneratedthoughtformsaremeshednearlyseamlesslywith your own, which is why for instance I didnt question what was happeningandansweredbackitfeltlikeitwasmyownthought.

Various types of nonlethal weapons have been created and are now being used. Directed energy can be used to sculpt clouds. ELF wavescanbeusedtoplacethoughtsinpeoplesmindswithoutusing implants.FritzSpringmeier

Part II My Own Experiences

87

AndfromthebookMILABSbyDr.HelmutLammerandMarion Lammer:

Dr.Freysworkinthisfield,datingbacktothesixties,gaverisetothe socalled Frey Effect, which is commonly known as microwave hearing. It is noteworthy that alleged alien abductees and mind control victims report that they sometimes hear voices in their heads,althoughtheyarenotschizophrenic.page98

Morevoices.So,speakingofhearingavoiceinthemindshortly after moving into my new apartment in Fort Lauderdale, I was thinking one night about how close Id come to actually bringing my brother Joe with me to Florida. I had almost rented a trailer and a hitchtoattachtomycartoo,inordertohaulhisbelongings.Stupidin retrospect, but my programming was strong. However, I managed to break from the programming and parted ways with Joe in Oregon, nevertoseehimagain. So I was thinking about all of that, frowning, having very negative ideas about Joe and feeling extremely grateful that Id ditched him in life, and then decided to bring the trash out to the dumpster. Out to the sidewalk and into the parking lot, I walked past the cars parked next to my building and accidentally slammed my thigh into something jutting out. Looking down I saw it was a trailer hitch on thebackofoneofthecars.Iturnedtocontinuetowardsthedumpster, in pain, rubbing my leg and carrying the trash bag, when I then heard a male voice in my mind command, Stop!Look at the license plate! I paused, frowning curiously, but started walking again towards thedumpster. STOP! he commanded more forcefully. Look at the license plate!! I stopped yet again, actually turninghalfway around, lowering the trashbagbutthenchangedmymindandstartedwalkingagain. LOOK AT THE LICENSE PLATE!!!! he screamed at me now, reallypissedoff. Alright!! I thought, whirling around and going back over to the neighbors car, squatting down in front of the plate. Like the alien in the cloud incident, this voice meshed nearly seamlessly with my own thoughts,soIjustrespondedtoitwithoutreallyquestioningit.

88

Chasing Phantoms

I stared at the plate. Alrightits from Michigan, I noted. Looking, looking. I know Im supposed to see something here, but I dontgetit.Thenumbersandlettersdidntmeananythingtome.But theresobviouslysomethingherelooking,looking. ThenIsawit.Thelicenseplateframe. ItsimplysaidJoseph. The trailer hitch which smashed my thigh. On my neighbors car with the plate frame that said Joseph. Right after thinking intensely about how glad I was that I didnt get that trailer and hitch and actually bring Joseph to Florida with me. And then them screaming at me about it all. Okey dokey. And I continued to the dumpster to tossinmybag. In retrospect one has to wonder how this amazing synchronicity wasorchestrated.

Beeping noises in the air. For a period of time in Florida in 2002 and into 2003, I would hear these electronic beeping noises in my apartment that would happen in midair, coming from an invisible source of some sort. Later an episode occurred with Tom there as a witness. It happened up in the air by the vent in the walland then beeped twice more, moving down the hallwayactually echoing, like therewasarealsomethingthere,intheapartment,invisible,moving about.Andthefactthatitechoedbetweenthewallswasamazing.

Invisibility. but even weirder was the time when somebody, whoknowswhat,arrivedinmycloset.Iwasbymyselfintheliving room,reading,whenIheardaloudthumpinmycloset/laundryroom. And then what sounded like a person in the closet, losing their balanceandfallingover.Justthisthumpingandbangingaround,like somebody the size and weight of an adult human had materialized there and then fell over and was rustling about. And it wasnt my cat, because she was in the living room area with me. The closet door was open slightly, about six inches, but I didnt get up to go investigate. I nervously went back to reading with my back to the closet. Within a minute or so I saw something moving around out of the corner of my eye, and looked over to see a really faint, barely visible black shadowy thing moving slowly about over in that area of the kitchen/hall/closet. Whatever it was, it was trying to be quiet and go unnoticed. Problem

Part II My Own Experiences

89

was, I heard it arrive, and I could see it with my peripheral vision. So despitetheir cloaking,theirpresence wasknown.NowIwas spooked and got up, grabbed my backpack, and left the apartment for several hours. I returned later, not worried about anything though. That was somebackthen.Justputitoutofmyhead,lalala,andmove onwith things. Side note: From the website Alien Jigsaw I recently found this veryinterestingtidbit,(boldedwordsmyownemphasis):

Another interesting paper concerning Information Warfare is classified and only individuals with appropriate security clearances can obtain a copy from the Defense Technical Information Center in Fort Belvoir, Virginia.[27] However, you can read in the abstract that this paper explores holographic image projection, cloaking devices and multispectral camouflage which will provide enhanced military deception capability.It is just possible that MILAB victims are being usedastheguineapigsfortheseresearchprograms.Becausetheyare secretive,theyarenotundercongressionaloversight.

Strange voicemails and phone call interference. My first experience with anomalous phone happenings occurred while still roommating with my brother in Portland, approximately January 2002. I dialed into my cell phone voicemail one morning while at work and found a message that went on and on for several minutes.the sound of marching jackboots. Thats it. Nothing else. Barely anybody even had my personal phone number, and the few of people who did wouldnt do something like that. It was bizarre, and actually creeped me out. If Im not mistaken, this message actually happened TWICE. But I wasnt documenting things back then, so I dont have dates. But thesamedaythatIreceivedthefirstmessage,mybrotherclaimedthat the Nissan he was driving, which Id given him for free back in California, had caught fire, or experienced some kind of explosion within the engine that actually blew off the hood of the car, causing a fire. So the car was gone, burned, and had been towed away. This in itself was a set up, attempting to cause a situation of my already penniless and unemployed brother to have to further rely on me to keep taking care of him in life. I have zero proof that this really happenedtoJoescarbuthedidtellmethestorybeforeevenhearing aboutthejackbootsphonemessage.

90

Chasing Phantoms

The next anomalous message occurred after moving to Florida, in about April of 2002. It was strange, like a whooshing wind noise, and these random, weird, far away sounding blips, and finally the distorted, possibly electronic voice of a little girl saying Bye! and hitting one of the number buttons on the phone. Tom figured out it was the 9 button. What it all meant, I had no idea, but it was bizarre, and Id never heard anything like that before. I had loads of stuff going on during this time, so it fits right in. I still have a copy of this message, and Tom has run it through all sorts of filter programs to see whathecouldfind. A third really odd one was a sentence fragment featuring a man with a southern drawl saying, manufactured hearts and kidneys and.hello?!....and limbs and things. Thats it, message ends. Still have a copy of that one as well. Some people may be dismissive of these messages as being wrong numbers or crank calls, but the interesting thing is they only ever happened during those crazy times when I had a lot of negative abduction activity occurring, and when I was in a vulnerable position in life. So, thats an important factor in determining whether or not it as a sidetrack circus diversion/fear and paranoiageneratorevent. Then theres phone call interference, which has happened to me on four separate occasions that I can remember, with only two people in my life once while talking to Joe back in 1999, and three times with Tom. Phone interference as Ive experienced it wasnt for the purpose ofwreckingthephonecalltogetustohangup,butrathertoannounce their presence, let us know we were being listened to, and possibly instill fear too, Im sure. When it happened to me and Joe, the noise scared the crap out of me. One second we were taking, the next there was a very sudden and loud blaring crazy noise that caused me to jump and pull the phone away from my ear, heart racing, nerves standing on end. It went on for a good ten seconds too. Its actually very similar to what happens in the movie Mothman Prophesies, where Indrid Cold creates a blasting noise that causes Richard Gere to jump and pull the phoneaway from his ear. My incident happened in 99 though, two years before the movie. With Tom, its always been like distorted electronic beeping. The three times with Tom were duringtimeswhenhewasbackinIowaforfamilystuffwhileIwasby myself at home. One of those phone calls was a very big deal, the

Part II My Own Experiences

91

outcomeofwhichwouldaffectthetimelineofourlivesinamajorway. Not only did we experience the distorted electronic beeping interference announcement during that particular call, but I also had two ear tones in the middle of it all. So, something was definitely listeningintoTHATconversationusingallpossibleangles!

The Gray homeless guy. This was during the summer/fall of 2002, when all kinds of strange and bizarre events were happening to me and Tom. We were idling at a red light at Broward and Federal in downtown Fort Lauderdale when a homeless guy wearing the bright pink Sun Sentinel Tshirt approached Tom, who was driving, and began chatting casually with him through the open window. Homeless people selling the Street Sheet for donations or the Sun Sentinel newspaper were commonplace at that particular intersection, so this was normal. So theyre chatting, and Im over in the passenger side in my own world, not paying much attention, then the light turns green. As the cars in front of us begin to slowly pull forward, homeless man suddenly changes you could say. He goes from easy breezy casual, to getting a sort of intense, serious look about his face, leans in through the window, staring intently at me honing in on me forthefirsttimeandgivesmeabigVsignwithhisfingers. It was at this point that I really noticed how he looked. The guy was barely 5 feet tall, if that, probably about 90 pounds soaking wet, meaning, very tiny, and with a very pronounced triangular shaped face, and large alienlooking pale blue eyes, and very thin lips/small mouth. He looked like a barely disguised Gray alien in human form. And the way he was intensely staring me down, giving me the V, leaning partially into the car window was just bizarre. I just stared back at him, like, Huh?? then he pulled back out of the way, and Tom began moving forward. Tom and I were both like, What was THAT?? Damn!

Finally seeing Them. August, 2002. Tom and I decided to go to Dennys in the middle of the night, around 1:45 a.m. At first we chose the one on Federal Highway. But we get in there, and theres like, no people. Were pretty much the only customers, and not only that, but our server isthis olderwomanwithabadcold.Weheardherhacking and coughing up a lung before she even got to our table. We ordered

92

Chasing Phantoms

our Cokes and when she went to get them, hacking and coughing, we took off and bailed out, in search of a more happening Dennys. One with people, and better servers. ! We headed further up Federal Highway and wound up at the Dennys on Commercial and Federal, which was jumping. Loads of people. We took our seat, ordered our drinks,andwerewaiting,chatting,andpeoplewatching. I was looking towards Tom when I suddenly felt them approaching, before I ever saw them. I looked up and see two suits coming down the aisle in our directionand both of their eyes were locked right on me, and only me. I stared right back, which isnt something I did at the time. Have to emphasize that. At that time I didntstaredownstrangers,orlockeyesonpeoplelikethat.Theway I felt was that I couldnt NOT do it, even if I wanted to. I was frozen. They were dressed impeccably, looking just like government agent types. One of the guys was Caucasian, tall, oversix feet, with meat on his bones, just a bigand tall guy. He had thinning/balding light brown hair, pale skin, was clean shaven, and was wearing a full suit, with jacket and tie included. The jacket and pants were dark gray, the shirt white. His face was plain white guy. The other guy was shorter, probably no more than 5 8. His skin was tan, and his hair darker, and he had more hair than the other guy. His features were heavier than the other guy, a bigger nose, a heavier brow bone. He was also cleanshaven. He wore a crisp bright white dress shirt, gray pants, belt,atie,butnojacket,unliketheotherdude.HewastheoneIreally lookedatfirst,becausethatstheoneIfeltthedrawto.Hewasstaring me down intensely, with a little smirk on his face. The vibe was sexual.AndIalsorecognizedhim.Ihadnoconsciousrecollection of him, but I knew him. There was recognition. My attention then turnedbacktotheother,tallerguyastheywalkedbyme,andthatguy was also staring me down, but in a different way. His look was a mix of contempt and disdain, but also curiosity. Like hmm. I didnt recognize him, and I knew that he was only seeing me for the first timeaswell. As they passed by our booth I took another quick glance back at the other guy who I recognized, then looked down at our table, still frozen in place. The only feeling going through my mind was uh oh like a little kid. I knew Id done something wrong and had that feeling of being in trouble. I was definitely not doing what I was

Part II My Own Experiences

93

supposed to be doing, or what somebody wanted me to be doing, thatsforsure.PartofitIthinkinvolved beingwithTom.Theydonot likehim,thatmuchIknow.Theplanhadapparentlybeentogetmeto stickwithmybrotheratallcosts,nomatterwhathewasdoingorhow nasty he got, thus enabling him to carry out his various criminal/agent provocateur programming commands while simultaneously sabotaging my own life in the process; then, turn my back on my budding friendship with Tom and never make it out of Portland, Oregon. Instead, I permanently ditched my brother, made a break for Florida,andhookedupwithTom. Iwasstillstaringatthetable,frozen,whenTomfinallysaidWhat thehellwasTHAT??Whywerethoseguysstaringatyoulikethat?!? He was frowning and watching them as they stopped at a booth behind us. He had no idea what was going on. I was finally able to tellhimfrommyperspective. According to Tom, who was facing them, they paused first at the booth behind ours, of course, while I sat paralyzed in place. Then the shorter guy that I recognized pulled out a cigarette and lit it up. Then they moved further back, to a booth against the back wall of the restaurant. Tom said that in regards to the cigarette dude, his mannerisms and vibe in general was that of power. Like mafia. Just the way he lit his cigarette and carried himself. Total power. Its funny,becauseinretrospecthedidlookItalian.;) Then the shorter darker mafia power cigarette guy, the one I recognized, decided to head to the restroom, as an excuse to do another buzz by probably. I didnt see him head to the restroom, but, again, I felt him when he approached back around again. I intuitively looked up, directly at him. His eyes were locked on me from over ten feet away as he neared, again, with that smirk and sexualvibe. So, yup, that was them. Or, some of them, anyway. I had requested prior to this incident to be able to see some of them while I was out and about in the real worldand be able to know that it was them. Well,guess I got my wish. They picked the optimal place and time to do it, too. A Dennys diner at two in the morning is perfect. Nobody is going to be dressed like they were at a Dennys, in the middle of the night. They totally stood out. Then factor in the telepathic tug and the subconscious recognition and the feeling like I

94

Chasing Phantoms

knew Id done something wrong, and well, there you go. There was no doubt in me and Toms minds who we were looking at. If it had beenduringtheday,duringworkinghours,itcouldbedismissed. Its interesting to note that we started out at a completely different Dennysand bailed out to come to this one at the last minute. This begsthequestionandyouknow,maybeImmissingsomethinghere, but in order to cross paths with them at the second Dennys, the situation had to be set up to get us to leave the first Dennys. Sois this saying that events were somehow arranged? If sohow? Who, and what, are these people, that they can manipulate reality, and whatinthefrickityfrackisgoingonhereanyway?

The thermostat. During this same exact time period where we saw them around Augustof2002,Icamehome fromwork oneafternoon to find several of my apartment windows cranked open. It was August in South Florida, which means I had the A/C going for my cat and all the windows closed as a result. Also, the bathroom door was now open when it had been closed when I left, since I didnt want to wasteA/Conthebathroom. Frowning, I closed the windows and bathroom door again, then went over to the A/C to look at the temperature gauge. Normally it was always set between 72 75. Now it was set down to 69 degrees, exactly. So,someone had been there, and made their presence known. (see the Number Sightings subsection in Part III for more on the number69inrelationtoMILABsactivities.)

Voice from the radio. September 2002. Tom and I had just returned fromanovernighttrip(toaCschannelingsessioninfact,anexcerptof whichappearsat theendofPartII)andwewereunloading Tomscar, making several trips back and forth into the apartment. I had turned on the radio inside the apartment while we unpacked. As I walked inside carrying something I heard a male voice say from the radio something reallyvile. I wont repeat it here, but it was something nobody would say over the radio, nor be allowed to by FCC regulations,letsjustputitthatway.Also,whathecoincidentallysaid matched up to a yucko dream Id had the year before back when I lived in Portland, which I wont elaborate on here, but which my

Part II My Own Experiences

95

pendulum later confirmed was not a dream, but an actual memory fragment.Icouldhearthesmirkbehindthevilewordstoo. It stopped me in my tracks, and I turned and looked back at the radio, holding my stuff, thinking, Did I just hear what I thought I heard?!?AmIimaginingthis???! And as if to answer my question and dispel any sort of doubts about what was happening here, the voice went on to say something else that was ten times worse. But I cant remember it now. It was so disturbing that I immediately froze up and went into denial/rejection mode. He said it, shocked me into mental meltdown and I just.blocked it out. Then I turned away from the radio, feeling numb, and went back to my business. So all I have is the knowledge that somethingwassaid,but what wassaidIcannolongerremember. Its been deleted. And the fact that I even have such a capability sayssomethinginitself,tome.Kindofrevealssomethings.

Power repeatedly surging. On Halloween night in 2002, Tom was tryingtosetupournewlypurchasedwebcamsothatwecouldhaveit on, monitoring us while we slept to deter abductions. Well coincidentally, the power kept repeatedly surging/going out that nightsixtimesinfactinterferingwiththeentirething.Admittedly, it scared me to no end because that was my mindset back then. Plus I also had that newfound phobia about the power going out. Id occasionally experienced power glitches in that apartmentbut none like that, to that extent. And there hadnt been any in awhilenot untilthenightweweretryingtosetupthenewwebcam.

TheBlackHelicopter,Round1.November18,2002.Somethingwoke me up at 7 a.m. on the nose. As I sat up, squinty eyed, thinking huh?? I realized what it was there was a very loud military sounding helicopter outside just going, and going, and going, and going. Hovering. Right next to my building. As I got up to go investigate, walking across my apartment to the front door, my nerves were standing on end and my stomach was sinking, because I already knew. This had to do with me. BUT, before I jumped to any conclusions I needed to see for myself. So I opened the front doorand stepped outside and looked up into the bright and sunny and cheerful looking morning. Sure enough there was a large, unmarked, matte

96

Chasing Phantoms

black colored military looking helicopter hovering over the leasing office building across from mine. Pointed in a beeline, straight at my front door. (Later research on the net would show that the closest match to the body shape of this thing is a Comanche helicopter.) Oooohhhkay, I thought, looking around to see if anybody else was hearingthis.Buttherewasntaneighbortobefoundanywhere.AndI promptlywentbackinsideandshutthedoor. It continued to hover outside and make a racket. As I came back inside, shaken, Tom sat up from bed and asked what was going on. I told him that there was a military helicopter hovering over the next building,pointedatmyfrontdoor.WHAT??Hesatup.Hewanted to go out and look at it with his binoculars, but I requested that he not do that. I didnt want him to go out there and put himself in the middleofwhatIfeltwassomethingthathadtodowithme.Although they already know who he is anyway. But still, theres no point in going out there and showing himself unnecessarily. I wanted to lay low, not go out there and antagonize anybody. [Different mindset back then. ;) ] I kept saying this isnt good, this isnt good really scared.Thehelicopterhoveredforaboutanother30seconds,thentook off. It didnt hover any other buildings, and it didnt circle the neighborhood. It just came in, pointed itself at my front door, and hovered there for several minutes until I went out and showed myself andacknowledgedit.Thenitleft,withnofurtherbusiness. Whats unusual about this incident: 1) You dont normally hear about black helicopters flying about urban areas in broad daylight, harassingpeople.2)Nobodyelsenoticedthishelicopter.Nobodyelse came out of their apartment. Not one. A huge black military helicopter was hovering over our buildings making an absolute racket at7a.m.,andnobodyevenpokedtheirheadouttoseewhatwasup??? Actually,itkindofdoesntsurpriseme.

Black Helicopter, Round 2. May 7, 2003. Tom was back in Iowa at this point, about to hit the road in a few days to drive back to Florida. Hed been back in Iowa for almost five months helping with family issues, so I was back to living alone with my cat. I was getting ready for work, and at 8 a.m. on the nose I heard the distinctive sound of a helicopter approaching outside from the back of my apartmentthen stop, hovering very close by. Just going and going and going and

Part II My Own Experiences

97

going. My heart stopped. ohhhhhh shiiiiit, I thought. I went out the back door to go look, and found a shiny, all black, unmarked helicopter, with a large cross shaped thing sticking out from the back end, hovering low. Even the windows were tinted black. It was pointed in a beeline at my back door this time. oh shit, I thought again.IranforthephoneandcalledTominIowa.Iwaslike,PLEASE answer your phone, PLEASE answeryour phoneand luckily, he did, even though it was 7 a.m. his time. I held the phone up in the air outside so he was able to hear the ruckus that it was making. Talk about two worlds colliding Im supposed to be getting dressed for work, figuring out what to wear, meanwhile, theres a black helicopter pointing straight at my apartment back door. I stood outside, on the phonetalkingtoTomandnarratingthesituationwhilestaringupatit. Atonepoint,it turnedslightlytoits leftto lookatme better.Itlooked like an insect when it did that. I was also freaking out that NOBODY seemed to even notice that this was happening, nobody was coming out of their apartment, just like the last time. Then I noticed that wait, therewasablackguystandingintheparkinglot,withhishandsinhis pockets, gazing curiously up at it, kind of like, WTF?? and then lookingoveratme.Yay!Letshearitforwitnesses!:D Finally I went back inside and told Tom that I had to go, I have to get ready for work, forget this. We hung up. I was shaking and scaredthen I heard the helicopter move so that it was now right on top of my apartment, hovering loud and intimidating, right over where I stood in my kitchen. I tried to go about my business like normal, pretending this wasnt happening, lalala! hoping it would go away.ButIfeltlostand panicked,wonderingwhyIdidnt havesome sort of forewarning about this from my intuition, or higher self. Something this bad should have come with a little bit of warningright?! I felt abandoned.. I was panicked about what they planned to do, and why they were here. I kept thinking, I didnt DO anything!! I didnt DO anything!!!! Then I was saying to my higher self, Why didnt you tell me?? Why did you let this happen!!! Why didyouletthishappen!!!! Then I got an answer. What I assume to be my higher self responded, since thats who I was addressing, and it sounded calm, mature, and slightly amused. Because nothings going to happen to you, it said. It also sounded like me, btw. My own voice. Female,

98

Chasing Phantoms

only older, and more mature and maternal sounding, the way my higher self always sounds. The exact quote of what it told me was: Treat this like you would an entity attack. Move to the center of the room and treat this like you would an entity attack, and watch what happens. Okay, I thought. I was standing there, staring down at the floor, brows furrowed, interacting with this thought form without really thinkingaboutit.Thatstheonlywayitseemstohappen,Ivenoticed. Its when Im not consciously focusing on whats happening, and am distracted.WhenImconscious,Itendtolockupandthenthingscant getthrough.SoIdidwhatittoldmetodo,andIturnedfrommyspot in the kitchen and moved to the center of the apartment, the living room area, and stood there. It sounds corny, but, I remembered the sceneattheendofthefirstMatrix,whereNeofullyrealizesthatitsall an illusion, and hes the one in control. I thought about him stopping thebullets, andsayingNo.Like,Imnothavingthis.No.Thisisnt myreality.Sorry. I closed my eyes, outstretched my arms to each side, took a deep breath. The heli was still hovering and harassing, directly overhead. Then I changed my frequency, basically. Thats the only way to describe it. Like changing the radio dial. I had the mentality of No. Im not having this. Sorry. And I did exactly what I would do during an entity harassment, repeating NO. NO. NO. NO. Over and over again, firmly, and really and truly believing it and feeling no fear, whatsoever. Just a completely different mindset, one where I felt connectedtomyhigherself,nothavingthissituation. And it immediately stopped. That heli pulled up and took off, gettingoutofthereASAP. I slowly opened my eyes, realizing that it was leaving, and very rapidly, too. A grin spread over my face. I became giddy, realizing I had the power to make this stop and go away. It had worked. Whoeverthatthoughtformwasgavemegoodadvice. A note about the time when this happened: The first time in November it was 7 a.m. on the nose. This time it was 8 a.m. exactly. Then I realizedDaylight Savings Time. Back in November DST was over.Sowhoevertheywere,theydontgobyDST.

Part II My Own Experiences

99

BlackHelicopter,Round3.May10,2003.Tomwasnow currentlyen route back to Florida, from Iowa. I had gone for a walk on (Fort Lauderdale)beach,andtherehadbeenapolice/patrolhelicopterflying up the coast, over the water. I thought about my black helicopter sighting from earlier in the week and compared the two helicopters, noting the differences in colors and body styles. I was focused heavily on the black helicopter incident almost as if expecting to see another, eventhoughIdneverhadsuchanexperienceatabeachofallplaces.I went back to my car as if I were going to leave but then rememberedHey, the point of me coming here was to go for a walk AND read my book afterwards on my beach chair. So, I grabbed my beach chair out of the trunk and headed back out to the sand and set everything up. I had just finished applying some sun tan oil and was settling in with my book when I heard another helicopter coming up thebeach,frommyleft. Before even looking up, I knew. I recognized the sound of it, or elsepickeduponitsfrequency.Sureenough,approachingslowlyup the beach was an all black, unmarked, glossy helicopter with black tinted windows. It was barely over the water line, pretty close to the sand where the people were sitting. But nobody seemed to notice it. As it approached where I was sitting it slowed down noticeably. I fixated on it as it passed by, thinking over and over to myself, Come oncome backcome backshow me what youre made ofcome backcome backcome on, show me what youre made of show me what youre made of Over and over. By show me what youre made of, I was referencing the ability for them to read my thoughts. Therewasnofear,onlymedaringthemwiththismanic,giddyglee. Andsotheydid. The black helicopter immediately stopped, swung tightly around to the left in a Uturn, and did an even slower fly by right over where I was sitting. I stared up at them, still fixated. At this point I felt a little fear, I admit it. Partly I couldnt believe that they really could read my mind, and partly I was surprised that they responded, and did what I asked.Iwaslike,Whoa,holyshit!Uhyeah,okay They continued their super slow fly by, and again, nobody around me seemed to notice it at all. Finally when it was far enough away it picked up speed and took off at a regular pace up the beach, and was gone. So, two black helicopter sightings in one week. This was the

100

Chasing Phantoms

same week that Tom was en route to come back to Florida from Iowa. Seems as if that was generating some attention. Also, going to the beach in the morning on the weekend is not normally something I do, but,Ihadtheurgetodoitthisday.

Helicopters, Rounds 4 & 5. The final two episodes involved a new modeofoperation:flyinginhugecirclesoverourapartmentbuilding, as well as the fact that these helicopters werent solid black. Rather, they were a very dark blue color. For those two reasons I didnt think (at first) that they were black helicopter harassment, but several things indicatedthatitseemedtobethesamething: Round 4 was on July 16, 2003 at 7:24 a.m. (Youll see in a minute why the time is important.) Just before this thing showed up I had beenhavingadreamaboutthemsinahelicopter;theyshowedupin my dream, looking for their 3 way radio. My mom was there, of all people, (shes not in my life anymore, as noted in my Appendix supplement http://www.in2worlds.net/abductions) and she had lost this 3 way radio thing. They were annoyed, and wanted the 3 way radio backwhatever thats supposed to mean, and whatever reason she of all people was involved in it all. I can only guess. At the moment when the real helicopter was approaching our apartment my dream took a violent turn. People in my dream began attacking each other, hitting each other with frying pans. (kind of funny I guess). I woke to hear the sound of a real helicopter beginning its repetitive circling overhead. When Tom went to go out and take a picture of it, (dark blue in color, no markings) I felt like the wind had been taken out of my sails, deflated, passive, like I couldnt do much of anything, and even admonished him not to take pictures of it! (programming I suspect because I wouldnt do that now.) Our apartment was on the outer edge of the circle it was flying in, but as soon as I stepped foot outside it coincidentally swung by right over where I stood. We went back inside, listening as it continued circling outside, and I realized I was getting more and more scared. Not good. So finally I toldTom,GivemeamomentandIlayonmybed,closedmyeyes, and pulled another Change the Radio Dial. Within seconds of me doing that the helicopter coincidentally flew off, and abruptly ended itscircling.

Part II My Own Experiences

101

Round5occurredonAugust6,2003,at8:24a.m.Exactlyonehour to the MINUTE of Round 4. This one looked identical to the last one, and as soon as we saw it matched, I looked for any abduction bruise markings on my legs. Sure enough, found the telltale perfectly round, deeppurplebruiseonmycalfbelowtheknee.Ithadntbeentherethe night before. This time instead of flying in repeated circles, the helicopter flew all over the place with no rhyme or reason to it, at all. Itwouldcircleovertheapartmentthenflymoveoffandcircleaboutin the distance, angled sideways, looking in our direction, then circle back over us, then move off again. Tom started immediately grabbing photos, and this time I overrode the urge to not take pictures! and grabbed for my own camera. Only problem wasthe battery was missing. Somehow the door casing had popped open, the battery had fallen out in my backpack, and the door had closed tightly again. I needed a butterknife to pry this thing open to put the battery back in! This had NEVER happened before in the two years Id had that camera!!! I got the battery back in and finally got a couple of shots, then nonchalantly decided to head off to work now. As I drove off down the street, the helicopter abandoned its random circling and followed me behind the tree line. When I got to the 4way stop, it too stoppedand pointed directly at my car. I took my camera, hung out the window and got another shot of it. Then nonchalantly drove off, smiling,listeningtoCDs,andsinging.Whatadifferenceafewmonths makes,thatsallIcansay.(Tomconfirmedthatthishelicopterstopped its circling after I left and drove off to work.) And we never had another helicopter harassment again. That afternoon we did experience one of those tremendous black clouds of doom though, documentedinmyAnomalousWeathersectionofmywebsite.

Coincidental debunking article. On a side note, I have to mention this.ButshortlyafterRound4and5I justsohappened tobeglancing through the Sun Sentinel paper at work and saw what of all things butan article talking about flight school helicopters that will fly in repeated circles over residential neighborhoods in Fort Lauderdale, annoying people. Nothing to see here folks, move it along, nothing to see But it gets better. Later that very afternoon Tom was driving north on Federal Highway and encountered a dark navy blue colored helicopter, identical to Rounds 4 & 5flying south directly over

102

Chasing Phantoms

Federal, right overhead. That was the only time this has ever happenedcoincidentally on the same day I saw the article. He even hadathoughtabouthowthatwasweirdtoseethesamevarietyofheli flying around in the city, and coincidentally directly over his car no less. Later that night he thought to mention this to me, and I was like, OH YEAH! I almost forgot to tell you!! And we ran off to a 7/11 to seeiftheystillhadanynewspaperssoIcouldshowhimthearticleand clipitout.Theydid. It would seem on a surface level that See, it was all just flight school helis, thats all but then theres the nature of this synch both Tom and I independently encountering something on the same day designed to instill doubt or flat out debunk these helis; and more importantly, all the circumstances surrounding Rounds 4 & 5 whichshowthattheywereindeedsomethingandnotjustflightschool helis: So, its only flight school helis! ? Sure, maybe just like the article says. But more likely not. That article actually sounded like somethingstraightoutofTheTrumanShow.

Another Them ? December 24, 2002. I wasnt sure what to make of this back when it happened, and I still dont. But considering what had been going on with me all this particular week I had more mysteriousbruisemarksonmylegs,painsinmyuterus,eartones,and strange dreams it probably is what I think it is. I was at Walgreens on Broward Boulevard and I was in the magazine aisle, excitedly readinganarticleinNewsweekabouttheupcomingMatrixsequels.;) So yeah, I was way excited, like really giddy, because Im just a dweeb likethat. As I was reading the article I got a whiff of some perfume stuff whichdidntsmellgoodtome.Ifrownedtomyselfandlookedupto seethesource.Isawawelldressed,corporatelookingolderwhiteguy who appeared to be in his 50s, who had just breezed past me down the aisle. He was the source. I only saw him from behind. He had all white hair,and a brightwhite clean crisp dress shirt and gray slacks, a belt, shined dress shoes. No jacket though. But impeccably dressed, spotlesslycleanandunwrinkled.Almosttooperfect.Stoodoutinthis particular ghettoy Walgreens. The downtown office buildings are onlyamileaway, butstill,everythingsurroundingthestorewasblack ghetto. My first assumption was that hed just gotten off work, being

Part II My Own Experiences

103

that it was 5:15 p.m., and like I said, downtown was close by. I immediatelydugbackintothearticle,notgivinghimanotherthought. A little while later I heard a really pointed and sarcastic voice say tome,ReadinganythingINTERESTING?Iglanceduptomyleftto the source of the voice and saw that it was the same white haired corporate looking dude breezing past me, this time going the other direction. We were the only two people in the aisle now. Everybody elsehadclearedout. Heneversloweddown.Heneverlookedatme.Hedidntwait,or want for, any sort of a response, unlike every single other harasser Id encounteredsincemovingtoFlorida.Aharasserharassesyoubecause they want that response, and even more importantly, they want to see your reaction. He on the other hand could have given two shits about whatmyresponsewas.Totaldisdain. Even more interesting was my reaction. Normally if somebody weretosaysomethinglikethatIwouldhavegottenannoyed.Possibly evenyelledsomething sarcasticbackinresponse.Thistime,asI stood there watching him breeze away from me it felt like the wind had been let out of my sails and all I could do was just stand there in a passive, childlike daze, watching him go. I was numb, blank. Unable to say something back even if I had wanted to, like mental control had beenexertedonmetoshutmeup. Factoring in a) what had already been happening to me that week, withb)howthisguywasdresseditwasidenticaltothetwoThems at the Dennys four months earlier; c) the fact he had the same disdainful contempt for me as they did; d) the fact that his cologne registered with me in some way, causing me to frown while reading, and e) my inexplicable inability to talk or respond to his comments, and Im liable to think that this was another Them, making their presenceknown. Both encounters also involved what I consider to be telepathic exchange.Inthefirstencounter,IfeltthembeforeIsawthem,andwas tuggedtolookupbothtimesthattheypassedbyme,aswellasfeeling paralyzed in some way, being unable to not look at them; the second time I was rendered unable to speak and could only stand there, in a blank daze. And to be honest, I cant confirm that what I heard him saywasactuallyspokenoutloud,becauseIneveractuallysawhimsay

104

Chasing Phantoms

it. Ive demonstrated the ability on previous occasions to clearly hear peoplesthoughts,so,whoknows.

MIA This one seems so trivial and unimportant that I was liable to dismiss ituntil encountering somebody else who claims to have experienced the same thing. But one time I was walking into the aforementioned Walgreens in Fort Lauderdale, and as I walked towardsthefrontdoorsIseetwogrungyguysstandingofftotheside, smoking cigarettes, and one of them (who had a moustache) calls out towardsme,LookslikewegotourselvesanotherMIA. I knew he was saying it for my benefit, being that he was staring me down as he took a drag off his cigarette, so inside I was like, WTH?? I mean what is that supposed to mean? Another MIA? Another Missing in Action? If thats what it even means. Okay. Fort Lauderdale was littered with crazies, the whole Street Theater thing, so it wasnt surprising. But still, that was pretty pointed and strange.SomuchsothatIfileditawayinthebackofmymindinstead ofdismissingit. Like Ive mentioned before in my writings, corroboration usually comes around eventually, if youre patient. Sure enough, about a year or so later I mentioned this in passing on a message board forum and surprisingly, one of the regular members, a female from Boston whos had a lot of her own weirdness in life, posted that shes gotten the same exact comment. Looks like we got ourselves another MIA. Gofigure.Butnothingsurprisesmeanymore.

The Dreams Dreams are often anything but. Sometimes they are actual memories of events, coming out while we sleep, screen memories of suspect abduction events, or symbolic messages given to us in regards to abduction happenings, fed to us by our subconscious mind. If youre an abductee, then one of the first places you should be looking at are your dreams. Even if you have hardly any actual memories, youll most likely receive indicators when you sleep. Following are some of the more bizarre and highly suspect dreams Ive had over the years. Some may be actual memories, and some seem to be highly

Part II My Own Experiences

105

symbolic messages being conveyed through the subconscious. Another important aspect of these abductionrelated dreams that Ive noticedisthatwhensomethingisaroundintheastralrealmshoning in on me, maybe planning to snag me, my dreams will take a sudden negative turn, reflecting this. Either the dream will suddenly turn morbid, or Ill see aliens and/or UFOs. It seems to act as a heads up warning system that the crosshairs are on me and something is about totrytotakeme. So whatever these dreams are, theyre worth mentioning to give thereaderanideaofwhatonecouldbelookingfor. The UFO. UFO dream when I was 13, of a UFO hovering over our house in Connecticut at night. I was out in the culdesac, off to the right side under the streetlights, just standing there watching it. The weirdest part was the Joe Walsh song that was playing, Lifes Been Good, almost like a soundtrack of sorts to the whole scene. ! It was specifically the middle part of the song, where the lyrics cut out and itsjustthattrippymusicpartthatgoesonandon.

More UFOs. Dream sometime in my teens, of me chasing frantically after a UFO. Even though I was a teen, the dream took place in the field behind an apartment building in Westfield Massachusetts, where we lived until I was three. I was in the field in the middle of a sunny morning with hazy summertime looking sky, and theres a UFO overhead, and its taking offwithout me!!!!!!! I panic and run after it as fast as I can, tearing through the field, like NOOOOOOOOOOOO, absolutely desperate. Its so intense, and Im so determined, that they finallyrelentandIfeelmyselfliftingupintotheair,beingbroughtinto the UFO. As soon as my feet leave the ground I go limp in absolute bliss, completely happy and content. I can feel what it feels like to be suspended in the air while moving upwards. Its an awesome feeling, like flying. The second dream where this occurred I was at a gas station, in the middle of the day, with a blue sky, and theres a UFO overhead, again, taking off without me. I start to mentally think NOOOO, and chase after it, and get pulled (happily) up towards the UFO.Notnormal!

106

Chasing Phantoms

The underground base. Until this dream in 2000 I had no concept of theideaofsurfaceworldversusundergroundworld.Iwassmack inthemiddleof livingoutmyadventures inTheVortexparanormal apartment when this dream happened, and it stayed with me for months afterwards. The dream centers around the idea of my brother Joe having accidentally discovered, through his many adventures of poking around/trespassing, the entrance to an underground base facility located underneath a local malland then coming back to show me and bring me along. In real life Joe was nocturnal and spent every night out exploring whatever city we lived in, poking around whereheshouldntbegoing,breakingintoplaces,trespassing,etc.and makingsomeinterestingdiscoveries.Sothisdreamplayedoutexactly as it would have in real life had this really happened. It was so real and so much fun that I could not shake this dream off for months afterwards, and wanted very badly to experience this again, and be in this world that Id been witness to. Id listen to Death in Vegas while imaginingmyselfbackinthisplace.68BalconyISpyandFlying ifyoud like thepersonalsoundtrackforthis.Illtry tosummarize itasconciselyaspossibly,omittingthenonrelevantdetails,buttaking manypartsdirectlyfromawriteupIdidrightafterthishappened.So youll note the wide eyed, innocent voice of it all Im sure. A bit differentfromthewayIamnow. It started where me and Joe were standing next to a lake which was supposed to be similar to the lake here in Rancho. The sky was gray white overcast. The next thing we know were watching a minivan drive slowly, head first, into the lake. It kept right on going until it was completely under. The engine didnt get flooded or stall, becauseitwasntanormalminivan.Itwasmadetobeabletogointo the water in order to access the secret entrance to an underground government facility. There were a couple of quick cut close up scenes of me next to the lake edge, looking down into the water at another submergingvehicle,goingdownintothissecretentrance. Nextscenecutstoamallthatsinthevicinityof thislake,butitsa mallthatsbeenbuilttheequivalentof twostoriesunderground.Itsa novelty thing to everybody in suburbia who goes there, but who dont realize that it was built as a faade, right on top of the underground facility. So Im in the mall now next to an escalator, staring up at a skylight in the ceiling above the escalators (same as the Laguna Hills

Part II My Own Experiences

107

Mall actually) which is really the ground level of the world above looking at the gray white overcast sky beyond, when Joe comes up to me andtells me tocomeon.hewants toshow metheentrance tothe facilityfromrightthereinthemall! I snap out of my gazing thoughts and excitedly jump and dash after Joe, through the mall, into this dark holeinthewall type looking restaurant/bar tucked into a corner nearby. No lights are on in the place. The only light is the bright white gray overcast natural lighting pouring in via the skylight of the mall that comes in through the front doorway. [] I catch up with Joe who is standing next to this rickety lookingelevatorinthebackcornerofthisrestaurant/barthingnexttoa maintenance type of closet. We get in, and the elevator starts to go down,slowandrickety,likeyouwouldexpectbylookingatit. I was filled with this overwhelming excitement and anticipation, mynervesstandingonendfor whatwasyettocome.IaskedJoe,Did we bring any film?? Just as I realized we didnt. I made a little DOH type face, and specifically thought to myself that I need to pay very close attention to the details I was about to see, because I didnt have any film to record it. I was exhilarated because I knew we were about to embark on something we werent supposed to know about. Wed bedoingsomeserioustrespassing. When the elevator got as far down as it was supposed to go.there was actually more to it. Joe showed me the trick he discovered, since hed been through this all once before. You have to push one of the buttons down again, he showed me, and then..he reached up and pulled at this little white string dangling from the ceiling corner. And thats all it took. The elevator dropped, going from slow and rickety and taking you nowhere to suddenly rapidly descending,strongandconfidentandwithapurpose. It descended rapidly, going down, down, down, down, down, at superhighspeed. Ontosomethingelse. My nerves were still on end, I had chills almost I couldnt believe how cool this was. I looked up and watched the walls moving up as we moved down, hundreds and hundreds of feet. There were outcropping shapes sticking out of the walls, thick half circles and thickhalfsquares,alternatingbetweenthetwo,evenlyspaced.

108

Chasing Phantoms

Whenwe gottothebottomtheelevatorthingdidnt stop.Instead, some part of it must have split off because we were now traversing along horizontally, being carried by something. (Dream logic I guess ;)Orsomethingthatreallycanhappen,whoknows.) We were now in this absolutely huge gigantic cavern room. A completely selfcontained underground facility removed from the world of the surface. It was completely surreal. The woes of the surface world didnt exist down here. Politics, the environment, national borders, wars, starvations, materialism, disease, work, school, family, loved ones. None of it. It was calm and quiet and still and enormous.Werapidlybegantoascendinheightupandsidewaysinto the air, traversing along on whatever it was that was carrying us, formerly part of the elevator car. The lighting wasnt bright fluorescent, it was more like really bright firelight. Hard to describe. And it wasnt actually a cave, although I never got a good look at the wall structure. I was distracted by us lifting up into the air, and getting a whirling, almost panoramic view of the gigantic room belowincluding these enormous incinerator furnace fireplaces that were below us. Pot bellied stove furnace things with smoke stack chimneys that went up, up, up through the ceiling and onto whatever abovethat.Thesestovefurnaceswereenclosedintheirownroomthat had this plexiglassish transparent wall material so you could clearly see them, and Joe excitedly explained to me that the stoves burned some combination of carbon dioxide and bleach. (??) I watched the fires roar silently from inside the rounded pot belly bottoms of these incinerators, behind the transparent enclosure. There was no signs of lifeinthis hugecavernousroom.Nowindowseither,obviously. The airwasstillandwarm. Just then we found ourselves surrounded by a tingly energy type force and it took hold of the thing we had been traveling on, and it lifted us up so we were free flying through the air on just a small seat/bench sort of thing, up, up, slightly wobbly but completely controlled by some force [electro magnetic force field Joe would later tell me in the waking world] that had become aware of our presence and was not too happy. It wanted to see us and deal with us. We continued to free float, and I was nervous but completely EXHILERATED, all at the same time. What an adventure Id gotten myself into! I gripped Joes arm as we talked about how this energy

Part II My Own Experiences

109

force felt, while I nervously glanced down at how high up we were. (even in my dream, my fear of open, unprotected heights was there, adding to the realism!) I could feel the unseen presence behind the force field as being male. His own personal psychic power or something. The scene then cut to another part of this selfcontained underground world. There never was any big confrontation scene between us and the invisible male presence. It was a large room that wassectionedintosmallerareasbyfurniture,likecouches,tables,and free standing bookshelves, and decorated with richtapestry carpets on thewalls,andfireplaceswiththeirchimneysgoingupandup.Turns out, Ive seen this scene before in another dream where I was free flying over these same giant partitioned rooms. I have that sometimes, where I revisit particular dream scenes. But I wouldnt haveremembered itwere itnotforthisdream. Ijustknowthatwhen I revisited those tapestry lined, windowless fireplace rooms in the latest dream I felt the same way as the first time I saw it. Awestruck, taking it all in, a completely new experience. And its interesting that inthisparticularworldImalwaysabletofreefly. AndthatswhenIwokeup. Verybummed,Iwillsay. I woke to the sound of rain tapping on the metal gutters and fan units outside my bedroom window, in the dark, with a slight breeze and a chill in the room. And after being in the dream of the self containedworldremovedfromsociety,withnowindows,naturallight or breeze, just that warm stuffy pressured air..let me tell you it was quite a shock. I lay there in bed for a minute trying to adjust from what was basically an abrupt switch from being deep underground to beingonthesurface.Myheartwasstillpoundingandmynerveswere on end. Ive never thought about the weather in terms of surface lifeuntil now. Because Ive never experienced anything different.NowIhavethatcomparison. [As an afterward side note back in 2002 I came across references in one of David Ickes books to lake/water entrances to underground bases, which floored me as I figured this part of my dream was nonsense.]

110

Chasing Phantoms

Insectoid Gray Aliens. Really strange, creepy dream involving terrifying Gray/insectoid aliens cutting the power in my old house in Connecticut and swooping in to get us. In the dream, I was in my parents bedroom and there was a corpse in a coffin, and a pukey greencoloredroseonthecoffin,andabunchofothermorbidnonsense which indicated that something was around hijacking my sleep state. Then the power went off in the house in my dream. I went for the light switch, flicking it up and down, up and down, to no avail. I tried another light switch, and another, and finally realized, uh ohhh, herewego!Iknewtheywerecomingtogetme. Ilefttheroomandwentoutintothedarkenedhallwayandopened the door leading downstairs. From the light coming in through the front door downstairs, I could see the silhouette of a REALLY creepy alien making its way up the stairs for me. It had a bald, round head, and really long limbs. To picture the way this thing moved, stand up, thensquatdownalittle.Now,imaginewalkingupstairsveryquickly in that same squatting position with your knees sticking out like that, hipsswayingabitbackand forth,with thelongthinarms.Wellthats howthisthingmoved.Iveneverseenanythinglikethatinanymovie, so it didnt come from Hollyweird. When I saw that coming up the stairs, I knewtheres nowhere to run. You cant hide from them. Youre cornered, and theyre going to get you. And so I decided if Im going down, then Im taking it down with me. Fuck them. And instead of running, or just freezing there and letting it get me, I hurled myself at it with my arms outstretched, to grab it and go head to head with it. As I fell through the air, silently in the dark, the alien disappeared. I fell through it. I turned around in midfall down the stairs, so I was facing the door at the top, where I had just been standing. My last thought as I fell slowly through the air before awakingwasIbetsomethinglikethisreallyhappenedtouswhenwe livedinConnecticut

Time Travel and the UFO. This one was a trip. I was living in Fort Lauderdale and I found myself having a dream one night where I was suddenly sitting ona rockalongside a stream/creek somewhere in south Florida500 years ago. Sitting to my right on the rock was a (Native American?) woman. I sat there in a dazed awe, looking aroundlikeWow!andsomehowknewthatitwastheearly1500s.

Part II My Own Experiences

111

It was morning and the sun was out, the sky hazy and kind of thick, theskyhadayellowwhitehuetoeverything.Therewerenobuildings around. Justthe streaminfrontofmeandtall grassandopen land.It wasquietandpeaceful.AndthemoreinterestingthingtonoteisthatI didnt communicate verbally with the Indian woman. We communicated telepathically. I hardly had any time to really even get into a discussion because things got cut short prematurely, and also I was still absorbing the fact that..Im in the 1500s. ! So the only thingIcouldthinktoaskheratfirstmentally,notwithverbalspeech was whether Miami existed yet! She said, Yes, Meahme exists working in the correction on my pronunciation! :D Imagine that. I telepathically understood Meahme, as she pronounced it, to be a settlement, not too far from where we were. That made me smile, like wowMiamiisalreadyaround!Cool. And then wouldnt you know it, but an annoyed UFO whizzed up to where we were. I glanced up at the black colored disc approaching, which slowed to a hover above us to the left, and telepathically felt its annoyance at me. It was conveying very loudly, with a robotic sort of voice, WHAT ARE YOU DOINGSTOP THAT RIGHT NOWSTOPTHATSTOPItwantedtoputanimmediatestopto this, and squelch me back into place. In my dream I sighed and felt limp, knowing the drill and immediately resigned myself, knowing there was nothing I could do to stop them from controlling the situation.Thatswhereitabruptlyends.

The Black Box. A dream when I lived back in Florida where I was shown something about how They had connected a black box to my heart, and had control over whether I lived or died. There was a switch/buttonontheblackboxthattheycouldturnmylifeonoroff with. The dream seemed to take place in a mix of where I grew up in Massachusetts and Connecticut. Iwaslyingonatable,andtherewere people in white coats around me, performing the black box heart procedure. But I seemed to be me at my age now, in the present, rather than a kid. I could see out the windows that it was sunny and blue skied outside. A weird muddled dream. Several years after this dream I read the book Song of Freedom by Judith K. Moore (mentioned earlier in this book) and there is a chapter called The Little Black Box. For Judith Moore, the black box was an implant in

112

Chasing Phantoms

her brain, installed by human elements that had been using her in mindcontrolexperimentation.

The Gray. Had a dream where I was in what appeared to be another one of those underground facilities, no windows. Im walking along and up ahead, about twenty feet from me, is a Gray alien. Little thing,aboutfourfeethigh,withthebulbousheadandlargeblackeyes. Itsstoppedinplace,glancingsideways(totheleft)atme.AssoonasI see it I frown inside, like grrrrrrrrrrand just go limp giving up. EXPECTING the mind control beams to come off it, controlling me, and knowing theres absolutely nothing I can do about it. Another instance of knowing the drill. Except for some reasonnothing happens. My limp body just stands there, then I perk up, with this Huh?? confused feeling, looking around. Nothing had happened. Im not under any mind control. And I look at this Gray being just standing thereand I charge after him, taking full advantage of this rare opportunity where Im not under the control of these beings and free to do whatever I want. Free to defend myself. Rage surges through me as I rush up to him and just start beating the crap out of this thing, pummeling him, screaming, cussing, hitting, kicking, going off like a crazy person, getting out all the pent up hostility from my apparently quite negative previous Gray experiences. Except when my fists hit this thing, its REALLY hard. The skin is this sort of leathery stuff over what feels like a metal skeleton! And I hear this things thoughts as it starts to hurry away from me. It would not be safe for me to stand here much longerit would not be safe for me to stand here much longer Its completely emotionless. Its thoughts are just a sensory analysis of its environment. Its thin little arms move up and down as it takes off, getting away from me. My fists drop, I frown, realizing this thing is a COMPUTER. Its a fricking ROBOT. My anger dissipates away in confusion. Its not a real sentient Gray being at all, so theres no point in beating it up. And thatstheendofthisdream.

My cat to the rescue. I had just moved to Fort Lauderdale, Florida, and wokeup onemorninginmy motelroomtotheimageinmymind of a very vivid, illuminated, glowing rainbow against a black background. Two UFOs descended from each side of the rainbow,

Part II My Own Experiences

113

landing together in front of it. From there, all these images of Gray faces filled my minds eye. Even though they all looked the same I recognized them. I sensed individuality or at least was able to feel the essence of them. I knew them, but I dont know how. And I began fighting with everything I had to get out of my body and get to them. !!Istrainedwithallmymight,reachingforthem,intotaldesperation. As I frantically began pulling out of my body to get to them I became aware of the rest of the room, probably because I was now mostly out of my body. Then I heard my cat Kitty suddenly meow from across the room. She ran over to the bed, jumped up, then walked up my stomach and chest, meowing at me in an urgent way the whole time as she walked, and literallyjust stood there on top ofme. Because she did that, and was standing on my chest, meowing in myface,Isnappedoutofit.Ipulledback intomybodyand wokeup, and she jumped back off of me, watching me, as the image of the rainbow, UFOs and the Grays faded away in my minds eye. I came to, and sat up, realizing what had almost just happened. I have been extremelygratefulandthankfultomycattothisdayfordoingthat(or whateverpositivestuffworkedthroughhertohelpme).Imnotsure exactly what would have happened to me had she (or stuff) not intervened. Its not customary for her to just jump on me while Im sleeping. Shed never done that before in the two years that Id had her at that point. Only the one time when I was fighting to get out of my body to get to the Grays did she do that. Literally stood on top of meandpreventedit,whetherintentionally,orinadvertently.

Adream?OrarealUFO/abduction?Idontknowwhetherthiswasa dream,arealevent,orascreenmemory.HoweverIllincludeitinthe Dreams section, just in case. But one night in Florida in March or April of 2002, (right after I moved to my new apartment in Fort Lauderdale)Ihadjustgonetobedwhensuddenly,abrightbluewhite light descended outside the front of my apartment. Its light poured through the blinds covering my front window. Whatever this was, it had tremendous force. I jumped out of bed, frantically grabbing for my cat to protect herright as the light source blew in my front window. Which is amazing, considering it was a strong, tri sectioned/slatted hurricane storm window. The glass and blinds flew

114

Chasing Phantoms

ineverywhere,landingalloverthecarpet,andnowthenoiselevelwas doubled, and there was all this wind and ruckus mayhem, and bright blue white light pouring in, and more wind blowing around. All I could do was just stand there, clutching my cat, facing the window (abouteightfeetfromit)frozeninplace,tooshockedtodoanything.I didnt make a run for the back door either. I was fortunate enough to have both a front and rear entrance to my apartment, but it was like I couldntmove.ThatsallIremember. I woke up the next morning, more than ten hours later very suddenly pushing myself up in bed with a HUGE gasp, eyes bugged out, whipping my head around to look over my shoulder, FULLY expecting to see my apartment completely trashed. It felt like it had only JUST happened, seconds beforewhen in reality more than ten hourshadpassed. The apartment was perfect. The window was in place, the blinds were there, and sunlight lit the apartment. Outside life was as calm andstill andpleasantascouldbe.Mycat wasthere,andshewasfine. ThefeelingofconfusionanddisbeliefIfeltishardtoconvey.IKNEW the apartment should be trashed. To the core of my being I knew it had happened. Yet, the apartment was fine. Suspicious indicators: 1) itwaslikeIwasblackedoutallnight,Ihadnodreams,nomemoriesof waking up even once in the night, and thats not normal for me; 2) waking as suddenly as I did, gasping; and 3) the feeling that no time had gone by at all, even though it had been ten hours its all indicative of being plunked back from an abduction. Guess things were rearranged too when I was plunked back. Like it never happened. Or, its actually a very vivid and intense screen memory of sorts.

Fading abduction memory. Woke up in Florida one morning with an imageinmymindofashort,pudgy,wrinklyoldmanwithhugeblack eyes. Like a cross between a wrinkly pudgy old man midget and a Gray.Itwasinmymind,thenfadedoutthemoreIawoke.

Killing Alison/Alicein Wonderland. At the start of the dream I was walking down the semidark hallway of my old high school in Connecticut lined with the blue lockers we had when I went there. The light source was natural light coming in through the windows

Part II My Own Experiences

115

from the cloudy day outside. But I was me at my current age, and current personality with the way I dress, feeling very calm and amused.IsawagirlIwasoncefriendswith,buthereinthedreamher face was a porcelain mask, (major mind control symbolism). She stared at me stone faced, with a white painted face, red lips and blush on her cheeks, looking like a harlequin mask. I walked past her to the end of the hallway and into room that had a huge tank of water featuring students taking a scuba class. They were being monitored by a Them government agent guy, dressed in the white dress shirt, dress slacks, shoes, etc. He was barking snide sarcastic unfriendly orders at them. The room was dark, lit by the blue glow emanating from the large tank of water. Later in the dream, I was going into my old bedroom in CT where I found Alison waiting for me behind my door, waiting to jump out and get me. She had long straight blonde hair and bangs. Alison/Alicein Wonderland, get it? I got her first though. There was a scuffle, with me overpowering her and hitting herintheheadwithahammer,overandover,inslowmotion.(Trying to kill the Alice in Wonderland programming?) I detached from the wholething, feelingmuted.Afterthat Iplannedtotakeoffonthelam to escape killing Alison, although I wasnt worried or concerned, I was in a childlike daze. I was getting in my car to leave for this place that looked like a Middle Eastern Aladdintype city in a desert. Pastel reddish brown yellow pink desert hues. I had to leave my kitty behind, which saddened me. (btw, my black cat named Kitty is a remnant of the black cat named Kitty from Through the Looking Glass, although I didnt know that consciously at the time when I customorderedherintomylifeandgaveherthesamenamethatAlice did in the book. Ive also been told that I have Alice in Wonderland hair. Go figure.) In my minds eye I saw the pastel desert hue colored Middle Eastern city with the domed architecture and all, and thatswherethedreamended.

Symbolisms. Speaking of which, around this time period fall of 2002/winter2003 Iwashavinglotsof strangeandunusualdreams that featured many prominent mind control symbolisms dreams where I was in elevators, going up and down tall buildings; needing to get from floor to floor, getting off on the wrong floor and then having to findanotherelevatortogetmetothecorrectfloor;ALOTLOTLOTof

116

Chasing Phantoms

elevator dreams. In several of these elevator dreams I could float due to a lack of gravity; in one I had to use amped up sexual energy to keep myself afloat; in that particular dream a guy appeared out of nowhere and commanded me to get in the elevator, so I did, and started floating around, and quickly realized that sexual energy could keepmefloating;inotherdreamsIwaswanderingthroughthesemall types of place, going into stores and doorways; in others I was wandering down the halls of a hospital, in a mellow daze, through double doors, walking past rooms that have glass windows, but the lights are off in those rooms, although I could still see into the rooms from the lighting from the hallway; [NOTE: Have read that MILABs often report dreams of being in hospitals] Lots of dreams about tornadoestoohappeningquitefrequentlyduringthistime.

Beingfloatedaway.Havehadseveraldreamsthatinvolvedmeflying along on my back, parallel to the floor, usually in the house I grew up in Connecticut. Im several feet off the floor, again, facing up towards the ceiling, and Im usually flying rapidly backwards, creating a slightly exhilarating and enjoyable sensation. Then Ill start to rise up and go through the ceilings/floors, and out the roof; another time I passed through the wallsand was very consciousof the moment that I passed through, having the thought that they changed my bodys frequency to get me to pass through solid objects In one of these dreams it started where I was in some house, and there was a crazy lightning storm going on outside. I went outside to go look, walking out the door and onto the sidewalk along the small front lawn. Everything was lit up by both the streetlights and all the overlapping lightning strikes. I turned and looked to my rightand right then therewasasmallUFOtravelingdownthepowerlines,comingforme, lit up with various colors around the UFO body. Thats when it lifted me up and began pulling me along, traveling parallel to the ground. I just went along with it, enjoying the sensation, and the dream ends there. The dreams always end as Im being floated/flown away, I neverseeorexperienceanythingbeyondthat.

Flyingmaps.Alsohavehadanumberofdreamsinvolvingmestaring intentlyatmaps,thenflyingrapidlyoverthesemaps.Andthesemaps always have the same exaggerated coloring bright vivid blues for

Part II My Own Experiences

117

water, vivid yellow/yelloworange and orange browns for the land. I would be liable to dismiss this as nonsenseexcept I encountered another person on a message board who mentioned these identical same flying over maps dreams, with the same vivid coloring and everything. She mentioned it first out of nowhere, without me ever even mentioning it. What are the odds? Had another dream where I was looking at Earth, from orbit, being shown Africa. Specifically I was directed to look at the area where Chad was. Have no idea why. The only theory I can come up with regarding maps and planet locationscouldberemoteviewing.Notsure.

Tehran, Iran. Dream (more like a memory/experience flash) where Imsittinginthebackseatofacarlookingoutthewindowinapassive daze. In this flash I dont see who else is in the car with me, driving, Im just watching the skyline go past us on the highway/expressway. Its Tehran, Iran. Ive never left the United States, let alone visited Tehran. ! Nor would I want to visit Iran, and nor had I ever researched it or sought out imagery of it at that point. Later on I would be working at a hotel as a front desk clerk with a guy who was from Iran, and I described to him the skyline of Tehran as seen from the highway, and the hazy, smoggy dirty blue color of the sky, and asked him if thats how it looked. He frowned at me, and said yes, actually, it does look like that. He stared at me like, How would you know that? Because of the way I just piped up, describing it like Id beenthere,whichcontradictedthefactthatIhadntbeenthere. Not sure I even want to theorize what this whole dream snippet couldreallybeabout.Itseemssofarfetched.

Scrolling text. Had a really strange dream full of negative themes/elements, and I pulled myself out of itat the point where there was a computer screen sort of thing in front of me with rapidly scrolling text (programming?) Just all of this text, scrolling very quicklyupwards,rightinfrontofmy face.Strangecolorsto itaswell, likelimegreen,white,andturquoiseblueorwhatever.

Another Sky. Ive had these really interesting, occasional dreams here and there over the past several years involving a sky packed full of flying objects. These dreams take place at night time, and almost

118

Chasing Phantoms

always in our old house in Connecticut where we lived for nine years. (AlthoughIdidhaveoneofthesedreamswhilelivinginFlorida.)The sky is glowing a pinkish black color in these dreams, and there are all these lit up flying objects, like jets and things, long tube shaped flying things, and other assorted aircraft, filling the sky. Theres always such a magical feel to these dreams, because in the dream Im just struck by howbusyandbustlingandexcitingtheskyisthere,versushereinour socallednormalworldwheretheresnothingbuttheoccasionalplane. On a couple of occasions in these dreams, (when they took place in Connecticut) one of these flying craft have landed (possibly crashed/skidded) into the woods behind our house. !! It looks like somesortofteardroppedshapedcraftthatcouldholdone,maybetwo beingsatthemost.

Anotherpossiblesoulabductionattemptandacleverpoem.Inthe middle of writing this book, I started to experience some weirdness you could say. Had a very bizarre dream that involved red UFO probe balls flying around in a cemetery where I and others were camping out in sleeping bags to watch them; later on I was inside a house, watching a miniature, elongated/tear drop shaped UFO craft flying around outside the screen door, and could even see the little beinginside,pilotingthe craft.A miniUFOwithaminibeing, whata trip. Right at the point as I was noticing this UFO just outside the door,Iheardamalehumanvoicesayinmymind:

Riversflownorth Riversflowsouth Riversflowred Soshutyourmouth.

Right as the human male voice said that, the UFO turned to face me from outside the door and honed in on me. I started to try to pull outofthisdreamandwashalfin,halfoutofsleep,awareofbeingin my bed, and aware of the room, but then slipping back under. I could feel my body suddenly being paralyzed in my bed, as an energy field of some sort enveloped my entire body. Then the alien spoke to me, with vocal chords that seemed a bit rusty, sounding crackly and popping.Letgoooooooooooooooooooo.ittoldme,withitscreepy

Part II My Own Experiences

119

crackling voice. I felt the telltale astral wind blowing about as I began toliftoutofmy body,alongwiththatalienvoice telling metolet go echoing around. I totally panicked and fought my way out of it, breakingfree. Ifthiswasrealandnotadream,thenallIcansayiswow!Idont know, I thought that poem was the most clever thing ever. I guess it was supposed to scare me, or be a threat of some sort, but instead I kept giggling in giddy glee whenever I thought about it later that day, admiringtheclevernessofitall.Imsurethatannoyedthem.;)

Summary

And thats not even the half of it. Theres so much more to the story, but it wasnt my goal to actually write a complex autobiographical account of my life and happenings. Snapshots of experience work best when trying to put stuff out there so others can compare to their own happenings. Also, many anecdotal accounts have been left out because I cant know for certain whether they are what I think they are. They may be nothing, or have normal explanations, and for that reason I just chose to keep them out even when they seem to match up to stuff Ive read in other peoples accounts. AfterIoriginallycompiledtheinitialgroupingofincidentsforPart II I just sat on it all for the next several days afterwards, pondering things.AndIprettymuchalmostabandonedthiswholewriteup.My first thought was to just walk away. It all seemed so absurd, so over the top, that my reflexive conclusion was that it cant be happening. Im imagining this, its absolutely insane. Listen to what I think has happened here. Theres no fricking WAY this has gone on in my life. There are so many unanswered plot holes, things I dont understand, stuff that makes no sense. What a confusing mess. So I must be imagining this or misinterpreting events in my life. Occums Razor and all that. The simplest explanation tends to be the right one which means nothing is happening here at all and Im just crazy and imagining mountains out of molehills. And so the next thought was live out the rest of my life and dont think about this, literally, ever again.ItwasaverystrongurgetooJustdonteverthinkaboutany ofthisagain.

120

Chasing Phantoms

My calm, rational source of reason counteracting this urge reminded me of the couple of memories I do have, with the leftover marks on my body to prove it to myself, and some of the more undeniable incidents. If I have those couple of incidents then it means I cant turn and walk away. Theres a story here. So eventually I snappedoutofit.Andsohereweare. That whole reaction is kind of understandable though, because when one is dealing with this subject in their own life, the biggest problemsare:

1. The lack of overt evidence (often times) as mentioned previously. Unless you go under hypnosis, which Im not willing to do at the moment, then youre pretty much screwed in terms of finding out thefullstoryofwhosdoingwhat,when,why,andhow.Thereare justsomanyplotholes,thingsthatdontmakesense.

2. The clash between abduction happenings and the real world. When you have this stuff going on in your life it creates a conflicting split. You cant just go and talk about it to any old person. So there usually is nowhere to go, except for the internet and books. Youre left on your own, trying to reconcile where the evidence is pointing to in your personal life, with the clash of the mainstreamworldthatoftentimesdeniesthatthisstuffisreal.

The clash with the real world just cant be emphasized enough. The real world occupies 9095% of our waking lives, reinforcing its particular version of truth and reality to us over and over. This other 510% involving abductions and paranormal is also very real, andequallyas validforthose goingthroughit,buttheresnoplacefor it in the 9095% world. Ive been at the drug store, surrounded by regular people and hustle and bustle of the every day real worldbuying Red Bulls or Frapuccinos so my boyfriend and I can stay up all night avoiding abductions, or buying film to photograph the anomalous bruises, small purple circles and even geometric marks that have periodically appeared on my body. Standing in line to pay, holding the film, or the Red Bull in my hand while my eyes would fall on celebrity/fashion mags, or the local and national newspapers for sale near the register, with mainstream news headlines screaming from the covers. Clash of two worlds. Which one is more real? Not

Part II My Own Experiences

121

the one involving the newspapers and magazines, thats for sure. Its the world thats been pulled over your eyes to blind you from the truth,asMorpheussaysinTheMatrix. Indeed. ***** Inthecourseofmyongoingresearch,oneofthebiggestthingsIve noticed is that my story doesnt neatly fit into any of the groups or categoriesthatIvereadabout. At first it was a caseof knowing Id been taken, but it didnt fit the typical aliens/UFO pattern, so I knew that wasnt it. Then in 2002 I finally learned about MILABS, MKUltra, the Monarch program, etc., and there were many random aspects of all these things that fit my situationbut many aspects that did not. For instance, my dad was never active military when I was growing up. He was already out for twoandahalfyearsbythetimeIwasbornin1974,andweneverlived on or right near any military bases. But thats a common thread for most MILABs/Monarchs/MKUltras, living on or near bases, and/or being a military brat. Although in reading James Bartleys article MILABS Operations (mentioned in the Recommended Reading section) he notes that MILABS can run the gambit from having no immediate military connections in their family, on up to having extensive military involvement on both sides of the family. So Im definitelyinthemiddleofthespectrumthere. Also my parents were loners, not part of any church groups, brotherhood fraternities or the like which is another common component in targets lives that youll often hear. Many victims were actively involved in church, usually Catholic, or had dads that were Masons. Also, I wasnt sick all the time as a kid, with mysterious bodily injuries andailments the waymany targets are. The few things Ididhavewerejustwhattheywere,andnothingmore. So I know that I wasnt a part of the old school Monarch programs, as that seems to be the story for many people who were born in the 40s and 50s. They had Satanic ritual abuse going on, sold into the government programs as small children and experimented on like lab rats throughout their childhood and teen years with visible ailments and bodily markings and indicators to prove it. Cathy OBrien, Kathleen Sullivan, and the relatively unknown author Judith K.MoorewhowroteSongofFreedomarethreeoffhandexamplesof

122

Chasing Phantoms

this textbook scenario. But yet in looking back over my life theres no doubt that something is going on here, as evidenced by this book. So whatIvetentativelyconcludedisthis:

I could have possibly been targeted for abductions as a kid due to who I am in general on a soul level, or, possibly something having to do with bloodlines, as mentioned earlier. Ive been told by several people now that theres something about my bloodline, andonepersoneventhattherewasaconvergence.

Becauseofmydadsinvolvementinstuffwhileinthemilitary;

Because of being so closely involved with and connected to my brotherlateron,whohadhisownstuffgoingon;

Then later because of being connected with my current boyfriend, whosalso anabductee,andwhorunsa wellknownwebsiteonall thingsconspiracy/alien/metaphysicalrelated.

There are quite a few avenues, and all of them make sense, and possibly all of them are happening. It seems to be a mix of hyperdimensional and human military spook. Theres probably definitely more thanone thing involved here, and I think this could be the case for most abductees. Dont limit yourself into thinking that youve only got one thing happening, from one source, with one agenda.Itsusuallyalotmorecomplicatedthanthat. And as far as what Im being taken for, I hesitate to even theorize. ButwhatIdoknowforcertainisthis:

Ive been programmed with selfdestructive, selfsabotaging thoughts designed to take me out of the picture. I know this because Ive woken up and caught them in the middle of doing it, severaltimes.

I have the sense that Ive been used for remote viewing, because again, I woke up and caught myself being pulled out of looking at something (by a humanmale voice),for somebody elses benefit. I also have demonstrated the ability to do this on my own, for personal reasons, in my waking lifebefore having ever read any materialonthesubjectorknowinganythingaboutit.

Part II My Own Experiences

123

Have one memory snippet that indicates unsavory things happening to me during an abduction as well. That cant be the onlytimethatshappenedthough.

I could theorize about additional purposes and reasons, but I hesitate to do so because I think it would be way too simplistic and laughable. Im working with a puzzle thats missing most of the pieces. SomethingworthnotingissomefeedbackaboutmysituationthatI got while Tom and I attended a Cassiopaean channeling session in NewPortRicheyFlorida,inSeptemberof2002. During the session, I took the opportunity to ask about Joe. I wantedtoknowifhehadreallybeenabducted,andifso,bywhom.I didnt get a direct answer. In typical Cs fashion, I seemed to get a roundaboutanswerthatwaspointingmeinanotherdirectionentirely. The thing about the Cs is that they liked to try to get you to think for yourself. Many things theyd answer directly. But if there was something youre missing, a point youre overlooking, and an opportunity for learning, they wouldnt just answer directly, because then theres no thinking involved on your end. That was the case here. I was waaaaaaaaay over here wondering about whether Joe was abducted, and by whom, thinking that was all there was to the story, when really, I needed to be looking way over thereand asking Who thehellisJoe?Notishebeingabducted?butwhoishetobeginwith. Here are excerpts from the transcript and what they had to say. Questions are listed with the persons first initial. Im C. The Cs responses are given with A for answer. Also, on a side note, any word that the Cs designate as being in quotes means that the word hasadoublemeaning.Boldedanswersaremyownemphasis.

***** C:IjustwantedtoknowhasmybrotherJoeeverbeenabductedby

A:Hesnothere.Butyouare.Doesthatstrikeyouasinteresting?

C:Cantheyclarifywhattheymeanhere?

A:Inthisroom.

(alotofconfusedheadscratchingfromeverybodyatthispoint,theorizing whattheymean)TheCsinterrupted:

124

Chasing Phantoms

A:Didyougetourquestion?

(morediscussion)

C:Okay,IguessmynextquestionishaveIeverbeenabducted?

A: Well, now that you askedyou may find great benefit in contemplation of this issue while in a relaxed state. Perhaps some considerationofthepossibilitiesinherentintheeventsofyourbrothers lifeinrelationtoyourownmightbefruitful.

C:Wellmostlymyquestionismoreconcernaboutmybrotherthanabout myownself.EnoughsothatIwanttoknowifhesbeingabducted,andif so,bywhom?

A:Considertheterms:Projectionandreflection?

J: Projection meaning to take the image of something and projecting it onto something else, a reflection of something that mirrors, comparing howtheeventsofhislifecorrespondtoyours.

A:Arehisexperienceshisalone?

A:Sheneedstoprobe.

V:Gettotherootoftheissuemighthypnotismbeagoodavenueforher toprobe?

A:Goodidea.

(then V asked some questions pertaining to her own abductions, which theCsrespondedwith.)

A:Moreprojecting?

C:Whatdotheymeanbythat?

A:Someprojectsomereflect..

Then,lateroninthesession:

C: Could I just ask one question? Last fall [October 2001 abduction] I believed I was abducted, and I actually have one memory of it, or a Gray, you know, while I was laying on a table. I also had physical signs on my body of an abduction. Im curious as Im hearing this: Was I being

Part II My Own Experiences

125

abducted by grays that really exist, or was that like the government mind controlmakingmethinkthatIwas?

A: How about real abductions, but not necessarily grays. They are verypopularscreens.

V:Okay,ifnotGrays,thenwho?

A:Askherbrother! ***** That last comment was very interesting ask her brother. You want to know whos taking you, find out whos taking him. So, weve got several things revealed or confirmed here: 1) That I was definitely abducted in October 2001. 2) Theyre saying it was a screen memory, asinhumans,notactualGrays.3)Considertheideathatsomeofwhat happened to Joe may have actually happened to me. This ties into the idea that both he and I had supposed separate abductions in October of2001.Soifhiswasinanundergroundbasewithhumangovernment agent thems, then what does that say about the nature of my own abductionduringthatsamemonth?4)Theideaofprojection/reflection and probes having to do with my brother, which is a whole side topic in itself, and one that I did eventually figure out after locating anotherCssessiontranscriptfrom1994thatusedallthosesameterms. In the 1994 session I saw that probes had to do with reanimated agent probes put into a persons life for the purpose of information gathering and derailment/destruction, and that they operate by reflecting back the energy that is projected to them by the target. Without the whole back story on Joe this probably wouldnt make much sense. But basically, by the time Joe reentered my life in Californiaafterbeingoutofmylifeforsixyears,itseems,basedonhis actionsandthestuffhewasdoingandinvolvedwith,thathewasare animated probe designed to mirror me reflecting back what I projected. The thing that I had noted in my nave obliviousness even back then was that the Joe that returned to me was all of a sudden amazinglylikemeinmanyways.Enoughsothatitmadeitdifficultto turn my back on him and walk away, which was the whole point I guess.Healsoapparentlyshouldnthavestillbeenalivebythatpoint, as evidenced by some of the stories he relayed and yet.he still was. So as nutty as the idea may sound of reanimated probes who reflect back your projected energy, all the evidence points to this. In any

126

Chasing Phantoms

possible future revised editions of this write up I may add in more detailsabouttheideaofreanimatedprobesinanabducteeslife. ***** Recently I came across the book Unshackled, by Kathleen Sullivan, detailing one womens lifelong involvement in government mind control experimentation and black ops work. At the same time I came across it on my own, an acquaintance emailed me in order to bringmyattentiontothisbook.SoIguessIwasmeanttoreaditeither way. ;) I have no idea whether all the events she writes about in the book really happened to her or not, yet there are some things worth noting. As different as our stories are, (Kathleen is one of the classic Satanicritual abusecasesofthe50sand60scoupledwithgovernment mind control programming that you always hear about, very different from my own situation) we share some strange personal details in common. Likemeshewasbulliedasakidbyagroupof kids in abad waytothepointwhereshespentalotoftimealone,andbooksbecame her friends. She didnt get along with her mom but got along great with her maternal grandmabut her mom and grandma didnt get along with each other. Same deal here. She has a section in her book entitled Comfortably Numb, about how physical pain used to not reallyregisterwithher,andwhileIdonthavethatparticularproblem, it did remind me of how by the time I was sixteen I was putting red pepper all over my food in this zombielike trance state, unaware of what I was even doing, but obviously hoping that the pain would jolt me out of my stupor. (mentioned in the Appendix section. http://www.in2worlds.net/abductions)Butmoreinterestingisthebitabout havingfreakishlylowbloodpressure.Kathleenmentionsherextreme low blood pressure on page 38, saying that it used to hover around 90/60, 80/50 before she woke up and began therapeutic work to integrate her compartmentalized multiples. Such low blood pressure for her equates to operating in a trancelike, compartmentalized state of mind. My own blood pressure? Freakishly low, always has been to the point where nurses and medical assistants would comment on it. One male nurse even joked, Are you even alive?! After reading this in Kathleens book I ran down to our corner pharmacy where they haveabloodpressuremachine.Myreading?91/53.Whetherthishas anything to do with being in a programmed, trancelike state or if its justgenetics,Idontknow,butitsaninterestingpossibility.

Part II My Own Experiences

127

Then theres something that pertains more to my brother and his later Shawn Hill agent provocateur programming, and adamant beliefs that none of this was real. Kathleen mentions Otherworld programming where the target is convinced that the reality theyre occupying isnt real, so therefore, theyre free to do all the criminal mayhem they want.because it isnt real! In Otherworld nothing was real [] I believed nothing in that world was real, I had zero fearofcarryingoutinstructionsonblackopsdidntfearbeinghurt or killed []no fear of being arrested after all, the crime had never happened! This is THE most accurate description of Joes attitude Ive ever seen in a book about mind control programming. Joe had no fear about being caught, hurt or killed as he went about his criminal activities, because he truly believed in a way that Ive never seen with anybody else that none of this is REAL, Carissa! as he once tried to explain to me in Portland, Oregon. His lack of fear led to a state of being invincible, and that, coupled with his skills meant he was able to pull off some unbelievable feats, things I cant get into here. I actually do think that this reality is a bitquestionable, and isnt what weretolditis,onlybecauseIvebeenwitnesstosomeveryoddthings in my time. Yet there can be no denying that this also seems to be a major disassociative programming tool. As I mention in the section Untangling Disinformation, I myself was given a dream one night in Oregon narrated by a male them that tried to show/convince me that this reality isnt real, its just a program filled in with holographic technology. The truth probably lies somewhere in the middle, in my opinion. It usually is never a polarized choice between two black and white opposites. So to read her talking about this was amazing. IveneverseenOtherworld programming, orhowit helps withcriminalmayhemblackopsstuffmentionedanywhereelse.

P I II II tI rt ar Pa
Expanded Insights

In this section, I expand more in depth on the types of metaphysical, hyperdimensional, and psychological situations that a MILAB (or alien) target may be facing in their every day real lives. Many of the books or articles that areavailableonthese subjects speak in broad terms, offering an informational foundation for what mind control and abductions are. There isnt too much material pertaining to the every day sort of issues that an abductee may encounter, with the accompanying advise and tactical tips gleaned from first hand experience.Andsothatswherethissectioncomesin. Everybodys situation is unique though, and what Ive learned in my own experiences may not apply to somebody else. And being that there are so many groups out there abducting people, and all with theirownagendasandmethodologies,meansthatthereisnoonesize fitsalladvisethatisapplicableforeverybodyacrosstheboard.Sothis is intended as a general starting place for tips, pointers and theories. As I learn more over time Im sure Ill be adding and revising this sectionforanypossiblefutureeditions. Fear in Relation to the Abduction Experience

What Im not really seeing addressed in the materials that Ive researchedonMILABSandalienabductionisthesubjectofFear.This is so important that it cannot be emphasized enough, and its unfortunate that so many good books and articles out there fail to recognizethisintheirwriteups.Toooftenallwegetareawholelotof stories that wind the reader up but then forget to mention (or maybe dont even realize) how fear factors into the entire scenario. Addressing fear should be the next logical step in all abduction material. Over the years my experiences have repeatedly shown me that its a low personal frequency that (often times) allows this stuff to breach your realm, and its what definitely perpetuates harassment long after it should have stopped. I find it impossible to read other abductees stories when its a rehashing of a downward spiral of negative events and where the tone is one based on fear, frustration and paranoia. In

130

Chasing Phantoms

fact most MILABS material and personal accounts have a tone that I cant relate to, and youll see why when you keep reading this section. Myownattitudehasprogressedfromnervous,todefiant,tobecoming downright manically giddy at the harassment, and because of that attitude/vibe, the nonsense I used to experience has completely stopped. But why am I different?? Why cant the other MILABS feel the same way and put a stop to the things that are happening to them too?? I was trying to figure this out with my boyfriend, and he pointed outsomethingIhadntevennoticedmostpeoplethatyoureadabout who are all worked up about their harassment and the direction that life has taken them are worked up because theyre invested in the illusion. And Im justnot. At least, not in the same way. The attitude to have, as my boyfriend noted, seems to be: Having maximum awareness with the least amount of emotional hysteria. Having the bigger picture perspective from a place of higher awareness. Which leads to the next big point about having the right perspective. Too often, MILABS are getting so worked up over things like their phones being tapped, or vans being parked across the street from their homes, and so on. And to that sort of harassment I sayWhocares?!Imean,letsgainsomeperspectivehere.Whatends up coming out of it all? Pretty much nothing, as Ive learned, and which Ill talk about more in depth coming up. But when nothing comesoutofanything,whybescared? InoneparticularMILABspersonalaccountshereiteratedmultiple times throughout the book her indignation at having her privacy invaded.Theyrelisteninginonmythoughts!Theyrewatchingwhat Ido!Privacyschmivacy.Intheenditdoesntmatteriftheywatched you and voyeuristically monitored your thoughts. Ultimately you are energy, and youll be moving on. Your body is your source of life, something to love, not a source of embarrassment and shame. So worrying about what other people think, what theyre saying, how they may be judging your thoughts and watching your body is just 3rd density prison trappings. To really fully realize this and live it is truly liberating. Its also helped that Ive had quite a few heavy duty woowoo! experiences of a realityshattering nature that burst whatever tentative

Part III Expanded Insights

131

bubble I may have still had left that this reality is what society would haveusbelieve.Inowknowitsnot. And thats the key, or the trick. People get worked up and freak out and find themselves in a downward life spiral when theyre desperately clinging to something thats illusory to begin with. Theres a strange paradox happening with many abductees. Their abductions have shown them another side of reality that grossly contradicts the mainstream version of events, and yet they cant let go of hanging on to the illusion. Their job, their titles, (people are all aboutlabelingthemselvesIvenoticed,mosteverybodylikestheirself assigned titles that show off how many different roles they play and who they are in this reality) their role in life and personal identity theyve attached to themselves, their material possessionsthey still cling to it all despite what they now know. And because they cling and still relate to it, they become fearful of the things that are happening that work to shatter that. Lose the investment in the illusion, and they lose power over you. Im not Carissa ________ (inserttendifferenttitlelabelsthatdefinemeasapersonandmakeme feel grandiose and special) owner of _______ (insert all my material possessionshere.)Imjustme. So with that in mind, lets take a closer look at how fear can manifestinthelivesofabductees,andwhattodoaboutitall.

Black helicopters

In Part II I got into my experiences with the black helicopters, and how when I learned to stop caring, and dropped the fearthey abruptly stopped. Within each encounter, the second I changed my frequency, like changing the dial on the radio, each helicopter immediatelytookoff. The implications of this are pretty huge. What exactly is going on then if these helicopters take off the second I stop the fear and change my personal radio dial?? What am I saying herethat they can somehow read minds? Pick up on a targets thoughts? That theyre scanningapersonsfrequencyinsomeway??? Yes,actually,thatsexactlywhatImsaying. Think of all that material out there that gets into the black helicopter harassment, treating it in this extremely serious, conspiracy way and not one book (at least that I know of) mentions changing

132

Chasing Phantoms

your frequency, or doing what I did in my own encounters. Instead, theypropagatethemistakenassumptionthat:a)thesethingsaresome kind of scary, OOOOOOOH!!! big deal, and b) theres nothing you can do to make it stop. Theyre going to hover, and circle, and harass you as long as they want, and as often as they want to. So you better justgetusedtoit,thisiswhatitis. X! I dont think so. Its anything BUT that. Drop the fear, and they drop you. What my higher self, or whatever it was, communicated to me during my second black heli encounter was totally right treat it as you would an entity harassment/attack, and watch what happens. Well, what I had learned is that when it comes to the neg entities, they feed on fear, and when I lost the fear, they lost me. So I took my higher selfs advise and applied what I knew about negstothehelis,andouila.!Myhigherselfdidntcomerightoutand say Dont be afraid! because pssh, that wouldnt have helped. My responsetothatwouldhavebeenYeah,whatever!!andthatwould have beenit.Soithadtopropelmeintosomesortofaction, becauseI hadtolearnbydoing,andseeitformyself.WhichIdid. So there is absolutely no reason to have black helicopters hovering or flying in circles over your house or apartment for hours at a time, none. When reading cases of that happening I think, Thats bunk! Theres no need!! I wish I could shout it from the rooftops for all MILABS targets to hearChange your radio dial!! Shift your frequencyupandrejectwhatshappening!Theywilltakeoff!! Whywilltheytakeoffandreactthatway?Becauseagain,theyare there to scare you, and measure/recordmaybe even feedon your resulting fear. If you truly and sincerely could care less, then they havenopurposeforbeingthere. Itscompletelyunderstandablewhytargetsgetfearfulandagitated duringtheirfirstcoupleofblackhelicopterexperiences.becausethey dont know what these things are going to do. In my first two encounters I seriously wondered if I was going to be shot at when I went outside to look. Seriouslywhat if its there to kill me?! When thehelimovedontopofmyapartment,hoveringdirectlyoverwhereI stood inside, I just flat out panicked. WHAT IS IT DOING?!? WHY IS IT DOING THIS TO ME?!? I DIDNT DO ANYTHING! Panic and stress and anxiety arose from not knowing what was going to happen next.

Part III Expanded Insights

133

But when it becomes obvious that youre not going to get shot at, and this thing is just going to hover, or fly in circles, doesnt it seem, oh, I dont knowa bit stupid by that point? It does, come on, admit it.Anditsatthatpointthatyourenowobligatedtodropthefear,roll your eyes, shake your head, and shift your frequency straight up. By my third encounter I had an evil grin going as I challenged the heli to readmymindandswingbackaroundIdareyouIdareyou.Ifelt giddy inside. I dont think were supposed to feel that way. ;) hehe Its 180 degrees from what theyre trying to accomplish. And there I am, getting off on it, challenging the thing with manic giddy glee. So adopt a bit of a psychotic mindset, like Ive developed over the years. It truly helps. They dont waste time doing all the lab rat psychologicalmindgameswiththeratsthatgetakickoutofit. At this point some may be wondering whowhat.is piloting these black helis. Are they human? I dont know. Their windows are allblackedout.Canttellwhatsinside.Idalmost ventureasfarasto say no, theyre not human, or at least, not fully. Could be hybrids. If theyre not alien/hybrid, then at best, theyre probably robotic military types, the kinds that do as their told without thinking, including heli harassment of whatever location theyre told to go to. Then theres even a more far out idea that theyre not really helicopters at all, only projections of such because in at least two of my encounters, nobody else seemed to be aware of these things, even though they were harassing in broad daylight in an urban area. Or maybe they are a helicopter overlay disguising a UFO. You never know. So keep all possibilities in mind if you find yourself having these encounters. Thingsarenotalwayswhattheyseemtobe. On a side note, something I began noticing more of while doing this write up is how often the black helicopter subject is held up as the ultimate example of the conspiracy crazies. Sometimes even by the people who research conspiracies! What is it about the idea of black helicopters that causes many people, including some socalled conspiracy theorists, to be automatically dismissive of them? Do they believe that all the people whove seen them must be confabulating a hallucination? AllIcansayisthatblack helisaremostdefinitelyvery real,and Ive actually begun usingit as a gauge tomeasure how much somebody thinks they know when they claim to be a conspiracy researcher. If theyre talking a lot of talk about this conspiracy and that, but then in the next breath dismiss certain other conspiracies as

134

Chasing Phantoms

beingintheblackhelicoptergroup,thenitsobvious.Youstillhavea long way to go, buddy. But keep digging. And who knows. Maybe iftheydigdeepenough,ablackheliwilldecidetopaythemavisit.;)

**** TheBees.Theresarelatedtypeofstorythatshouldbeinsertedin here,asitrelates tochangingtheradiodial.Ithas todowith a swarm of angry bees that appeared outside our apartment one afternoon when Id been reading the book Barbara: Story of a UFO Investigator about UFO researcher Barbara Bartholic. I mention her book again later on in this section as well, but I had been reading the chapter titled Punishment for Investigating which details all the ways in which Barbara had been harassed over the years for her research into abductions and UFOs. My skin became hot and flushed as I read, and I was even shaking a little. It was the most disturbing chapter to read in the whole book, and I wasnt prepared for it. Especially the mention of harm that came to her pets. Innocent animalsbeingtargetedtogetattheirownersishorriblestuff.SoIwas worked up after several hours of reading. By then it was early afternoon and my boyfriend was up from sleeping, and so I took a break from reading to talk and hang with him for a bit. My cat was standing at the front door meowing expectantly, hoping to be let outside to play and have some fun, as was the norm on nice warm dayssuchasthatbutIinexplicablyfeltlikeIcouldntgetupfromthe chair I was in. Normally I would have gotten up right away and opened the door for her, but it was like I was being held in place. So I just sat there and smiled at my cat from across the room and told her thatIdletheroutinalittlewhile,justhanginthere.Ididntquestion the fact that I didnt seem to be able to get up. When something is beingdonetouswenormallyjustgowithitasifinadream. I sat there in the chair talking with Tom and bouncing ideas back and forth about the chapter Id just been reading, and after about a minuteIheardanoiseoutside.Itsoundedlikebees.Alotofbees. Whatsthatnoise?Isaidtohim,frowningandlistening. Motorcycles? he said, not paying much attention. Occasionally therearedirtbikesonthetrailinthewoodsoutsideourapartment. No, thats not motorcycles.that sounds like bees. I was now able to get up since the veil of control had lifted, and I walked over to thelivingroomwindowtoseewhatwasoutthere,concerned.

Part III Expanded Insights

135

It was bees alright. And we soon realized it was a swarm, thousands of them, the most bees Tom and I had ever seen in our entire lives. They were also individually really huge for bees, the largest nonbumblebees Ive ever seen. And they were right outside one of our living room windows, seeming to be quite agitated. The swirling mass spanned from our window up to our neighbors second and third story windows above us, since we live in a three story building. The bees were all facing the building and windows, and manyofthemseemedasiftheywereactuallytryingtofindawayinto our window, hovering right up against the screen and flying around theedges,exploringforwaysin.Seeingthousandsofagitatedbeesout of nowhere hovering outside our window and hoping to get in, and the way it all sounded was alarming. To put it mildly. Id just never seen or experienced anything like it. It was like something out of a movie.Ihadanimmediatepanicfearsurgeandbeganrunningaround closing all the windows of the apartment. We have screens, but I wasnttakinganychances. I resumed my spot next to Tom at the living room window where the bees were all concentrated, figuring theyd soon break it up and leave. Tom grabbed his digital camera and took video footage of it using the video function on his camera, which is good, so we have proof of this incident. ;) http://www.montalk.net/bees (the video is grainy and shaky, and the window screen obscures a clear view, but you can still get the idea, enough to see the large mass of agitated and very large sized bees, aimed at our window. It was actually worse than how it appears in this video.) But one minute soon turned to five and then ten, and it became clear they werent going anywhere anytime soon. They just kept going, and going, and going, thousands ofcrazybees.AndthenIhadtherealization. My cat had been pleading to go outside only a minute before they arrived.Andherfavoritespotwhereshealwaysgoestofirstwhenshe goesoutside? It was exactly where the swarm was now. Right outside that particularwindow,whereshellpokearoundandnibbleongrass. Something had held me in place as I sat at the chair, not allowing me to get up and let her outside. But if that something hadnt done that, then my cat would have walked right into what was to be an angry swarm. And me being me would have of course put myself rightinthemiddleofittogetherout,becauseIwouldabsolutelynever

136

Chasing Phantoms

just stand there and watch her get stung to death. I couldnt, I cant eventhinkaboutitortrytoimaginewhatthatwouldhavebeenlike. It would have been a very bad situation, and the realization of it coupled with the sound they were making and the way the swarm looked just made me panic even more. The fear was running away withme.SothatswhenIrealized.Okay,thishastostopNOW.Im NOThavingthis. Without saying anything I turned from the window and went down the hall into the bathroom and closed the door, to block out the sound of the bees and get some quiet. Then, I did what I did for the black helicopters. I changed the radio dial. Controlled my breathing and did a frequency shift, dropping the fear and panic that had been surging through me, all the while repeatedly thinking NO. NO. NO. Just fully believed that I had control over this situation, not something else, and that it was going to stop NOW. Because Im NOThavingit. I intuitively sensed that I didnt need to do it for long, just enough to literally, change the dial so to speak and sweep out all the fear and reject what was happening. I finished, opened my eyes, opened the bathroom door, and went back out tothe living room feeling calm and in charge. I dont know why I believed that it would work for bees of allthings,butIdid,forwhateverreason. Andwithinoneminuteofmeemergingfromthebathroomthebees were disbanding and clearing out. Only a couple of stragglers remained, and within another minute they were gone too. Amazing coincidence.Allwasquietoutsideonceagain. It may not seem like much of a big deal, but Ive since talked to Barbara Bartholic on the phone and she relayed to me that the angry swarm of bees thing is one of those things that most people dont know about, but its very real and it does happen. That surprised me to hear, I had no idea. Until she told me that I still believed that there was a chance that this incident was natural and explainable. But shes got a few alarming stories in her files of personal research involving abductees or people involved in abduction research having the swarm of angry bees appear outside their residence. So she was absolutely amazed to say the least that Id had an encounter with them tooand inthemiddleofreadingherbook,noless.Itwasshewhoencouraged me to add this section into my book in fact after hearing the outcome of my experience, because she feels its important for people to know

Part III Expanded Insights

137

that they can apparently gain the upper hand in these situations. You dont have to stand there and let it just happen, being powerless to stop it. Harassment, be it helicopters to anomalous swarms of angry bees or whatever it may be can be stopped. You just have to drop the fear, believe you have the ultimate control, and change the radio dial.
Paranoia

Another related topic to fear is paranoia. Ive encountered people on the internet, or in emails, who displayed the figurative wildeyed paranoia.Theretheyare,relayingsincerestoriesabouttappedphones, surveillanceandmonitoring,blackhelis, agentsin disguiseasregular people, obsessing in circles about their weird events, and theyre all workedupaboutitcompletelyamplifyingthesituationandensuring that the harassment will never end. Theyve become a guaranteed fear/anger/paranoia allyoucaneat buffet, and in the process theyre locked into a downward spiral that may lead to their permanent derailment in life if they cant snap out of it. They havent figured things out yet. You have to stop caring. You have to become nonchalant.AsIbluntlytoldoneguyonamessageboardmaybetoo bluntlyCalmthefuckdown! You have to. You have to calm down, take a big breath and get a griponyourselfwhenitcomestothisstuff.Youhavenochoicebutto learn how to be nonchalant. And I mean sincerely nonchalant. Dont pretendyoudontcarejustdontcare.Period. So, theyre buzzing your apartment or house with a helicopter? Cool. Wave at them and take a few pictures. Then crank up some goodmusicanddancearound. Your phones are tapped? Thats good. Who cares. Give them something worth listening to. Have fun with it. When theyve tapped into my conversations, namely, when my boyfriend has been back in Iowavisitinghisfamilyandweretalkinglongdistance,wealwayssay hi to them. Hi! How ya doin. Five seconds later were onto other things and have totally forgotten about it. Are we going to be all weirded out about it for the rest of the conversation? Are we going to spiral down into low frequency fearful paranoia?? Hell no. Its not even worth remembering ten seconds after it happened, only because

138

Chasing Phantoms

wevelearnedthatnothingendsupcomingoutofit.Theymaketheir presence knownand then thats it. Nothing else. Its all side track circusdiversion. Theyre following you in black cars? Hmm. Tailing people in black cars sounds so, I dont know, 1970s doesnt it? Its a big mind game, because they know it will oooh, be spooky. My brother claimed that they would park across the street where he worked in Connecticut and just watch, and make their presence known. He got so pissed off about it that one day he went charging out the door, across the street and right up on them, screaming WHAT?!? WHAT?!!? WHAT THE FUCK DO YOU WANT?!?!?! I believe he began pounding on their car and kicking it, if I remember correctly. ;) They started the engine and took off. And that was the end of that. Ive seen my brother in action firsthand, doing far worse things than that,soIdontdoubtforasecondhedidthis.Hewasabsolutelycrazy andfearless. A good example to cite here would be the book The Mothman Prophesies. When you get worked up and obsessive about stuff, freakedout,scared,thewaypeoplewereinMothman,thentheentities seem to want to mess with you even more. Its like a scientist toying with a lab rat. When you stop caring, when you get to that point where youre willing to charge right at them and confront them and take them on, face to face, when you lose all fear, it all stops cold turkey. The abductions may still continue, but its back to business, minusallthemindgames. One of the big bombs my brother dropped on me after I arrived in Portland, when he was first explaining to me what the situation was with our abductions and with reality in general, was to tell me that They could see and hear everything that I see and thinkdue to my implants.! Hmm, I thought. I realize that most ordinary people would get terribly freaked out by this revelation. The idea of no privacy. The idea that everything youre doing and thinking and saying is being monitored, by unknown Thems. Quite the paranoiainducing predicament of voyeuristic intrusion. For normal people. But Im not normal. So later that night when my brother went off to work, I danced naked in front of the big mirror that was there in his apartment. Theyre watching? They can see what I see through my eyes?Good.Letme standinfrontof amirror.Heresaniceshowfor

Part III Expanded Insights

139

you. ;) This is what I think about them monitoring my every thought,word,andactionandseeingwhatIsee:Idontcare.Next! In retrospect it was that mindset that helped save me. Had I spiraled down into fear, paranoia, anger, frustration, etc. I probably wouldntbetypingthisrightnow. On a closing note theres another facet of paranoia I want to get into: blaming every little thing that happens in life on the infamous invisible all powerful THEMS!!! Sometimes things happen stuff breaks, people dont get your email or voicemail message, mishaps occur, etc., and the THEMS!!! are not behind it, believe it or not! ;) I have encountered a few people in life though with the tendency to blameeverylittlethingthathappensontheTHEM!inthisbugeyed, alarmist way, and to that I say.its time to get a grip. While you might be a target, theyre not micromanaging every little malfunction and mishap that occurs in life. Ive gotten several emails from people who were convinced that the THEMS! were interfering with their emailaccounts,sosurethatIwasntgoingtogettheiremail,orthatifI didnt write back right away then it obviously meant that the THEMS hadstruckagain,causinginterferencetokeepusfromcommunicating. Allofwhichjustleftmeshakingmyhead.Itsveryoffputtingtohear from people like that, stuck in that mindset. Another time when I was giving a talk/interview sort of deal to someone whos since become an acquaintance of my boyfriend and I, he was experiencing technical difficulty with the microphone and sound setup during our first talk. His immediate thoughts were that it was THEM! interfering. He was prettyconvincedofittoo.untiltheissueresolveditself.;)Andweve never had another issue like that again while talking. Its because the problem wasnt THEM! interference, it was just normal technical difficultieswhiledoingtheinitialsetup.Thosethingsdohappenafter all.Ivealsoreadofaguyonamessageboard(thesameonewhowas freaking out about tapped phones, mentioned earlier) who was convinced that his hard drive was fried out by THEM! Well, sometimes computers die. It happensa lot in fact. It doesnt mean THEY! did it. There were a few others on this same message board also blaming things on the THEMS, describing what came across as wideeyedparanoiaaboutvarioushiccupsandthingsinlife. The test for discerning what might be the handiwork of them is whetherlogicalexplanationscanberuledout.Andideally,Ithinkwe should always be looking for the logical explanations for things not

140

Chasing Phantoms

to the point of oblivious denial, but in a balanced and reasonable way. When an incident is over the top and unbelievable, then chances are itsprobablythem.Forthemoremundanestuffthatcertainlyseems suspicious, but youre not sure, its a case of time will tell. Dont jump to immediate, paranoid conclusions. Keep a levelheaded mindset as you neutrally observe the entire situation from a detached viewpoint, gathering facts. And if it turns out tobe them, dont get freaked out byit.Keepyourwitsaboutyouandtakewhatyoucanlearnfromthe incident in order to apply that knowledge in the future.and then moveonwithyourlife.

Death/injury threats and attempts

To me, the most disturbing facet of all concerning alien/MILAB abductions concerns prominent researchers and authors being physically maimed during abductions, instilled with disease programming,orflatoutbeingtakenout.Cancerseemstobeabiggie. Alien/MILABS researcher and author Karla Turner died prematurely of breast cancer. And in the book Barbara: The Story of a UFO Investigatorshehasthistosayaboutthecancerprogramming:

IvemadeawidecircleoffriendsallacrosstheU.S.A.,mostofwhom were somehow involved with UFOs. Too many of them are dead or dying.Cancerseemsthefavoritemethodofriddingtheworldofnosy busybodies who want to known who and what the aliens are and wheretheycamefromandwhytheycomehere.Canceristheanswer toalltheirquestionsinfartoomanycases.

Puzzling,isntit?

Nottome.

Almost every day since I started my UFO investigations I have suffered strange happenings, sickness, complete lack of privacy, pain, torture to my animals, accidents to my family members, loss of property, threats, and almost every other kind of punishment you couldwishuponyourworstenemy

When I first read this chapter of her book, titled Punishment for Investigating I got a bit worked up as mentioned earlier in this section. I found myself easily succumbing to the same fear that many

Part III Expanded Insights

141

of these researchers also experience. But I took a step back, conferred with my boyfriend, (who happens to be the web host of a metaphysics andconspiracysite,andtheauthorofnumerousarticlesonsaidtopics, so, hes a good person to talk to for some feedback) and I came to my senses, youcould say. He remindedme of my own teachings that Ive been writing about and living for the past two years. And so at this point in the game, Im going to take a bold step forward and loudly proclaim that in my opinion, it doesnt have to be this way. They donthavepoweroverus.Theycantkill you,norcan theygiveyou cancer,oranyotherdisease. Whats happening here with these researchers is a multifold scenario:

The fear frequency. It cant be stated enough. Fear, fear, and morefear.

Lack of intending for protection. And Im not talking about begging to God, in the traditional sense of praying Im talking about rising up and connecting with the very sources that you would be praying to, changing your frequency, empowering yourself, as well as taking preventative spiritual measuresasIwillexpandoninabit.

Not taking control of the reigns and reversing whats been done to ones body. We dictate the health of our bodies not outsideforces,asIwillelaborateoninasecond.

But what happens to these researchers is not what has to happen toyou. Forstarters,sometimespeoplewillreceivewarningsbeforeattacks are implemented. But too often theydontlistenand take it seriously, or take any sort of precautionary spiritual measures. So what to do whenthathappens? We should listen. And I dont mean in the sense of becoming afraid and giving them power. What I mean is simply acknowledge whats happening. Dont run from it face it straight on. OkayThere is an intuition/voice, etc. telling me this. The source obviously believes this bad thing will happen to me if I dont take heed. So acknowledge it. But definitely dont ignore it and shove it aside. When there were black helis hovering and circling over me,

142

Chasing Phantoms

ignoring it and just sticking my head in the sand which was my first reaction! did absolutely nothing to stop it and make it go away. In fact,itonlyamplifiedit.

Sorule#1:Dontignorewhatshappening!

The next step would be to stop what youre doing, right then and there, and have a spiritual powwow. Connect to something higher andpositive,whateverworksforyou.Jesus/theChristConsciousness, God/the Creator Source, angels, spirit guides and protectors, your Higher Self, and so on. Everybody has their own thing, so, call on yours,whateveritmaybe.Connecttoit,mergewithit,becomeitfor more on this, see the next section, called Praying for Intervention. Youre empowering yourself and raising your frequency, rising above 3rddensityvictimhood.Youretakingaction.

So rule #2 Connect to the higher powers and raise your frequency rightoutof3rddensity.

Indoingstep2,yourealreadyturningthetablesontheoutcomeof the situation. Someone wants to harass you or your family, with the threat of more in the future?? I dont think so. Youve picked the wrongtargetstoharass!

Sorule#3Sayno.

It seems so simple. Almost too simple, Im sure. But Ive done it, anditworked.No.Idontthinkso.YouareNOTgoingtodothisto me. No. Im changing the radio dial. NO. NO. NO. NO. NO. Over and over and over, while simultaneously raising your frequency. Youresayingno,rejectingtheirthreatsandharassment,dictatinghow your life will go, according to you, taking control of the situation. All the while as you factor in your spiritual powwowconnecting to your higher power help, and merging with that, aligning with what it represents. Calmly rejecting whatever scenario they had in mind for you. You have to know that you have the ultimate say in what happens toyou.

Part III Expanded Insights

143

Sorule#4Realizeyouaretheoneinchargeofyourlife.Notthem. Andknowitwitheverythingyouhave.

You have to know it, and not second guess yourself. And know that when youre done doing this, and are walking away to go do the next thing, that things are already in the works to make sure you get yourdesiredprotected,safeoutcome. From what it seems to me, based on the research Ive done, the all out negative, physical abusive harassment doesnt just erupt in a MILABslifeoutofnowhere.Thrashingsduringanabduction,leaving onesbodyblackandblue,disease,organfailurecancerdeath.You dontjustgofrom0toalloutcrazinesslikethatovernight.Itstarts withbreachingyourrealm,andfromthereitbuilds.Andbuilds.And builds. The longer you allow it to happen, the more you stick your head in the sand, the more fear, worry and paranoia you generate that feedit,thenthestrongerthefootholditcangetintoyourreality. But if you fearlessly face off with it right from the getgo, you WILL nip problems in the bud. There will only be so much they can do after that when youve lost all fear, you can feel your own empowerment and strength with total conviction, and are on permanentspeeddialwithyourspiritualpowwowsource. The other, very understandable, problem lies in the fact that most people will naturally be intimidated by these beings and military spooks. They seem so much bigger than us, so much stronger, so, soevil. Theyre outside of time, whizzing around in UFOs, materializing and disappearing at will, abducting and implanting and monitoring,flyinghelisallaround,tappingyourphone.Andasweall know, bigger, stronger and evil always equates to being invincible.right? X!Hardly. Everybodyhastheirstrongpoints,andtheirweaknesses.Andthat meansthemtoo. Their weakness lies in the fact they overestimate themselves and believe that humans will continue to remain the victims weve demonstrated ourselves to be. They also seem to lack the spiritual connection we humans are able to tap into. Cold, cunning intelligence willonlygetyousofar.Youneedtherest,whichwehave.

144

Chasing Phantoms

So now, why are they able to give people cancer? Are they all powerful Godlike creatures with the ability to completely control and micromanageallotherlesserbeingsatwill??Andmoreimportantly WHO exactly is it thats giving these people cancer? Is it aliens?...orhumans? Its actually humans, apparently. Lets look at an interesting excerpt from the Barbara Bartholic book that directly pertains to this, (boldedwordsmyownemphasis):

Atabout4a.m.,Iworktoavoicesaying,Youhavebeeninfected with cancer. The words were put into my brain through thought projection. There is no hope for you. The program has already been installed. Cancer will kill you. The wordless projection felt human rather than alien. It was much too blunt to have come from alien sources. Too clumsy really to have come from ordinary human sources.IrealizedImustbehearingfromashadowmilitarygroup.I wentwildwithfear ***** I spoke to one of the exmilitary men whom I knew to be psychic, thenshowedhimthehandshapedbruiseundermybreast.

With a half smile he said, Theyre giving you cancer, kiddo. Looks liketheyredoingawaywithyou,girl.Theresnohopeforyou.

Theywho?

TheBlackProjectIntelligenceOperation.

Ithenshowedhimthebruiseonmyneckwhichappearedtocontaina puncturemark.

They dont want you speaking out any longer, Barbara, he said. He evenseemedpleasedtoaddwithatwistedgrin,Youreagoner.

***** Whatsgoingonherewhenwereallypickthisexchangeapart?

Thepowerofsuggestion.
They being the military black ops/hybrids/whatever they are have tapped into a very basic understanding about the nature of the human mind. We are extremely suggestible and programmable. People are so sensitive to their environment and to the emotions and

Part III Expanded Insights

145

reactions and words of everybody around them that they will usually take most things to heart. We are reactive people. We get affected by words,bothpositiveandnegative. If you were surrounded by people affirming positive things to you every day, for your entire life, imagine where youd be and how far you couldgo.Butwedontliveinthatworld.Weliveinaworldthat both purposely and inadvertently tears us down in so many ways and cripples our potential. And it takes so little to do it, which is pretty unfortunate.Butitsthenatureofthisworld,andalsowhatitistobea highly emotive, reactive human being that responds so sensitively to thisworld. The military spooks issuing cancer commands, and later reinforcing it in person, know all thisand are utilizing another form of mind control. And by this point, we should all know how much they rely on their handy dandy mind control. They are all about bending the will of their targets to mold and shape them according to their mandates, usually through hypnosis and suggestive commands. So keep this in mind. And I dont care if the cancer command/suggestion iscomingfromhumanmilitaryspooks,orasevenfoottallReptilianor Mantid. Youre the one in control of your life and body, not them. Period.Andtheyre countingonyounoteverrealizingthis,risingup, andreclaimingyourpower.Andthatstheirweakspot. There is however another facet to this instilling somebody with cancer or various diseases by beaming particular frequencies at them, known as scalar weapons. When you do the research youll turn up evidence that the military has developed frequency weapons designed to kill outright or inflict harm and disease on a target. This has apparently been employed on certain MILABS targets in order to shut them up if theyve pursued certain sensitive topics. But I believe that even this is combatable. Why? Because again, they do not have the final say in what happens to you. You are the one responsible for what happens to you! They may beam their little diseaseinflecting weapons on you, but you can combat it and reverse it. We all have that capability. Problems arise for those who dont realize that they can reverse the things being done to them, and instead, just lay down and die instead of rising up with an indignant mindset, ready to combatwhatshappening. Theres a book that I recommended on my web site that I want to take a moment to recommend here, because its very fitting, but its

146

Chasing Phantoms

called The Biology of Belief, by Dr. Bruce Lipton. Dr. Lipton was a cellular biologist and professor working for mainstream academia during his 20 year career. During the course of his work and research, he came to discover some startling things about the nature of the human body. It turns out that its all about mind over matter. DNA and genetics dont dictate whether you get cancer, illnesses and diseasesyour own thoughts, perceptions, beliefs and attitudes do. Anditstoomuchtogetintohereforthiswriteup,soall Icandoisto just recommend this (well written, riveting, educational and down to earth) book as being one of the more important things youll read, if youre not aware of this subject already. Id put this concept to work formyselfbeforeeverreadingDr.Liptonsbookorwatchingoneofhis presentations, thanks to another book entitled The Holographic Universe, by Michael Talbot. I healed myself of various ailments through the sheer will of the mind, and literally, talking to the body parts in question that had the issues. I stopped a bladder infection, an ear/jaw issue that was rendering me unable to talk, a tooth problem, and other assorted things. Dr. Liptons presentation and book served to help reaffirm and remind me of this knowledge that Id already gleanedbuttrustmeitcantbereinforcedenough! Once people realize this concept and can prove to themselves that it works, then suddenly the idea of a military spook commanding you to get cancer is absolutely absurd. Sure buddy. Whatever you say. ;);)eyeroll,eyeroll.Onceagain,theyrelyonourlackofknowledge andawareness. I dont completely have my head in the clouds in the sense that I believe we can eliminate all abductions entirely through the above mentioned practices. Things vary from person to person. But what I do know is that you have to at least fight back and take a stand, do something, because even eliminating 90% of your abductions and removing your fear has to be better than doing nothing at all and just going belly up. Its 90% less interference, programming and possible injury than you would have had otherwise and that in itself reduces later attempts to take you, seems to eliminate how far they can go with you when and if they do take you, and pushes back the realmbreach.

Part III Expanded Insights

147

Praying for Intervention vs. Saving Yourself


Connecting to your higher powers

Following isa moredetailed explanation of theconcept mentioned intheprevioussection. In reading the accounts of female MILAB targets, notably in the Karla Turner book Taken, I couldnt help but notice the overwhelming feeling of fear that pervaded almost every womans story. Fear of what was happening to them, fear of the dreaded impendingabductions,fearofthestrangeparanormaloccurrencesthat surrounded them. Fear, fear, fear, and more fear. A whole book of fear. Not only that, but several women mentioned begging and pleading to God to get their abductions to stop. But help never came. Theabductionsandharassmentneverstopped.Prayingdidabsolutely nothing. Why? Because they were asking from power outside of themselves to come in and intervene and rescue them. In doing so, they became a helplessvictimchild,unabletohelpthemselves. As mentioned in the previous section, you have to realize your own power. You have to rise up and connect to the very power youreaskingforhelpfrom.Youhavetobecomeit.Whateveritmay be. Jesus. Angels. God. Your Higher Self. You have to know that you have it within you, and that you can plug into it, access it, and align with it at any time. Youre not going to cower in the corner asking for it to come and rescue you, the powerless victim. Youre going to change your frequency right out of this 3rd density reality, and youre going to rise up and join forces with whomever youre calling upon. And this flies in the face of everything that mainstream religion would have us believe. Mainstream religion has conditioned the worlds people that they are helpless victims that reside underneath a male God figure with a beard and flowing robes, perched on the clouds, holding a staff, judging everybody and only helping those that He deems worthy, the ones who live perfect, immaculate lives, while throwing lightening bolts and evil glares at all the rest of the heathens and damning them to hell. Weve been conditioned to believe we are meek and powerless, and have no

148

Chasing Phantoms

control over our lives and no say in anything that happens to us. God runs our lives. Not us. Were just Gods little puppets on a string.AndImheretosay,thisisnttrue.Butdonttakemywordfor it. Discover for yourself whats possible and what youre capable of! The disinformation conditioning is designed to get you to believe that youre underneath higher powers so you wont realize that you ARE the higher powers. The higher power creator source is in everything, andyouarealreadyit. Another tactic worth noting that seems to always work for those being harassed by abductors and neg entities is to command something to stop and leave in the name of Jesus Christ. They dont like that one AT all. People have reported being dropped like a hot potato the second they said that. Many reading this wont be Christianbutitneedstobenotedforthosewhoare,andthosewhoare willing to try it. Its highly effective, and worth trying if the reader hasnt already because its not begging for intervention outside yourself its a form of aligning to a particular team and commanding that the negs have to leave your reality in the name of that team. Not to state the obvious, but a belief in and emotional connection to the idea of Jesus is also absolutely necessary for this to work. You dont wanttobeutteringemptywordswithnothingpropellingthem. To wrap up this section, I want to leave off with the reminder that being fearful and cowering in the corner waiting for intervention is whatsknownasOption1. Being a fearless but slightly crazy person who goes around confronting lifes harassers with fists, baseball bats, pellet guns and even an arsenal of empty wine bottles, like my brother did, ;) is Option 2. And while its heading in the right direction because its definitelyfearless,dokeepinmindthatTheGridisallaboutgivingus only two polar extreme opposite choices. Black, white. Right, wrong. Liberal, conservative. Violence, or passive victim. TPTB are all about eliminating options, and giving us two false dichotomies to choose from. So maybe what we want is to consider Option 3. The one hidden behind the curtain. The one where you acknowledge the things that are happening to you, but without fear, then change your personal radio frequency and again, rise right up out of this 3rd density reality to align with the very higher powers that you would call upon. Youre not a passive victim/prey. Nor are you becoming a

Part III Expanded Insights

149

fearless, psychotic aggressor. (Because if left unchecked, that fearless and violent retaliatory aggression can become a slippery slope into the realmofpredator.)SoOption3.Thatswhatitseemstobeallabout.

Revoking illegal metaphysical contracts As the reader is probably realizing by this point, anything that I can pass along for what a MILABs target can do to combat their situation in a proactive, fearless way, then Im all for it. With that in mind, recently I came across some fascinating information regarding the idea of revoking illegal metaphysical contracts including those concerning MILABS written by Lipstick Mystic, aka Jennifer, author of www.lipstickmystic.com. The following excerpt was originallypostedontheNobleRealmsmessageboardforum,andisre printed here with permission. In fact, the following tactical advise actually came about as a result of the original online version of Chasing Phantoms; Jennifer relayed that after reading the PDF version of my book, a group of people she works with asked the universeyoucouldputitforanysortofadviseforwhattodoaboutall of this MILABs stuff. The following excerpt was the answer they got. Soitscomefullcircleasitsnowbeingincludedinthehardcopybook form! This is extremely useful information for consideration, and worth mentioning as one proactive solution. Bolded words my own emphasis:

Just as any legal agreement you enter into if you are mentally disabled or on drugs is NOT legally binding, so are these crusty contracts with the negative reptilians (and other negative ET groups who have also come along for the exploit the humans ride) NULL ANDVOIDaccordingtoUniversalLaw. My healing circle was given a very powerful affirmation recently toaddressjustthatissue. I invoke Universal Law and declare all FALSE contracts with negative reptilians, humanoids, and ET races NULL AND VOID. I cancelthemthroughouttimeandprobability. When you invoke Universal Law you can really start breaking those illegal contracts, which were made when humanity was under duress,throughcoercionandmanipulation.

150

Chasing Phantoms

In a similar way, you can invoke Universal Law to cancel all false contracts you may have made with the military industrial complex and its subsidiary groups (think MILAB). Because these contracts were made in situations that were illegal in a metaphysical sense often done during abductions when you were hypnotized or drugged, through coercion and torture, using lies and manipulation. Under Universal Law, we have the right to cancel any such contracts throughout time and probabilitynot just for ourselvesbut on behalfofallotherhumanswhohavebeenaffected. My sense is that THIS is the hot button to work on if we really want to put an end to the garbage thats happening all over the world and the satanic war games that those boring old characters are addictedto. If we cancel all false contracts we have made throughout the ages in which we gave permission to these dark ones to be our bosses and to own us spiritual slaves then they have to honor that under UniversalLaw. Wakeuptothat,andthingsstartshiftingimmediately. This invocation....to invoke Universal Law to cancel all FALSE CONTRACTS (ones made under duress, or ones unintentionally made by our parents that affected us as their children).....with the military industrial complex, subsidiary groups, and negative reptilian and ET groups......has created dramatic improvements in the people whohavebeenworkingwithit. Be warned, though, that you may experience some very strong effectsafteryoudothiswork.Iwassettingclearintentionsaspartof thisthatallimplantsrelatedtothesecontractshadtoberemovedfrom my physical and etheric bodies ASAP.....And I could feel my spiritual guidesandangelsworkingovertimeclearingthemoutatnight....andI slept12hoursfortwonights....andduringthedayIexperiencedreally weird, scary numbness in various parts of my body.......but they kept telling me they were moving me through this clearing process as fast asmybodycouldprocessit. Today I have no numbness, and I have a mental, emotional, and spiritual clarity that I dont think Ive had in YEARS....perhaps even my whole lifetime. As the daughter of a Navy guy who has worked with top secret submarine technology his whole career, and the granddaughter of a man who helped fine tune radar technology duringWorldWarII,IthinkIwasonalistprebirth. I wanted to share this because Id love for people here to start experimenting in their own meditations with invoking Universal Law

Part III Expanded Insights

151

todeclareallfalsecontracts(withwhomever...ETs,government,other darkcreatures)nullandvoid..... Andseeifthingsdontchangeprettydramaticallyforthebetter. Were far more powerful than we realize, as long as we keep reclaimingourmemoryandourspiritualsovereignty.

Everybodys going to be different, so do and say what works for you when you revoke your contracts and ties. Ultimately what matters most is the intent. The mere fact that you are renouncing any known or possible ties or contracts with unsavory elements whether legal or illegal shows the universe where you currently stand, and proclaims where you are consciously trying to align yourself. That counts for a wholelot,actually.

Negative entities interfering with awakening MILABS

ThiswasanotherbitIhadwantedtoincludeinearlierdraftsofthis book but then held back. What changed my mind was an email exchange with a guy that Ive come to know through a message board forum I participate in. He has signs and symptoms of having maybe had funny stuff happening to him in life, and Id always been pretty positive that he was an abductee based on various things hed mentioned in emails to me. An abductee of whom or what, I didnt know, but he seemed to have somethin going on. We were recently emailing back and forth for several days discussing things, and during these several days where he was making some really important connections for the first time ever in his life, (like the fact that his dad was Air Force intelligence) really looking closely at things he hadnt noticed before, he coincidentally experienced negative entities visiting himinthedreamtime,harassinghim. I myself have also experienced supposed negative entities paying me visits during the dreamtime during times I was making important breakthroughs with regards to MILABS stuff, asking questions and probingforanswers.Followingisonerelativelyrecentexample: In the previous section I reprinted information about revoking illegalmetaphysicalcontracts.Well,despitefeelingvery excitedabout it all I wasnt even able to get around to trying this until almost a full two months after the fact. ! I kept experiencing a feeling of negative discouragement, keeping me from trying it. Patiently I rode it out,

152

Chasing Phantoms

knowing it couldnt last forever. Then two months later I could feel that the negative pressure had lifted, and I took the opportunity to squeeze in some revoking. For three nights in a row I did this as I driftedofftosleep.Well,onthethirdnight,somethingcameround toharassmewhileIslept.IfoundmyselfinadreamwhereIhadaneg entity latched onto me. I became lucid and started connecting to the idea of the Christ Consciousness, raising my frequency, and even mentally crossing myself. That provoked it and I found this neg screaming and flailing about, causing my body to jerk all about as it putonquitethelittledramaqueenhistrionicsdisplay. I got it off me and woke up in my bed. All was calm. Or was it? Mycat wasawakeandbegandoing somethingveryunusual.Silently she positioned herself with her back to me, facing out towards the rest of the room. Shed sit there for a bit, then get up and move to another side of my bed, calmly sitting, facing out towards my room. She continually moved around the three exposed sides of my bed, facing out towards the roomas if possibly facing off against something that was around, and maybe keeping it from getting near me on the bed?Icanonlytheorize. This actually didnt spook me because by this point in my life Ive been through a lot and have gotten a bit blas. I laid there thinking aboutthings,andthenhadthebrightideathatsinceImawakeandall in the middle of the night, and since Im already on a roll with the whole revoking illegal metaphysical contracts thing, then why not see aboutremovinganypiecesofmydadthatmightbestucktome,any part of him that might be linked to the MILABS stuff in my own life? Its a long story in itself, but pieces of peoples souls can attach themselves to others, and theres evidence that I have a piece of my dadstucktome,aswellashispossibleMILABSconnection. I laid there and began intending for any possible pieces to detach and return to sender. I was doing this for about one minute when I receivedthesmackdown Iguessyou couldcallit.Iwaszapped by something while I lay there in my bed. It was like a small jolt of electricityinmychest/ribs/heartarea,anditjerkedmybody.DidNOT feel good is all I can say, EXTREMELY unpleasant icky feeling, and Ive been in no hurry to experience that again. Even more interesting is that it simultaneously made a ping! noise in the air above me. !! SowehadphysicalsensationgoingonhereANDaudio.

Part III Expanded Insights

153

Ive had extensive paranormal experiences as mentioned earlier in this book when I lived in the paranormal apartment from hell nicknamed The Vortex back in California, with my brother. But this was my introduction into MILABSrelated awakening harassment. When MILABS begin poking around in sensitive areas, asking questionsandtakingstepstoremoveitfromtheirlife,stuffseemsto appear,kickingupastink. Recently I came across something similar noted in the book Song ofFreedombyJudithK.Moore.Backduringherchildhoodandteen yearsin the50sandearly 60s,Judith Moorewasusedin Satanicritual abuse/governmentmindcontrolexperimentationprojects.Herstoryis one of the few of this type that I truly believed as I was reading it, (versus some of the prominent women out there on the touring circuit discussing the same things who seem to have been compromised, or people who may be copycatting other womens stories) but at the beginning stages of her realizations about what had gone on in her childhood, she experienced one of those creepy paranormal entity encounters:

One night, coming home, my friend and I were talking about the possibility of incest in our childhoods. As we parked for a few minutes to continue our conversation, something horrifying happened: a big, dark figure loomed at the car window, then disappeared. We screamed and drove away. I know that was an apparition from the darkest side of life, a visitor from the other side, theworldwheredemonswanderinsearchoftheirlostsouls.Icannot remember being so frightened in my life as I was those first days of identifyingmyselfasasurvivor.page15

Factoring in that message board buddy who had negative entity stuff coming around in the dream time during the first few days of truly questioning his childhood and his strange parents and their Air Force intelligence connections, along with my own stuff, and Ms. Mooresstory,anditreallymakesmethinktheressomethingtothis. But what Im wondering is, how exactly real are some of these entities? A real entity from another realm most definitely can appear in this realm and interact with us even attach to us and try to attack us whilewereawake,asisthecasewithJudithMooresencounter.Hers definitelyseemstobereal.Butinthecaseofmymessageboardbuddy

154

Chasing Phantoms

and myself, the fact that these things were only appearing to us while we slept really threw me for a loop. Theres no doubt that something was amiss herepeople dont just have dreams about neg entities wrestlingthem,tryingtolatchonandharass themafter all.Butagain, in my own encounters, something about it didnt feel real. As with all confusing things, I just put it aside and figured answers will come. Theyusuallydo,ifyourepatientenough. At this point I think Ive gotten some answers. It happened one night after the above incident, where I found myself wrestling with another harassing neg in the dream state. Were wrestling, and Im invoking the Christ Consciousness energy, raising my frequency, taking this thing on, whatever it is, but with no fear, just in the most nonchalant way imaginable due to that aforementioned blas attitude aboutitallandIsuddenlybecomeawarethatIcanhearhumanmale voicestalkingfaintlyinthebackgroundofmymind,onwhatsounded like a radio. !!! I couldnt discern what they were saying though, it was like gibberish. The entity? I could handle that for some reason. But the idea of human male voices being involved in it allTHAT freaked me out. I panicked, saying to myself like a little kid, WHY DO I ALWAYS HEAR HUMAN VOICES?!! Always being a reference to other times this apparently happened during my dreams, but which I didnt consciously remember until that exact triggering moment. And then it turns out that my boyfriend had experienced the same identical thing battling it out against a neg entity in the dreamtime, only to become aware of human male voices talking back andforthonaradiointhebackgroundofhismind. Butitgetsbetter. Later on after that particular incident I found myself fending off yet another neg entity during the dreamtime, feeling calm and nonchalant while invoking the Christ Consciousness vibrationand then a sarcastic human male voice cuts in on the line so to speak, sounding like late 20s, early 30s maybe, and jibes me with, Why are you even USING that technique anyway?? Jesus wasnt even REAL! Justtotallymockingthewholething. !! This time hearing the human male voices didnt faze me. So Im wrestling with this entity, whatever it really is, and meanwhile Im addressing Mr. Sarcasm off to the side in the same sort of voice one mightusetoexplainsomethingtoafiveyearold.ItdoesntMATTER

Part III Expanded Insights

155

if he wasnt realits the IDEA BEHIND IT that counts. Like, come on guys, lets get on the same page here. Duh. ;) REALLY funny in retrospect. I havent experienced any more of these strange neg entity encounters since calmly answering them back as if they were five years old, being completely unfazed, and I suspect I never will again. Why? Because in my opinion, these dream time entities may often times have very human manufacturers behind them. I was already taking them on in a very blas way, which in itself is awesome and shows spiritual progression, but having knowledge that theyre not even real to begin with dissolves the game. Now, it doesnt mean all night time/astral harassersarebeingcreatedbyhumanabductors.But certainly some of them seem to be as Ive since discovered, possibly in order to mess with the target, to discourage/scare them from pursuing answers, to sink them into a lowered fear frequency and send them spiralingoffcourse,andsoon.AndsoIpassthisonforconsideration. Negentityharassersmayalsobeacomponentofthemindcontrol programming itself, a program/compartmentalized personality fragment instilled within the psyche to deter the target if they begin waking up, asking questions and remembering things. This was an ideaIfirstcameacrossintheworkofFritzSpringmeier. And theres also the offhand possibility that these entities actually are real, and were sent in by these human thems who may be involved in occult ritual practices. But again, my experience has shown me that an entity who can only come after you while in the dreamtime/astral state, versus on your own turf in the physical realm whenyoureawake,issmallpotatoesandweak. If these dreamtime entity harassments ever happens to you, then twoofthebiggesttipsIcanpassalongistobelucidandawarethats important and nonchalant and blas. No fear, basically. Practice becoming more lucid and conscious in your waking life, as that will spilloverintoyoursleepstate.Itsallaboutneutralawareness.

156

Chasing Phantoms

Thwarting psychic attacks

Thetermpsychicattackscanrefertoseveralthings:

1. Deliberate mental targeting of an individual by a person or a group of people with the intention of harming them in some way; 2. Neg entities targeting a person to attach to them, harm them, and/orfeedonthembydrainingtheirlifeforceenergy; 3. Having focused, negative thoughts about someone which inadvertentlysendsnegativeenergytothatperson. Psychic attacks go by various names, and its the same concept involved with dark occult black magic rituals when the intent is to harm somebody, or invoke demons and neg entities to do ones bidding. So you may be wondering, why am I mentioning this in a book that concerns abductions? Namely because psychic attacks are often a major component involved with MILABS, and therefore makes it something worth mentioning. Somebody I know was once experiencing a psychic attack and decided to lie down, meditate, and trace it back to the source to discover who was behind it all. Surprisingly,thispersonfoundthemselvespoppinginonthreeremote viewers working in an underground base whose job it was to hone in on himandmess with him. The remote viewers in turn received quite a jolt to suddenly find their target looking right back at them. ! They werent expecting that. So this is probably far more common than people realize: governmentsponsored black ops remote viewers and psychic warriors being used to knock targets off balance in life, possibly to inflict harm, and maybe even get somebody taken out of thepicture. To give you the basic idea of what a psychic attack would feel like,followingaresomesymptomsthatIandothershaveexperienced:

Intense energy drain and lethargy, to the point where its like your actual life force is being sucked out of you. It will often descend out of nowhere, which is another major clue, and render you practically unable to move or do anything other than crawl onto yourbedandcollapseintoaheap.

Part III Expanded Insights

157

Nauseaagain,usuallyappearingquitesuddenly.Alsomigraines, flashingintheeyes,orskinfeelingasifitsonfire.

Feelingextremelynegativeandhateful.Nonaffectionateandaloof towardslovedonestothepointwhereyoufeellikeyouwantthem completelyoutofyourpresence...maybeevenyourlife.

Mental agitation for no logical reason, not tying into diet, sleep, or personal conflicts. The mind going going going, with amped up internal dialogue, repeating thought loops or all around negative mindset,andoftentimesinterferingwithsleep.

Inexplicable depression, despondency and even suicidal ideas then sometimes followed immediately by thought forms in your head telling you to go kill yourself, (or as Ive experienced, being toldtogolaydownanddie,rightnow.)

Nightmaresandoverallnastythemed/violent/upsettingdreams.

These symptoms will usually go together as a package deal of sorts, and arent to be confused with the flu, or viral/bacterial sickness which can cause some of the same reactions. When Im sick, Ill usually get the sinus discomfort, sore throat, and a fever that comes from inside the body and accompanied by chills, which is how I can differentiate between true sickness and then something else. Also, sickness doesnt descend as rapidly as psychic attacks do. With a psychic attack you can literally be fine one minute, and then be overcome the next. And conversely,you canbe under attack and then within seconds of intervention treatment as quick as the snap of a fingerbefineagain. But dont despairit can be combated! Of course, otherwise I wouldnt bother to mention it. The most important thing is to be able to recognize that this is happening in the first place. By learning that psychic attacks exist, and what some of the major symptoms are, yourealreadyhalfwaythere.Theycountonpeoplebeingignorantof things,remember.Thatshowtheyreabletodowhattheydo.So,its allaboutbecominginformed. The next step is to pry the source of the attack off your body. Remove the muck, and sever the connection. What many people do is toliedownandthenintendfortheconnectiontobreak.

158

Chasing Phantoms

If you happen to have somebody nearby whos gifted with the art of handson healing, thats good too. In that case, the laying on of handswiththeintentforthenegstoleave,rightnow,canbeenoughto get the negs to fly right off your body. Ive experienced that, so, I know its real. In the meantime, either you, or both you and your healer, should be calling on positive protective forces. Or rather merging with your personal positive forces, as Ioutlined earlier in this book. Youll be shifting your frequency up, connecting to your positiveforces,aligningwithwhattheyrepresent.ThenwhatIvealso done is perform a mental raking over my body, envisioning myself scraping all the neg muck that may still be on me, rounding it all up, putting it in a figurative bag, sealing it up, coating it in the positive energy that I called on, and do a big ol return to sender. Sending it back to whence it came...whoever/whatever the source may be. Some people like to try to trace things back to find the source behind it all. I havent attempted something like that, but if youre curious and like answers,thengoforit.Byknowingwhothesourceis,itcouldcomein handyforoffsettinganyfutureattackattempts. After that, when Im on such a roll, I then like to expand my protective intent toincludemycat,myboyfriend, theentireapartment weliveinandeventhecarswedrive.:DWhynot,goallthewayand coverallbases!Itcanthurt. Back in 2000, I had to do a cleaning in my bedroom as well as self protection after being whomped one night by a nasty neg entity who physically went after me while I was awake in bed, vulnerable. I documented this on my website in the write up called The Vortex. And in that case, I didnt call on protective forces or even align with them.IwasntatapointinlifewhereIwasintothatsortofthing.But what I did do, (and which worked) was to connect to who I was as a kid. Connected to the innocence, purity, and the uncorrupted core of who I am as a person. So just remembering that, and connecting to it, was enough to raise my frequency sky high. Once I was able to elevatemyfrequency,fromthereIwrappedmynegentityinlotsaluv, andsenthimbackthroughtheportalfromwherehecame,thensealed it. So ultimately, thats what were aiming for with these protective meditations raising our frequency whatever thoughts or methods can get us there. There is no one, acrosstheboard method. Just do whatever works for you. When you raise yourself up like that, the negscannolongerholdontoyou,andthehooksdetach.

Part III Expanded Insights

159

So thats the general outline of how its done, but everybodys going to have their own methods that are tailored to them and their personality and beliefs. Remember, we dont have to be helpless victims, but they count on us not realizing this. So Id recommend doing research on websites, books and resources that get into more detail about neg entities, attachments, and psychic attacks if this is a subject thats of interest to you. A good starting place is the excellent book,PracticalPsychicSelfDefense,byRobertBruce. Im also going to be honest I cant pretend that youll only have to do this once, and then life will return to flowers and rainbows permanently afterwards. It most likely wont. If youve experienced a deliberate targeted attack on you once, and managed to sever the sources connectionanddoareturnto sender, thenchancesare,theyll try again. Ive experienced this several times. On one occasion for instance I severed a psychic attack/entity attachment, feeling fantastic afterwards to the point where I was practically floating and had blasted my heart chakra wide open, only to find myself inexplicably edgy and grumpy/low frequency within 24 hours. BUTI dont mention this to instill fear. My mindset is matteroffact, its just how it is shoulder shrugging awareness. They dont just let people go without a fight after one thwarted attack. So if you do have to protect yourself against a psychic attack/attachment, do keep in mind that it most likely will return. All of which means, intend for continued protection in the future, take preventive measures to keep up your frequency,andeliminateavenuesinyourlifethatallowthemtobreach yourrealmagain.Ifyoureawareandprepared,thenit wontbe abig deal.AndIbelievethatafterafewtimeswiththat,theyWILLgiveup. End Times Programming

After the original printing of this book an interesting subject came up on a message board I participate in the idea of apocalyptic doomsday end times scenarios seeming to be an actual need of mass consciousness, whether its Biblical Revelations, the Rapture, the New Ages Shift/Ascension, 2012, Y2K, nuclear war, Planet X, global warming, ice age,poleflips,cometimpacts,andsoon.Andrightthen asIreadandpostedtothatthreadImadetheconnectionregardingmy own apparent end times programming, received via my MILABS

160

Chasing Phantoms

involvement. Id never thought much about it before then, and it certainly slipped my mind during the original writing of this book. Then, synchronistically within a day of making that post I came across a brand spanking new article by James Bartley outlining what of all things butMILABS end time programming. ! Mr. Bartleys article was exciting for me to read as he was talking about the exact sort of programming I myself have experienced. There are endless uses for MILABS targets and many aspects of programming going on, but I thinkendtimescataclysm,NWOlockdownsocietyprogrammingis SUCHahugeandimportantonethatitwarrantsitsownsectioninthis book. Forme,thisprogrammingseemstohavestartedbackin2000when I was roommates with my brother in SoCal and apparently being abducted,butnotawareofit.Iknewhehadthethemsinhislife,but I was in a state of oblivion about my own involvement. I was also not intoreadingconspiracymaterialatthatpoint,andonlyhadsomebasic understanding of the NWO. But yet at this time I began experiencing what could be called obsessive thoughts regarding a future society in the midst of NWO lockdown/martial law. Id have these vivid imaginings that would invade my thoughts where I could see tanks rolling down the streets of urban L.A., soldiers with guns drawn,patrolling,keepingeverybodyinline.Melivingontheoutside of this locked down society, on the lam, in the woods or in caves. These thoughts were so pervasive that as a writer I wanted to write somesortofstoryaboutitall,otherwisethey werejustburningup my brainwithnooutlet. These thoughts continued into 2002 and 2003, an allaround state of mind that was expecting, prepared and even hoping for a cataclysm where I would be a survivalist living in a postapocalyptic society, again, on the lam from oppressive forces trying to keep everybody in line. Its not really normal to want this sort of future societyandtobethinkinginthatdirection. I began reading militaryissued survival material,books on how to grow and forage your own food, make your own soap and candles. Not in a crazy, wild eyed way, but out of matteroffact, level headed interest. I created a Bug Out Bag loaded with all the necessary on thelamsurvivalsupplies.Therewasaveryvivid,realisticdreamofa nuclearexplosionIhadonenightwhereitwastheendofthegamefor me. Vivid imaginings of walking along roads that no longer had cars

Part III Expanded Insights

161

on them, because most people werent driving anymore ducking off intothewoodstododgethepoliceroadblockssetupalongthewayfor interrogating the rare people who did still drive. More vivid imaginings of Washington D.C. being nuked because its only 100 miles away from where we currently live. Just far enough away that we wouldnt be killedbut still within a major danger zone requiring us to leave, and then surviving in a society that would now be in chaos. Vivid imaginings of panhandling for food outside stores that I could no longer go into because Id said no to the Big Brother microchipping, while others said yes. So now I had to be on the outside looking in. And lots of obsessive interest about the logistics of freight train hopping. Not normal! ;) Id intently study passing freight trains and imagine running along and grabbing on, jumping off, jumping onto the top from a platform above, and even got tips from my dad who hopped trains as a kid wear gloves, he suggested. Andgetabeltorropeofsomesorttostrapyourselfinifyouplantobe on one for awhile, so your hands and arms wont get fatigued having toholdonforsolong. But then, there was the mother of all bein on the lam and escaping the NWO dreams: It was so vivid that it may as well have happened. The dream started with the U.S. being in a war situation and with martial law in effect; I then found myself traveling by foot across the country and was in a convenience store where people were gathered around the T.V. that hung from the ceiling, calmly watching the news reports. Then it culminated with me and several others illegallyhitchingridesonfreighttrains,tryingtogetcrosscountrypast closedstateborders.Weweresomewhereoutwest,in openland with mountains in the distance and a piercing blue sunny sky. Military snipers dressed in black were set up intermittently along the tracks to pluckoffpeoplelikeme.Isawtwosniperdudesabout30feet(?)from the tracks, one of whom had his rifle up and firing. The one next to him had his rifle down, and just stood there squinting in the sun, letting the other guy take his shots at us. I could feel the bullets whizzing past me as I rounded the corner of the box car to get away and hang off the other side, and thats where the dream ended. My mentality through it all was calm and nonchalant. Just doing what neededtobedone.Nofear. When I pendulum dowsed this back in 2005 I got that no, it was not a normal dream.and no, it wasnt a prophesy either, believe it or

162

Chasing Phantoms

not. Much to my disappointment. Being wired to find this desirable and appealing means I was secretly hoping for such a fun and dangerous future! But alas, it apparently was not a premonition of a real situation waiting to happen. So what was it then? Well, what I got from my line of questioning was that yes, this was programming. Interesting, I thought, then put it aside and forgot all about it. Until now, after finding the James Bartley article, which outlines verbatim the fact that MILABS are being run through dream time and virtual reality training programs designed to prep them for some future locked down postcataclysm society where they will be on the lam, traveling cross country, dodging the bad guys and having to forage forfoodandsurvive. http://theuniversalseduction.com/MilabOperations.pdf Itwas morealmostfallingoutofmychairwhenI readthis.Just to see somebody describing my obsessive thoughts, ideas and dreams that Ive been having over the past six years was amazing. So I guess thependulumwasright. So how canyou tell thedifference between a premonition vision of ones future versus programming dreams and thoughts? Easy programming dreams are vivid. Toovivid. Theyre so real itwas like you were there, and they seem to involve very negative scenarios. True premonition dreams seem to be a lot more subtle, at least in my own experiences. And the thoughts and imaginings that I wouldhave whileawakedidntfeelreal.Theyseemedtoinvademymind,seeping in almost like a virus you could say, overtaking whatever I was thinking about before. Theyd take on a life of their own, growing bigger and bigger like a snowball rolling down a mountain. True waking premonitions, as Ive experienced them anyway, tend to be suddenflashesthathappeninaninstant,notconnectedtoanything. The next question then is Why? Why are MILABS being programmed with end times training scenarios, and being wired to desire this in their lives? And most importantly, are all MILABS being given this programming? Or only selected individuals? James Bartley has his personal theory for whats going on here, (bolded words my ownemphasis):

the obvious first candidates for survival are milab adults and especiallymilabchildrenwhohavelatentparaphysicalabilitiesdue

Part III Expanded Insights

163

totheiruniqueDNA.Fromthestandpointofthemilitarycontrollers, milabsandmilabchildrenarenotnegligiblecommodities.Theyare extremely valuable. Think about it: Even aliens, sometimes several different species of aliens are interested in these people. The aliens particularlythereptiliansandthedracs,musthaveagoodreasonfor beinginterestedinthesemilabs.

Onasidenote:Forsomereadingthatitcanbeanegowanktofeel as if theyre one of the special chosen ones, due to special abilities and bloodlines, although I know that wasnt Mr. Bartleys intended purpose in mentioning it. This is just a word of caution for anybody who might make the mistake of falling for that potential ego pitfall, anditssomethingelseImentionlateroninthisbook. With that said, I tend to agree with Mr. Bartley that this could be one particular reason for why some MILABS are being targeted for training.Asalwaysthough,theresneverjustonereasonforanything, andImthinkingtheremaybemorelayerstopeelbackhere:

1. Disinformation. If targets are programmed with very vivid, believable training scenarios and end times battle dreams it may reinforce and convince them that this really is our future. In turn, theyhelppropagatethispossiblymistakenbeliefoutintheworld on the internet, with friends and family, and so on. So, a case of MILABSpossiblybeingprogrammedtoinfluencethemasses.

2. Ensnaring/herdingdesirabletargetsontoanegativetimelines.In getting a MILABS attention focused obsessively on these negative future scenarios, the programmers are getting these selected desirable targets to inadvertently pull that negative probable future reality to themselves. Like attracts like, and your health, job, friends, and life happenings in general all reflect what youve pulledtoyourselfviayouractions,thoughts,fears,(orlackthereof) attitudes, and beliefs about whats possible and what isnt. The same goes for where you wind up in the future: Your attitudes, thoughts, actions and beliefs right now, as you read this, are shapingwhatupcomingtimelinesyoufindyourselfon.Andwhat if youre somebody with enormous potential on a future positive timeline? And youre being derailed/sabotaged into pulling yourselftowardsonethatsverynegative?Nowtheresathought.

164

Chasing Phantoms

3. Encourage a ServicetoSelf (STS) militia mindset. One of the MILABS women in Bartleys article was trained for how to grab a shoppingcartandraceherwaythroughasupermarkettostockpile food and supplies in the event of an emergency, beating out everybody else. Yay for me, I have food, too bad for you, youre goingtostarve!beingthementality.Anotherpartofthisendtimes cataclysm programming involves what to do with those who cant keep up with you when youre on the lam and trying to survive. The programming tells you to drop them, and dont think twice. No matter who they areeven if theyre a loved one. Ive run up against thoughts like this, wondering hmm, what happens if someone Im with is dragging me down, but its someone I care about?? Then I read about this very same thing in Mr. Bartleys article. Drop em, says the programming. A completely self centered,mememe!STSsurvivalistmindsetalltheway.Atfirst I could sort of understand that point of view although I wasnt comfortable with it, so just pushed it out of my head, not wanting to think about something like that. After awhile though things began changing in me, and thats when I said, You know, wait a minute here!! I dont think I could do that. I dont want to do that! To me it was the whole false two choice dichotomy deal, where were only given two black and white polar opposite extremes to choose from either save yourself at the expense of others, or go down in flames with the lagwagons who will drag youdown.

X! How about neither. How about this entire end times programmingdebacleisbunk?Wheresmythirdoptionhere?

ding ding ding! Once you begin questioning things and aligning with a positive path, the negative programming starts to fall apart at the seams and loses its appeal. You start to see it for what it is. TheywantMILABstoadoptamilitiamentality,onewheretheyve got guns and are willing to trample on anybody who gets in their way, and do what they have to do to survive. Its utterly ridiculousinmyopinionandstripsapersonoftheirhumanity.Id starve to death before I carried on like that. Some people are already quite STSoriented though, and/or are somebody with the potential to tip over in that direction, which is probably why theyre targeted for this sort of programming. Keep in mind that

Part III Expanded Insights

165

they are always scoping for good STS recruits. ;) They can scan frequencies, see who has the dark side potential lurking within them, or those who are already full blown living it, making for an excellent new recruit. Come, come work for us, you smart, psychic,STSbloodlineyou!

4. Go westinto a trap? Something else Mr. Bartley noted in his write up, which matched with my own dream experience, was thatMILABSwerebeingdirected to gowestinthesebeing onthe lamandtravelingcrosscountryscenarios.Gowestwhy?One idea is that the southwest is riddled with both above and below ground military bases that have both human and alien personnel, as well as having energy vortices galore. It is, or at least, has the potential to be, one huge higher density bleed through. So, stuff may be waiting to round up the arriving programmed recruitsoncetheyobeytheirprogrammingandmakethejourney.

Another idea may be purely survivaloriented, to get away from crowded urban areas with lots of people, police, guns, mayhem, and lockdown. Get to rural empty land away from people, and maybehaveabetterchanceatsurvival.

Related to that is the concept of Earth changes its been reported thatmanyhighuppeopleintheknowhavebeenrelocatingto,and building homes in, Idaho, Montana, Colorado, Wyoming, New Mexico and Arizona, because those areas will supposedly be safe intheeventthatthingswindupunderwater.SomanyNewAgers, MILABSandmilitiasurvivalistsingeneralhaveitintheirheadsto go west/southwest that it automatically begs to be questioned. Its extremely suspicious at best, and I just know that should I ever find myself in the middle of a society gone to pot, Im going the opposite of where all the programmed people are being herded. Forgetthewideopenbakinghotdesertwithnofood,waterandno place to hide.one would be way better off heading for densely forested areas where theres food, better access to water, shade, and means to make solid camouflaged shelters. And the farther inland and the closer to mountains, the better just in case were talking about Earth changes here where things have gone underwater.So,youknow,justathought.;)

166

Chasing Phantoms

So we have four potential reasons off the top of my head as the reason for this programming. And yet all of it manages to cleverly skirt the free will violation kink in the works. Why? Because we as humans have self awareness and sentience, with the ability to think, question and analyze not only ourselves, but the world. And its up to us to put those abilities to use. And if we dontthen oh well, not the programmers faults. ;) So the negs way of thinking goes. They like to exploit lack of awareness for all its worth, get away with as muchastheypossiblycan.Theprogrammersarenttechnicallyforcing the target onto that negative timelinenor are they forcing them to live out that scenario if and when they do find themselves in it. The target still has freewill to stop and go, WAIT a minute herewhy am I having these obsessive thoughts? And why do I feel like these scenariosareappealing???Andtheystillhavefreewilltooverridethe programmingthatwouldhavethemgoingwest,killing andtrampling on others and doing what they have to do in order to survive, and coldlydroppingthosewhocantkeepup. Once you can recognize that you have this sort of programming, and if youve decided that you dont like it, then take back control of the wheel. Declare that youre aligned with positive sources, ask for whatever help and protection they can offer, reject the obsessive thoughts about negative future survivalist me me me! scenarios that wouldinvadeyourmindanddreamslikeavirus,andbeginpracticing all the small ways you can override those negative STS behavioral urges as they manifest in your every day life. Youre basically re programming yourself is what it boils down to, and aligning yourself withadifferentpathandadifferentprobablefuture. Untangling Disinformation

A big part of what it means to be an abductee is that people will often find themselves being given revelations about various things. Theyre shown things, told things, theyre given predictions or prophesies, insights into whos who and whats what in this reality, butthebottomlineiswhatsreal,andwhatsdisinformation? At this point Im going to relay what happened when my brother Joe finally got to meet them face to face during an abduction that he was allowed to remember, which took place in October of 2001, and

Part III Expanded Insights

167

the revelations about us, and reality in general, that he passed on to me. He was given all sorts of information, not only for his own programming purposes, but also because it was supposed to get to me too, to shape the outcome of where I wound up in life. For the actual details about what Joe saw during his abduction, see the section called The World Underground in Part I. And keep in mind that Im not endorsing what he relayed. I think some of it is flat out crazy. But what I am going to do is just lay out there what he was told and shown,forthebenefitofanybodyelseout therewho mayhavebeen told/shown something similar during their own abduction experiences. Because from what Im starting to realize, there may be MILAB targets out there being put through the psychological mind game ringer to REALLY screw with their sense of whats real versus whats illusion, and to give them the impression that their abductors are Godlike powerhouses who control reality, all in an effort to sabotage them in life and aid the negative programming attempts. So this could be useful for that reason. Then, Ill untangle what I feel is the disinformation and correct whats most likely been skewed. Disinformation is very clever in that its usually closely intertwined around valid information. It gets you nodding your head Yes, Yes, Yes to stuff that matches up to what you know, then takes a sudden turn way out into left fieldwith hopes that youll just keep nodding your head Yes. And as mentioned earlier in Part I, theres often double reverse psychology going on, requiring multiple unravelingsofthematerialbeingpresented. AtthetimeJoetoldmeallofthis,Iknewnothingaboutanyofwhat he was talking about because it was 2001, and I was brand new to this entire thing. I had no way to verify any of it at the time, so all I could dowasdocumentitonmycomputer,whichIdiligentlydid,andputit all on the backburner. Only after the fact did I slowly start to find sources who were saying the same thing. And as mentioned previously, Joe did not read up on these subjects, and didnt go on the internet, so thats not where this information came from. But then again...he didnt have to seek the info out on the net or in books, because he wasnt a regular person, or a regular MILABS target. I mentioned in Part I that Joe was a probe/pawn of sorts, being piloted bysomethingelse,andsobytheendwasactingasadirectextension ofthem.

168

Chasing Phantoms

So with that in mind, these are some of the revelations that they told him during his 10/01 abduction. I dont get into everything he mentioned, as some of them are trivial or personal, but these are the majorones:

This reality is merging with another, and because of whats happening, certain chunks of this reality have gone missing. Those missingareasarebeingfilledinwithholographicprojections.Youcan feel when youre in a holographic projection because the people and naturalscenerywilllacklifeenergy.

Holographic reality known as The Program is projected through an interconnected system of satellites, radio dishes and ELF waves, among other things. Basically anything that can be used to transmit signals.

The media isall an illusory lie as well. He claims to have been shown some sort of disk thing that they can insert into something that has a crystal, I dont fully know or understand, but thats where our television,news,etc.comesfrom.

Only about 3 out of 10 people are actually real anymore. About 30% of the population. If that. The rest are what you could call drones. Empty shells, background characters, puppets of the program. Black peoplehowever,usuallyareallstillreal.!(hedidntexplainwhy,just saidthisiswhatyoullsee.)

There are various secret factions of thegovernmentand theyre at war with each other. i.e., they all have their different agendas and theyre competing with each other. As far as the government we see the President, Senate, Congress, etcthats not whos really running things. They secret factions dont answer to them and have no regard foritatall.Andyes,hesaid,thegovernmentwasbehind9/11.duh.

In about 5 years time (putting the timeline at the end of 2006, into 2007, roughly), something is going to happen which is going to halt the way of life as we currently know it. Things will be locked down, [martial law?] and traveling will become so expensive and such a hassle with all the paperwork thats required for it that only the rich will be able to keep doing it. Theyre going to have militarized check points set up on the highways, with spike points for popping tires, andfacilitiessetupundergroundforconfiscatingpeoplescars.

Part III Expanded Insights

169

On a personal note, he went on to say that we both had implants that allow for them to see everything that were seeing. Everything wedo,sayorthink,canbeandismonitoredbythem.Thenthere was the bit about how were not from here soulwise and theyre not either. In fact, theyre supposedly part of the same soul group as my brother and me. And that also, oddly enough, ties into why both of us look so young for our ages. He said were not aging at the rate that others around us are. And supposedly, according to them, my brother and I were abducted when we were kids by aliens. Stuff not related to them and their agenda. They are supposedly something separatebut theyve been following us since we were kids. They have files on us containing every known possible detail about us, and he said they claimed that theyve even manipulated events in our livestoseewhatweddoandhowwedreact.Butthentherewas the tacked on bit that Oh, see, they like us, and are on our side, and do what they can to help when they can. Theyre not supposed to, buttheystillsneakinhelp.(riiiiight.) The part about manipulating events to see what wed do and how wed react sounded a bit ridiculousat first. Until I stopped and remembered that Ive seen them, whoever/whatever they are, orchestrate some pretty unbelievable synchronicities that involved actual reality manipulation. Its stuff thats so out there that I normally just dont think about it too deeply because the implications are pretty astounding. So long after Id put aside this particular revelation onto the backburner, I began realizing on my own that it seems as if there may be a blueprint of sorts with regards to the lives of abductees. Whether military or alien, I started to possibly see patterns in the chaos, as if our lives arebeing manipulated to go a certain way, with certain types of things happening at certain ages almost as if we were being experimented on. Then I remembered Joes revelation about them manipulating life events to see what wed do and how wed reactand was like, HOLY SHIT. Its something Im still looking into, and plan to do a small write up on it in the near future that will appearonmywebsitewhenIcangetsomemoreinformation. There was one big thing that Joe heavily tried to impress upon me as well, which was that I needed to stop thinking about things so much. Because see, the way the grid program of reality works is that when you think about things to much, it tries to beat you to the punch

170

Chasing Phantoms

you could say, and manipulates events based on its anticipation of whatyourethinkingofdoing. So, if I had to untangle the things that I was told, Id say the truth was that yes, something is changing in our reality some call it the Shiftifyouwillandyes,holographicprojectiontechnologyseemsto be real, from what Ive since discovered in the past few years. In fact, the (channeled) book Bringers of the Dawn by Barbara Marciniak says much of the same stuff Joe relayed. Joe had never read that though, and neither had I, until after the fact. And as far as chunks of realitygonemissingIwrestledwiththisone.AtfirstIwaswillingto believe it, with a neutral, sure, anythings possible mindset. Then I putthewholethingoutofmyheadforseveralyears.Now,asof2006, Ive found myself going back to this particular revelation with some shockedincredulity.Ivecomeacrossinformationfromvariouspeople over the past year that corroborates this. Large amounts of people in crowds with no auras. Entire areas that used to be real but which no longer emit life force energy. People seeing the white grid lines, of which I have some personal experience with as well. And so on. So now Ive found myself returning to this revelation with particular interest. Now, fake media generated from a disc I know that what were told via the media is a bunch of lies, but as far as the entire shebang beingcompletelyfake,peopleandallno.AlthoughIwouldntdoubt that the technology he was describing was real discs, crystals, and whoknowswhat,whichallsoundsveryAtlanteanesque. But what does seem to be valid is the concept of drones. People who are content to serve the program/system, and who try to keep the rest of us in place. To say that Ive noticed people who werent acting right is putting it mildly, and this started happening for me back in 2000, before my abductions were known to me. Ive encountered peoplewithbigemptyeyes,whoseresponseswerenotmatchingwhat was being said, people who could only talk about normal things, and who literally, shut down when something woowoo was said, and people who were just acting reeeeaally off in general. So yeah, this parthasvalidity,inmyopinion. 9/11 being staged? Absolutely. The government not being what were told it is? Check. Secret factions? Yup. At war with each other?Imsure.Sothatallseemstobetrue.

Part III Expanded Insights

171

However, the part about not thinking about things too much becauseofthewaytheprogramworkswasactuallywherethebrunt of the most potentially damaging disinfo. was. It was designed to get my reality creation abilities nipped in the bud, pronto. Ive consistently been able to manifest what I need in life, going way back to when I didnt even know about such concepts. So imagine what would happen should I begin trying to turn my mind off and not think too much. As mentioned earlier in this write up, they need people to not think. They need people who are asleep and unaware, drifting through life on autopilot. People who think too much are a dangerousthing. As far as the prediction about five years time guess well just have to wait and see. The thing about this one is that myself and others that I know through a message board forum have felt some definitive changes or shifts you could say over the past year or so. We feel like weve shifted onto a different timeline nowseveral times in fact. Some of us even have very clear knowing/memories that we are repeating ourselves as if in a time loop of sorts, myself includedand Im not talking about dj vu either. So for me Im not worried about this predicted future because the bottom line is, the future is open, can change,andhasalreadybeenchangedonmultipleoccasionssince2001. There are many open probabilitiesa factor that was conveniently left out of this prediction. OF course. ;) They dont tell you things likethat,remember. And while I dont doubt the both of us were implanted, the fact that I was told how my every action and thought could be heard and seen by them was said (in my opinion) in the hopes of driving me into self conscious, fearful paranoianot because it was just some useful tidbit to know. Luckily, I didnt go down that route, and decided that I didnt care what they were seeing/hearing. Which ties into one of the biggest underlying reasons for telling me any of this stuff in the first place: To break me psychologically, and get me to chooseaverydarkpathasaresultofwhatInowknew.Fakemedia. Fake people. Fake reality. Nothings real! Have a psychological meltdown!Theresnopointinbeingnormalandmainstreamanymore, right? Just go crazy and be a sociopathic criminal, like Joe. Close myselfofftopeople, andhatethemall,usethemandexploit them,the wayhedid.AndifeverythingIdidorthoughtwasknowntothem, and theyd been snagging me and watching me my whole life, then

172

Chasing Phantoms

shrinkupinparanoid,selfconsciousfear.Beahelplessvictim.Allthe while believing that these guys were really the good guys, who help whentheycanandarepartofthesamesoulgroupasus.;) When I was talking about this topic to a male abductee over the internet, he said that their attempts to psychologically destroy him with these same tactics only backfired. Id said the same thing about my own situation, so it was funny to hear him say that. And what we mean by backfire is that instead of converting us into angry/paranoid/hateful/fearful tools that serve the dark stuff, it backfired, and succeeded in just making us all that more aware, and switching us over to the opposite direction of what was intended. But asmyveryawareboyfriendhasnotedonmanyoccasions,theyalways take a risk when they make the decision to fully go after someone. Theres a high probability that they will succeed and the target will be converted/absorbed/taken down.but theres always the chance that itll blow up in their faces. Then again.it could all be more layers of games within games, asalready mentioned earlier in the book. ;) Who reallyknowswhatsactuallygoingonhere. SeveralmonthsafterJoerelayedtheserevelations,Ihadadream whereIwasshownwhatrealitywouldbelikewithoutTheProgram inplace.Itscaredtheshitoutofme,isallIcansay.Itwasbrief,butI heard a male human voice somewhere off to the side or behind me, narrating, but I couldnt see him. (Communicating through implants most likely.) And then I found myselfhovering in an empty void of total nothingness, my feet hanging in midair, accompanied by the most intense feeling of panic and anxiety Ive probably ever felt. Its really hard to explain, but Id have to say it really did actually maybe feel like how a void in reality might feel. THIS is what its like without the program I was told. Kind of like, Do you get it now? Withoutfakereality,thisiswhatyoudhave.Notverynice,isit? I woke from that experience in a full panic, gasping for breath, nerves on end, really messed up. Whether somebody was really showing me something valid, just as a useful and informative FYI, or whetheritwasallmanipulativemindcontrolgamesdesignedtobreak me psychologically, I can only guess. I actually suspect it could be a mixofboth. But this does make me wonder though how many other abductees are being targeted in a similar fashion, given revelations and insights, whether trueornot,whicharedesignedto tryto derailtheminlife.If

Part III Expanded Insights

173

anybodyout thereexperiencesanythingevenremotelysimilarto what I went through while up in Portland, the only thing I can suggest is to not flip out. Keep yourwits about you, and just put whatever youre told or shown on the backburner until a later date when you can get more information and corroboration. Thatsall you can do. You cant just automatically believe it and take it at face value, no matter what flashy theatrics they throw at you. What Ive discovered is they havealotofabilities,sure.Butwhatsreal,andwhatisnt?Thething to always keep in mind too is the spiritual bigger picture. The stuff they dont tell you about are higher positive forces and your own Higher Self. When I discovered that in 2003 it was like I gained a whole spiritual arsenal against them. Thats when everything changed. So its an absolute must to keep that aspect of it all at the forefront of yourmind. Multiple Personalities vs. Multiple Personas

Before researching heavily into the subject of mind control, I independently came up with the idea of what I call multiple personas, which differs from the concept of multiple personality disorder.InthecaseofMPD(orDisassociativeIdentityDisorder,DID, as its now called) we understand it as being a situation of the person having separate, individual fractured personalities, sometimes having their own unique names, genders, ages, personalities, speech patterns, mannerisms, etc., and accompanying black out periods when personalities are flip flopping back and forth. Its wild stuff. And I cantsayIveeverknownanybodypersonallywhohadthisproblemto that severe of an extent although I have on the other hand, witnessed what I have deemed multiple personas. Its a much milder form of beingafullonsplitpersonality,butitsnottobeconfusedwithbeinga multidimensional person. If youre real youre not going to be a one dimensional cardboard cut out after all. Youre going to exhibit different moods, different sides of yourself as you navigate your way throughlifeplayingyourvariousroles.Youreamom,afriend,awife andlover,aneighbor,adaughter.Somebodysdad,brother,son,boss, husband. You cant be one way to everybody, and thats very normal andtotallyunderstandable.

174

Chasing Phantoms

But what Im talking about is having an almost split personality. A situation where the mood swings are more like severe personality swings, but the person in question still answers to their name and never loses awareness of their core self, versus multiple personality disorder where a person may answer to a different name, thinking they are actually somebody else. My theory is that in the case of multiple personas there could be one of a couple of things happening: 1) the mind control target has had their mind split/fractured during programming sessions, which leaves them with personality instability in their waking life that in turn, can cause their personality to shift around, yetthey never quite make the full flip over into a compartmentalizedalter,losingthesenseofwhotheyare.Itstopsjust short of that, leaving theperson a fully functioning member of society, with (relatively) little suspicious behavior that would be noticed by anybody. Or 2) its a situation where programming to fracture the mindhasonlybeendoneonamild,surfacelevel. I figured some this out on my own around 19992000 or so, after having experienced my moms rapid and unstable personas switches asateen,aswellashearingmybrothersstory,andthenobservingmy then boyfriend Steve, as well as my own self, only to stumble onto corroborating data several years later in an article by Gunther Rassbacherthatbackedupthetentativetheory.Fromtheonlinearticle Operation Open Eyes: Mind Control in America Five Easy Steps to Create a Manchurian Candidate by Rassbacher (bolded words my ownemphasis):

The next step is Level 3 hypnosis, where the subject will become an overwrite upon his own personality. An overwrite is a new identity or personality. Itis similarto having multiple personalities, except the original personality is repressed or hidden under the overwrite and will not surface for a set period of time which is determinedbytheProgrammer.

Theoverwriteisnotacompletenewidentity.

While I have yet to know somebody who exhibited individualized split personalities to a severe extent, I have on the other hand, witnessed the concept of multiple personas, or maybe an overwrite, as itscalledintheaboveexcerpt.Ihavealsoseenthesepeopleassignan alternate moniker to themselves that they like to occasionally go by,

Part III Expanded Insights

175

and sometimes would use that name in lieu of their given namebut yet, while still retaining full memory and recognition of their real self. (have also read of a number of famous people that I suspect of being mind controlled who do this as well, casually talking about their variousalteregoswhohavetheirownnames.) My brother (back when he was alive) had his alterego, Shawn Hill, and mentioned a couple of incidents back when he lived in Connecticut where petty criminal stuff happened, and it seemed like he probably did it as Shawn Hill buuuuthe couldnt remember doing itnecessarily. It seemed like he had a vague recollection of being there and doing those things, but, it was so hazy Talking to him on the phone back in 1998 or 1999, he told me that he didnt want to be called Joe anymore. He wanted to be called Shawn. His new name was Shawn Hill. I laughed nervously, like, Ohhhkay. Well, ImnotgoingtocallyouShawn.YoureJoetome.YournameisJoe. His whole demeanor during that call was short and brusque, and he was even less amused by my refusal to acknowledge this overwrite persona named ShawnHill. But notice that henever lostawareness of Joe. Even though he was in Shawn Hill character, he still knew full well who Joe was, and Joe, when being Joe, was fully aware that there was this Shawn Hill running around doing things he could only vaguely remember. Thats not true multiple personality disorder. But its definitely something. And multiple personas, or personality overwritesseemlikeagoodwayofexplainingit. And my exboyfriend that I mentioned, (whose dad happened to be former NSA) also had an alternate name that hed occasionally use forhimself,Scott.Whenwewereoutinpublichedgivehisnameas Scott.Itnever struckme asbeing anything tooweird,justsomefunny thing he liked to do. But, then there was the fact that he experienced memory black outs where entire chunks of things he did, conversations hed had, were gone. It was like he may as well have never done those things. And then the most telling incident that I witnessed with him occurred three years into the relationship (when therelationshipwasdeadanyway)andtippedmeoffthattherewasan issue, and it was when he split off in midconversation. One second we were having a light hearted exchange, the nexthis face changed, went blank. Not only did he not remember what hed just said a second earlier, but he completely denied even having the entire conversation wed just been having. Even me rehashing the entire

176

Chasing Phantoms

conversation Okay, you said this, then I said that, then you said this then I said that! did nothing to jog his memory. I didnt react well to it all, lets just put it that way. When I had to ask him, Whatdo you have like, multiple personalities or something?!? then I kind of knew. If you even haveto ask that question, then it means somethin is goingon. Yet, I dont believe these incidents can be classified as full fledged multiple personality disorder, because it wasnt like I would come home one day and try to talk to my brother, or thenboyfriend, only to have them pull a crazy and tell me Joe isnt here right now... Or Whos Steve?? Im ScottI dont know who Steve is. meanwhile, as they believe they really are their alterego. You hear about that sort ofthinghappeningtopeoplethough. Later on after I moved my brother out to California to come live with me and Steve, we were talking about his Joe/Shawn thing, and I mentioned my suspicions to him about Steve. He responded with a big grin and said, Yeah, you didnt know that? I noticed it the first weekIwashere! !! Yes, I guess I did miss the signs, what can I say. Joe claimed that he watched Steve switch during one of their conversations Steves expression changed, like he was suddenly switching personalities, or coming toand Joe could tell that Steve didnt recognize what was going on. Supposedly Steve had an oh shit look on his face, and justplayeditoffsoastonotattractattentiontothesituation. My own situation is a weird one. Back in 1996, when I was 2122, long before I knew that I was an abductee and had definitely never heard of government/military abductions and the subject of mind control, I awoke one morning and clearly heard in my mind a male voice saying with big eye rolling disdainful sarcasm, You have so manypersonalitiesyoucantevenkeepup. !!! What??!? I thought to myself. Where did that come from? It couldnt be a dream for starters there were no visuals, just a male voice. And why would I dream something like that anyway? I wondered. It wasnt true. So it didnt make much sense. Now of course, I know about MILABs, programming, the human males that areinvolvedinmineandthewaytheysound(almostalwayswiththat same sarcasm), mind control, compartmentalization, split off personas andthelike,andsoitallmakesperfectsense.

Part III Expanded Insights

177

Then there was another REALLY anomalous incident that happened in 2002. Ill reprint the incident from my log book. Excuse the language, but, this is exactly what went through my mind, and theres no way to censor that in order to appease sensitive types and yet still accurately represent what happened. If anything, the cussing and the attitude is the exact point Im trying to make here, as youll see:

November4,2002

Iwasstandingattheprinter[atwork]waitingformystufftocomeoff and I was staring out the window at the blue sky and the sunny day andthetrees.Happenedtodirectmyattentionbackinsidearoundthe office itself. Next thing I know, I temporarily woke up. Either that, or some sort of program kicked in prematurely that wasnt supposed to. I felt like I emerged from a zombielike state of trance tolerance, where normally I walk around in an amnesialike state, tolerating having to work and pay bills and come to this place called C_______ Management,dayinanddayout,andbewiththese people,doingthe jobthatIdo,puttingupwiththecrapIdo.

All that changed. The amnesia lifted, and I had this realization about WHO I AM. And I was looking around the office thinking, WHAT THE FUCK AM I DOING HERE??!?!!? It wasnt like I couldnt rememberwhoIwas,orwhereIwas,orwhyIwasthere.Itwasquite the opposite, in fact. I knew EXACTLY who I was, and I was like, oh my GOD..what the FUCK am I doing HERE?!!?!? Like, were talking about ME here!!!!! ME!!!!!!!! What am I doing HERE?!?!?!?!? Its not like I didnt recognize the place. I knew it was C_____. I knew it was my work. I just couldnt believe that I was willingly coming here every day wasting 8 hours of my life, every day, HERE. At THIS place. It was almost like, Oh, while you were sleeping, this iswhatyouvebeendoingwithyourself..Thatwhole,Whileyou were sleeping deal. And when I realized what Id been doing with myself,Iwasshockedandappalledandhorrified.

And then I slipped back under the water, and the feeling was gone. All I had left was the intellectual knowing/memory that it had happened,butthemindsetitself,thatpersonality,wasgone.

178

Chasing Phantoms

Whats not mentioned in my log book entry is what would have happenedhadthisrealizationaboutWHOIAMnotgoneaway,hadit not slipped back under the waves. The personality was aggressive, and had zero tolerance for the mainstream world. None, period. It would not have stayed at work, and it would not have continued living a normal life.going home to the apartment, laying around with the boyfriend, maybe reading, doing some article writing, doing internet research, watching a movie, sleeping, eating, paying bills, and more work at the stupid $10 an hour job. Repeat every day, on and on. Oh no, I dont think so. ;) Not hardly. Now, it wouldnt have beenviolent, I didnt get thatfeeling,butitwouldnthavebeenableto tolerate doing any aspect of the mainstream normal life that we all do everyday. There are two main explanations for what happened here. The first, which is the one I wanted it to be, is that this awakening was spiritual in nature, the spiritual/incarnation amnesia lifting and suddenly remembering, if only for one brief shining moment in time, WHOIAM. Of course that doesnt explain the cussing and negative, male, aggressive attitude. That personality was anything but spiritual. Ive connected to my higher self, and lets just say that the discrepancy between that personality which emerged accidentally while I was at work, and my Higher Selfs emotionally detached, yet totally empathetic,wiseandunderstandingnatureisprettyglaring.Itsnight andday. So, after several years ofclinging on to the idea that this accidental personality emergence was the spiritual veil lifting, as pleasant and fluffy as that sounds, Ive had to settle on it being an alternate, compartmentalized multiple persona that somehow, someway, was triggeredandpoppedoutwhenitshouldnthave.Becauseletsfaceit, Ive connected to my higher self, I now have that basis of comparison, and these two are totally different. But what cemented it was how recently Ive been reading the works of several mind control women whovewrittenabouttheirstories,describingtheirvariousalters.One of them in particular, Kathleen Sullivan, author of Unshackled, supposedly had several very aggressive male personas that were created to do down and dirty work, high stress assignments for her handler thems. These guy alters were all aggressive business, designed and trained to wield guns and take people out and live in a

Part III Expanded Insights

179

world that was completely removed from her normal every day core self who went to work, earned money, paid her bills, watched TV, hung with her husband, cleaned her house, etc. Im not saying thats whatmyownalterwascreatedfor,butitwasveryaggressive,andfelt male in nature. Ive pendulum dowsed it and got each time that this personality emergence was a compartmentalized alter popping out, not spiritual amnesia lifting. In fact, the whole, Who I Am thing wouldnt even be an accurate description to describe the mindset, it wasmorelikeanothersideofmeemergingthatsnormallydormant. So while Ive never been like Joe or Steve, and have never flipped anddone180sasquickly(andscarily)asmymomcouldanddid,andI dont have two mes and experience black out periods like my dad does (which I get into in the Appendix http://www.in2worlds.net/abductions) unfortunately as the years have gone on Ive noticed what I consider to be persona instability. And I dont like it. I feel like there are multiple sides of me, who have multipleconflictingviewsandattitudesandendupcontradictingeach other. I can feel myself shifting around but is it just normal mood shifting? I dont know. If Im conscious of it, it means its not a split off persona. Theres never a complete amnesiac break. Even with the abovementionedincidentatworkin2002IstillknewwhoandwhereI was. But Ive never adopted an alternate name for myself the way programmed multiples often will, and in fact Im adamantly against that. Im Carissa. Period. I wont even tolerate a nickname, even when people have tried to give me one. And Ive never experienced blackoutperiods,norhaveIeverbeenconfrontedwithaconversation or situation where I was apparently there, but yet, have no memory of it. Thankfully! That to me is where the line is drawn. Up until that point theres a suspicious issue occurring, but its not serious. When you cross over into black out periods and alternate names, then youre in trouble! My own situation is apart from my family, because Ive nevercarriedonthewaytheyhave,takingthingstothatextent.Ithink a persons frequency determines how unstable theyll behave. Both of my parents had very low frequencies, as did my brother either emotionally volatile, and/or extremely depressed and angry so their issueswereQUITEnoticeable;ontheotherhand,Stevealwaystriedto be as emotionally neutral, stable and balanced as possible, (Libra sun/moon,gofigure;))soquitefittingly,hisproblemswentrelatively unnoticed.

180

Chasing Phantoms

But the reason that this can go undetected for so long with some peopleisbecausethekeyliesinitssubtlety.Peoplearelookingforthe BIG and DRAMATIC and EXAGGERATED, the way it goes in the movies.ButreallifeisntgoingtobelikethemovieSybil. Im willing to bet the issue of multiple personas as a side effect of mind control programming is more common in society then we think. Whenyoutakeintoconsiderationhowmanymilitaryandgovernment agency personnel there are out there, both active and retiredand their familiesas well as the number of Hollyweird performers and entertainers, models, singers and television personalities; politicians, corporatebigwigs,politicalauthorsandotherhighprofilepeoplewith huge influence; inmates, juvenile throwaways, sex industry workers and runaways; New Age and religious gurus, and the alternative health, healing and metaphysics arenathats a hell of a lot of people. And those are all the prime target candidates, according to the research. Main targets are people who are front and center of all majorareasinoursocietythatwouldservetodistractusand/orsteer usdownthewrongpath,aswellassocietysthrowaways,rejectsand lost souls who are exploited simply because they can be. However, many of these people still need to function in society and have their double lives, which means their programming needs to be relatively seamless. So subtly is imperative, as mentioned. Which means most ofthetime,thingswillgoundetectedandmostofsocietywillcontinue toremainunawarethatthisishappening. Residual Talents and Abilities

Something I began noticing about myself in my early twenties was my unusual, to the point of being freakish, lightning fast reflexes. I dontrecallhavingthoseabilitiesasakid, butIsurehadthemnow.It became evident during one particular incident at 21, while I was roommates with a group of friends who were in my life for several years. We were all in the kitchen, and I turned and accidentally knockedatallglassoffthecounterwithmyleftelbow.Isawithappen outofthe cornerofmyeye,butbeforeIevenknew whatIwasdoingI bent down a little and swooped my right hand behind my backand caught the glass in midair behind me without looking. It was one smooth and continuous move, from knocking to bending to catching,

Part III Expanded Insights

181

and I had no control over doing it. My arms and hands hada mind of theirown. Theroombecamesilent,andIlookedupwiththeglassinmyhand to see three of my roommates just staring at me with looks of shocked puzzlement. I put it back on the counter, and one of the guys, Mike, said Wow. Thats all anybody could say. Conversation resumed a littlenervously. And that was my introduction into a skill I have absolutely no control over. Like the time at the pizza parlor in Fort Lauderdale where my boyfriend and I were studying a menu at the counter, and my left arm suddenly shot out to catch a falling menu in midair; my conscious mind didnt even realize it was falling until after my hand had already caught it and carefully placed it back on the counter top. The guy behind the counter looked at me with wide eyes and said whoa. And recently standing next to my bookshelf reading a book andmyrightarmshotouttocatchtheheavybookendandpushallthe toppling books back on the shelf conscious mind had to catch up once again with what my reflexes involuntarily did. And the many times Ive dropped something Id been holding and one of my hands involuntarily forms a perfect little scoop shape and positions itself under the falling object to catch it. I can feel my mind shutting off as someotherparttakesoveranddoesthis.Itsbizarre. All of which has led me to question my other unusual skills and abilities. In the original writing of this book I left this section out, but now I feel that was a mistake. Its in my theory that people who are being taken and programmed, whose brains are being effectively rewired, are going to find themselves with some unusual residual talentsandspecial enhancedabilitiesthatnormalpeopledonthave. And this needs to be mentioned, because it canbeanother marker that confirms something funny going on under the radar of our normal waking reality. So to illustrate, Ill list a sampling of my own abilities, andmaybethereaderwillbeabletorelateinsomeway:

Lightning fast reflexes, as mentioned above. Most notably is the fact that I have no control over it. I cant override it. I happen to berighthanded,butthisgoesforbothhands,leftincluded,which is interesting. Complete ambidextrousness in that regard. Something that reinforced to me that this skill is indeed indicative of stuff was the movie Mr. And Mrs. Smithfunny enough.

182

Chasing Phantoms

IonlyjustwatchedthismovieinSeptemberof2007,aboutabored married couple who soon discover that the other is a special ops agent.BradPittscharacteris99%convincedthathiswife,played by Angelina Jolie, is an agent like himself, and he tests her by purposelydroppingawinebottleafterrefillingherglass.Without any conscious control, her left arm automatically shoots out and catches the bottle in midair, something that normal people dont do I guess. So, now his character knows for certain. I only just watched this and was like !!! when I saw that using reflexes as the ultimate test to determine whether someone is an agent with training. And then on a minor note, in the movie V For Vendetta the main character V, who happens to have unusual blood properties (unusual bloodline) is the target of a governmentsponsored experimentation program which results in him developing a new alter ego and some pretty impressive skills including heightened intellectual capabilities, and lightning fast reflexes.

On a minor related note is that somewhere along the line in life I becameambidextrous.TothepointwherewhenIwaswaitressing at one particular job, my boss was watching me in action and said Oh! Youre a lefty! pleased to find a fellow south paw. I looked at him like he was nuts. Sorry, Im right handed. He promptly disagreed, and pointed out that I was working left handed. Another time I was playing Ms. Pac Man at a Laundromat and was intensely playing along, and doing very welluntil I looked downandnoticedthatIhadbeenworkingthejoysticklefthanded thewholetime.Itfeltlikemyrighttome,therewasnodifference. But the second I became conscious of it I wasnt able to do it anymoreandgoteatenbyaghost.:D

Very psychic. Have demonstrated all of the following at some point in my life: telepathy with both humans and animals, precognition/premonitions, clairvoyance, remote viewing, telekinesis by accident once or twice, and some pretty extreme reality manipulation/creation skills, as well as just overall knowing/sensing whats coming up down the pike in life so theresnosurprises.

Audio recognition. Can recognize a song within sometimes one note, backwards as well. Won a radio contest at 13 for being able torecognizetwonotesplayedbackwardsofthe60ssong,ICant

Part III Expanded Insights

183

Help Myself. (The Four Tops.) I was the only one who called in. Nobody else recognized it. And when listening to my boyfriend play around on his guitarfor every chord and every group of notes or sound effects he does with his amp, Im matching up in my mind what songs have used those exact chords and notes and effects. ;D Its impossible for me to justhear the notes ina neutral waywithoutmymindmentallyplacingthemtoothersongs,likea computer, matching things up. One time when pondering out loud my audio recognition abilities I received a prominent ear toneinmyrightearatthatexactmoment,asifconfirmingit.

Unusually good memory. The ability more so when I was younger though to remember names, dates, birthdays, addresses, drivers license/plate numbers/vehicle info., and all manner of data and trivia and life happenings in general, including conversations. It really did stand out amongst the people I was around, and became known at one particular job I temped at in 97 as a file clerk. There were over 30 cabinet drawerswithovera100filesperdrawer,aswellasvariousToBe Filed baskets, and files strewn on peoples desks and everywhere.Butitsoonbecameknownthatifyoucouldntfinda fileinthedrawer,justaskmeIllknowwhereitisoffthetopoff my head. Its in the basketon soandsos deskon top of the cabinet The psychologists would come up to me and toss outa patients name, skeptical that I could possibly knowand I alwaysdid.Soontheycametoexpectitasagiven.;)

This is also why I was such a great memorize and regurgitate robot machine in school. In high school Id wait until the last day before a test sometimes within only hours before and then learntheentiretwoweekslessonandgetanAorB.Didntpay attention to Biology class all of second semester in 10th grade in Connecticut,andlearnedallfivemonthsmaterialintwodaysand got the highest score in the class on the final. Shocked even me. Took tests on books I never readand passed. Id recall details about the books that I heard during class discussionin the background, while I did other more important things like read myownbooksthatIwantedtoread.;)

And there was one freak incident that occurred in 1997 when I was23andworkedasawaitressatoneofmyjobsIwasonall week and couldnt forget anything if I tried. I spent the entire

184

Chasing Phantoms

week manically amped up getting hardly any sleep every night as if I was bipolar or something, which Im not. I could remember every last little thing that every table Id waited on from the Sunday before had orderedthen realized I could remember everything in general about everything that had happened all week. It was maddening, and I found myself sitting on the floor of the living room at like 2:30 a.m. with my roommates, swigging cheap wine straight from the bottle trying to come down to a normallevelsoIcouldgetsomesleepandstopthiscraziness.

Compartmentalized mind. Have a compartmentalized mind thats demonstrated that it can do its own thing, and seems to operateseparately,almostlikeacomputer.InthepastIvesolved mathstuff,orfiguredthingsoutseparatelyfromthemainbrain, andthenfedmetheanswerwhenitwasdone.

Tying into the above two is the compartmentalized computer mind in general. I can get into a frame of mind where its like another part of my brain takes over, like when playing video games, and is able to perform in a way that I cant in my normal state of consciousness. One time when I was22 andat the movies with a friend named James in California, I was playing one of those Simon memory arcade games in the lobbyand I slipped into that compartmentalized state of mind and was able to keep going and going and going, perfectly playing back longer and longer strings of the color tones. My eyes were glazed over and I felt detached from myself, it was some other part of my brain that was playing. Finally James said, Damn, girl!!! freaked out. Hearing that pulled me out of it, and I messed up and the game was over. I had made it up to about 25 tones, and if James hadnt saidanythingthanwhoknowshowlongIcouldvegoneonfor.

What it all means, Im not sure, but it seems to be indicative of something. I think people can be, and most likely are, tinkered with during their abductions and programming. Brains are upgraded, people will find themselves with skills they didnt used to have, and some of it may even be the natural byproduct of other things that theyre being used for. As noted in the section regarding the after effects of being taken, finding oneself with increased psychic abilities outofnowherelastingforuptoseveraldaysinarowmaybeanatural byproduct of the abduction process in itselffor whatever reason. I

Part III Expanded Insights

185

dontprofesstounderstandwhythis is.Butthatincidentin97when I was a waitress and was amped up and wired all week with the inability to forget anything, even the most trivial details, also seems to be indicative of having been taken and used for something. Possibly mybodyandmindseemedunabletoadjustandcomebackdown,and Iremainedinaheightenedstateforsometimeafterwards. For myself, I noticed a definitive change, or at least another subtle level of change, occurring around the age of 2223, in 1997. Thats when my brain seemed to suddenly become smarter and much, MUCH more clear all the time, versus only during those select times when I needed it, like in school. Its also when I first noticed my inadvertent lightning fast reflexes. It all came in handy I must say at my jobs. As a waitress I could now take orders without having to writethemdown,(whichhelpsboostyourtips;)thatreallyseemsto impress people). And in 99 when I was working at an executive suites, answering the switchboard for up to 48 different companies, it also paid off. There were times when Id be answering multiple calls for 3348 companies on the tenline system using a headset, (which very frequently meant having no less than ten calls at a time on hold that youd have to work your way through, then put another ten on hold,andanother) andhavingeverysinglefour digitextensionand every four digit voicemail memorized, along with the whereabouts of every person I answered phones for off the top off my head so I wouldnt have to stop and refer to my sheet..and during one particular time period while simultaneously doing data entry side projectsatthesametimeasansweringthephone,typing(atthatpoint) 65wpm/10,000+keystrokesperhour.Allfor$9.00anhour.Theysure got their moneys worth with me. Its all very reminiscent though of my dads unusual performance in the Navy of translating Morse codeintotypeatsomethinglike8090+wpm,amonghis otherabilities whichIgetintointheAppendix.http://www.in2worlds.net/abductions Maybe there was a biological/nutritional reason for this, but I kind of doubt it. It just seems to me that I was upgraded. I was always smart..but never THAT good. As with my dad, it was like the potential and foundation was there, and then maybe something came alongandtweakedthingsabit.Factoringintheroundaboutindicators of abductions occurring in my early 20s, (despite the fact that I didnt even know about the topic) and these talents and skills definitely seem suspect in retrospect. Although Ive certainly met people who

186

Chasing Phantoms

blow me out of the water in terms of what theyre able to do psychic abilities that are to be reckoned with, true photographic memory all the time, stuff thats pretty freaky and probably naturalborn, not a result of having been tinkered with. But still, I mention this in case it mayberingsabellforsomebodyreadingthis. Physical and Spiritual Isolation of Targets

Isolation and relationship interference

When doing the research, I came across something interesting that really stood out for me it was the concept of keeping a mind controlled subject isolated in life. As somebody whose life theme for the longest time seemed to be about isolation, which I get more into in the Appendix, I really sat up and took notice of this. Its important enough to be mentioned here in this piece only because isolation can be extremely detrimental for a programmed person. We NEED other (quality)peopleinourlives,iffornootherreasonthantohelpkeepan eyeonusandmakesureweredoingokay. Keeping a target isolated from friends and family, in a situation where theyre living alone, means the programmers/abductors will haveunlimitedaccessandwillexperiencelittleifanyinterferencewith their activities. An isolated abduction/mind control target is one that hasnochecks andbalancessystemin theirlife.Self awarenessoftheir abduction situation certainly helps, but sometimes we just cant pull ourselves out of a programmed funk on our own, or might not be able to override certain programming urges. So having people around us that we can talk to or who can get us to snap out of it is necessary. And if theyre people who are aware and on the level regarding abductionsandmindcontrol,thenitsevenbetter. Asmentioned,myownlifehadbeennothingbutavariationonthe isolationthemeforthelongesttimeandIcanthelpbutnoticehowthis probably has enabled much of the abductions and programming that maynothavehappenedotherwise.Ihaveonlymet ahandfulofother people in life that have been as cut off as I have been from family and normal friendships and normal relationships, and who were as completelyindependent,startingatsuchayoungage.

Part III Expanded Insights

187

The excerpt that I came across which first brought this issue to light for me was the following, from Secret, Dont Tell by Carla Emery, discussing the case of Candy Jones, and which was actually an excerptfromanothersourcebeingquoted:

The first stage of any mindcontrol program involves isolation from family and friends while the foundation programming is implanted. After that, a more permanent form of isolation is built in: talk frankly only with us; stay away from them. Jensen and Burger also programmed in harsh prejudices for the purpose of alienating Candy from all definable groups of people. Jensens flat nofriends rule dealt with the rest. The mindcontroller wanted her to be a self sufficient loner who avoided people and avoided relationships becauseCandysaidmostofthemwouldntunderstandwhatIwas doing.Icouldnttaketherisk.(Bain,page141.)

A selfsufficient loner who avoided peoplethat was and is definitely me. By the time I was 19, my favorite phrase was Its just me, myself and me in this world. Theres nobody else in this world that can help me. Im on my own. I have no safety net in life. I have to take care of myself, because nobody else willand nobody else cares. That was my philosophy, for years. It developed for a good reason, because events had conspired to make this the case. But even when I did have people around me who cared, and this wasnt necessarily the case, I still had this in my head. Also, considering that my entire immediate family has major signs of being abducted and tamperedwith,itsprobablynoaccidentthatthingswentthisway. AnotherexcerptfromSecret,DontTell:

At their wedding, [Candy Jones] long years of CIAconditioned isolationwereobvious.LongJohnhadfortyguests.Candyhadnone, except her mother and the attendant who looked after her. Donald Bain, Nebels friend and biographer, noticed that, and thought it strange.page72.

That would so be me in the event I were to ever get married. ;) Except I wouldnt even have my mother. It would just be me, myself and me. I used to say to myself that even if I did ever decide to get married for some reason.how I can have a wedding when theres nobody to invite! And the same goes for deathbecause there were

188

Chasing Phantoms

long stretches in my life where I was living alone, with no family around, no boyfriend/husband, and no friends or acquaintances, (or else renting a room from strangers who also wouldnt realize right away that I was gone or miss me) I realized it would be a precarious situation were I to die in a car crash or something. Nobody would know I was gone or miss me. There would be nobody to claim the body.So,bettermakesureIdontdieprematurely! In the case of Candy Jones, it was her CIA controllers giving her programming commands to ensure that she didnt pursue friendships and relationships and kept herself isolated from others in life, but its notalwayshumangovernmentagentthemsthatdothis.Thisisalso something implemented by hyperdimensional aliens, entities, hybrids, whatever the case may be. And it would be done not only through abduction programming, but through manipulation of the people around the abductee, since thats what higher realm entities are capable of. Put the spotlight on both the abductee and those closest to them, working everybody equally until something eventually gives. Friendshipandrelationshipinterferencegohandinhandwithbeing anabductee.Those timesyoudofindyourselfconnectingtosomeone in life may be met with all sorts of bizarre happenings to keep you apart and derail the situation. Author Eve Lorgen wrote about this in depth in her bookThe Alien Love Bite Alien Interference inHuman Love Relationships. http://www.alienlovebite.com/ In the case of the alien love bite scenario, the purpose seems to be twofold to interfere for the sake of keeping people apart, and also to feed on the extreme emotions that would be involved in such love relationships goneawry. Isolating a high mark target is imperative if you plan to be abducting them on a regular basis get them alone so they can be taken more frequently, and without as much interference. Its also important if you just want to take them out of the picture ingeneral. Get them spiraling down into loneliness, alienation and despondencythat should do the trick, so they think. Its a very successful tactic, and seems to work on mostbut its never foolproof. Especially if the people involved have awareness about these sorts of things.Awarenessiseverything.

Part III Expanded Insights

189

There is no God/severing spiritual connections

Weve all heard of people whove been programmed into becoming religious fanatics, aka bible thumpers, and the even more extreme example of brainwashed religious cults, but what about the flip side of this? Cutting a target off from spirituality? Ive seen this mentioned here and there in my research, with regards to getting a target to believe that either God hates them, or that there simply is no God. If a target believes that God hates them, or if you can get the target angry at God, then according to mind control author Fritz Springmeier, You can get that person to commit any sin. And if a target believes there is no God, or anything spiritual for that matter, then theres no greater spiritual hope for them to cling to, nothing to get them through trying timesnothing to fuel selfempowerment when theyre being worked over by their handlers and programming. All of which is mucho bueno when trying to isolate and destroy a target, or program them to commit criminal acts in the vein of agent provocateur work, assassinations, terrorist activity, and so on. Spirituality often equals hope and empowerment. It can be a lifeline, and a weapon against the negs for any target who would try to fight back and resist whats happening to them. They do not wantthat. I found this particular aspect of MILABS to be interesting, only because I believe that I experienced a variation on this, which cant be dismissed. My aforementioned ex with the mind compartmentalization and the NSA dad, was also a diehard Atheist and skeptic who seemed bent on getting me to convert to Atheism, to thepointwhereitbecameapparentattheendoftherelationshipthatit had been a mission of sorts for him. Steves philosophy, which he statedand stated oftenwas that There is no soul, were all just pieces of meat, when we die its lights out, thats it, there is no God, there is no afterlife, were all just pieces of meat, when we die itslightsout,thatsit,thereisnoYougettheidea. What Stevehad was a script. A glossy eyed, trancelike script that he would endlessly repeat during the three years we were together, and the year and a half as roommates before that, in order to convert me to being Atheist, and then reinforce the mindset. He was also a diehard skeptic, and refused to believe in anything to do with psychic abilities, the paranormal, and so on, and made sure to work on me to

190

Chasing Phantoms

trytogetmetostopbelievinginthatstuffaswell.Thetotalironywas, he had past experiences with the paranormal, and could even read minds, but refused to admit what he was doing. ;) He turned his back and adamantly refused to acknowledge any of it, to the point of extreme,illogicalabsurdity. All of this became apparent to me by the end of the relationship, after Id already began to notice the multiple personas issue. I was standing before him in the hallway one night, hearing THE SCRIPT for the millionth time in almost five years, and I noticed for the first timehiscompletelyglazedovereyesthatwerentevenseeingmeashe spoke. And his robotic, trancelike state that seemed to be rehashing somethingthathehadmemorized.Ihadtheclearanddistinctthought of Hes trying so hard to convince me that there is no God and no soul..thenitmustmeanthereis.Hescompletelyfullofshit. AndIsilentlywalkedaroundhimandaway,andlefthimstanding there in the hall, literally, talking to the wall. After wed officially broken up, the only thing he could come up with to complain about, his one big peeve, was And you were never really an Atheist. That was it. His face twisted with disdain when he said that, surprising me, due to his usual emotional neutrality about all things. He seemed to feel genuine disgust for this supposed indiscretion of mine! It was all very puzzling for me at the time, like.huh? I of course did not know about MILABs, mind control, nor my own status as an abductee at that time, but in retrospect it seems that he could very well have been taken and programmed by something else and used to work me over. And considering his familys background and his multiple personas issues and whats apparently happened to me it makes him all the more suspect for such doings. So cutting targets off from spirituality seems to be a very real facet of it all, because spirituality, along with a connection to higher positive forces and havingthespiritualbiggerpictureisourultimateweapon.(Andlest I sound like Im coming across as a victim I definitely take full responsibility for any people whove been in my life and the choices Ivemadeinkeepingthemaroundlongaftertheydhittheirexpiration date!Programmingornot,westillhavefreewillandtheabilitytopull ourselvesoutofasituation.So,justtoclarifythatIdontpresentthese personalized examples in order to paint myself as a sympathetic victim.Therearenovictimsinthisworld.)

Part III Expanded Insights

191

Discovering Abduction Schedules

If youre dealing with military abductions, or the joint alien/military affair, then there will most likely be a pattern to when youre being taken. And it seems that they will operate on that schedule for as long as they can, until you discover it and begin throwingawrenchintheworks. Because so many things had begun happening to me by 2002 I started keeping a log book to document my stuff, as well as diligently photographing the mysterious nickelshaped round dark purple bruises that were periodically appearing on my legs. I hadnt figured anything out yet, and it was a bit frustrating, but I plugged away with itallnonethelessinhopesthatsomeday,answerswouldcome. ThenonedayinAprilof2003,Ifiguredsomethingout.Inflipping through various photos of the nickelsized bruises, I really noticed for the first time the dates on the back of each photo. All of the photos were taken either between the 1st and 3rd of each month, or the 20th 23rd. !! I couldnt believe I hadnt noticed this before. Amazing. This wasntrandomchaos!Thisiswhyitsimperativetologanddocument your stuff. Over time, with enough materials gathered, you will discover the patterns and meanings. But you have to be patient enough to wait for the materials to accumulate. It wont happen overnight. This realization was so revelatory that I had to pause and take a moment to regroup. I closed my eyes andaddressed my higher self. I started talking to it, saying, Okay Higher Self, me in the future, it looks like I found a pattern to the abductions. Tell me what Im supp. Itsabouttime!cametheresponse,interrupting. Not in a sarcastic way, but rather in an urgent dont stop now! sort of way. The voice was like my own, so, it was differentiated from the outside microwave voice beaming technology mentioned in Part II where the voices were male, and clearly not connected to me. The thought behind what the higher self voice was conveying was Keep going!Keepmoving,dontslack.Youfoundthepattern,sodontstop now...IstartedLAUGHINGthough,shakingmyheadaboutitall.It wasjusttoofunnyhowitcutmeofflikethat,allurgent. There are a few possible reasons for why they might utilize a regularschedule:

192

Chasing Phantoms

Possibly theyre taking so many people that it has to be an organized affair. The military/black ops agencies would want things to be as organizedandefficientaspossible.

May coincide with the targets personal biological cycles; Certain times of the month may be more opportune for snagging somebody based on the purposes theyre being taken for. On a lesser note, possibly moon cycles, biorhythm cycles, womens monthly cycles, etc. andsoon.Somethingtodowithsomesortofcycle.

Maybe theres some unknown variable, something pertaining to whatevers going on in their realm, that makes it so that they can only takepeopleatcertaintimes.

Throwing a wrench in the works was just mentioned a moment ago.Whatdoesthatentail? It means exactly thatfoiling their efforts to take you. What I came to discover was that my mysterious bruise markings were appearing on a regular schedule, and that during those times of the month I had an increase in number sightings and ear tones, indicating that something was amiss. There was hyperdimensional forewarning,youcouldsay.AndIbeganthinkingofthatasmyheads up,andusedittomyadvantage.Onthosenightswhenitseemedstuff might happenmy boyfriend and I stayed up all night. I would go to workonminimaltonosleep,andweddowntheFrapuccinosandRed Bulls to keep us awake. Or wed take stuff to read and go hang out at Dennys for several hours in the middle of the night, eating food and drinking coffee and reading good books, during the prime time that theydbe (trying) totakeme/us.Or,IdjuststayupaslongasIcould, andthenconkoutforthelasttwohoursbeforemyalarmwassettogo off while my boyfriend kept watch. Hes nocturnal anyway, so it was normal for him to be up during the night and to go to bed at around 6 a.m.orso,whichcertainlyhelped.Somepeoplewillclaimthatstaying up will do nothing to thwart them. I disagree. Thats defeatist. Especiallyifyouleaveyourhomeandgoelsewhere,andevenmoreso when you go to a public place. You have to at least try. You cant justgobellyup. I didnt mind any of it though, all the dodging and outrunning abductions, losing sleep and all that, mostly because we lived in South Florida, and the year round summer weather and close proximity to

Part III Expanded Insights

193

the beach meant everything had a fun vibe to it. It was perpetual summer vacation. My job required no brain power, so it was cool if I went in on no sleep I didnt need it anyway and life in general just didnthavethatoppressivefeelthatyoufindelsewhereinthecountry. Its hard to get depressed and feel dragged down when you have an easy job, theres no winter, and outside your front door theres palm fronds rustling in the breeze and you can literally, be sipping a Pina ColadaonthebeachofftheA1Athenextday.Translation=whenyou live where others come to vacation. So everything was already light hearted and felt like a game, and this was just one more aspect of the game. Having that outlook really helped matters too, in retrospect. Its ALL about your personal frequency, as I outlined in the section regarding Fear. And when youre not afraid, and are just facing the situation head on, just doing what you gotta do, and maybe even getting a slight kick out of it ;) having fun, it turns the tables on the outcome. Once I began throwing a wrench in the works enough times and made it difficult for them to adhere to any sort of set schedule, then I had the experience, as mentioned in Part II, where I woke up to hear a mans voice pulling me out what felt like a deep, trancelike state, saying 14141 as if it were some trigger code. It felt like I had been looking at something for him before he pulled me out of it. (Remote viewing?) But then another female voice cut in on the line you could say, (higher self?) to inform me in an urgent, FYIsounding way that They now have the ability to use you without actually takingyou.Viatheimplants,mostlikely. But hearing that definitely threw a wrench in MY works. It seems that with MILABS, their preferred method is to take somebody physically, but if they have to then sure, theyll resort to Plan B, and use them remotely. Possibly its not as effective, but, it gets the job done. Whatever the job is, I dont know. To this day I still have no idea whats going on and how it all works. I can only theorize. But talk about making me feel hopeless. Whats the point of outrunning them if theyre just going to plug into me while I sleep? So I gave up. At that time, I just didnt know how I could possibly side step somebodypluggingintomewhileIsleep,seamlesslymergingwithme so I dont even know it and just perform for them like a good little monkey. If thats whats indeed happening. So for about a year and a half I took the blue pill, and slipped back below the waves. It just got

194

Chasing Phantoms

so tiresome always being on the run from something when I didnt even know who or what I was running from, or what was actually goingon.Andtoadegree,thatsstillmyattitude. Now however, at this point I think there are ways you can side step it. But it requires much more work then just staying up all night anddrinkingRedBulls.Astheirtacticsareampedup,whentheystart resorting to their Plan Bs and Plan Cs, then the effort we have to put in as a counter defense will also go up. One major countertactic would involve lucid dreaming skills. When you become adept at being conscious while sleeping, then its possible youll be more sensitive to any attempts at intrusion that may occur. Which ultimatelymeans,wecanfightback.Itisntentirelyhopeless. Figure out your abduction schedule, if there is one. Dodge the physical abductions if you can. And in the event that they plug into you via your implants, gain the upper hand by practicing lucid dreaming and taking control of your sleep state. There has to be ways to program your own mind to alert yourself in the event that something is trying to plug into youwhile you sleep. Connect to your higher powers for any additional feedback and insight and help you can glean about it all. And always keep your frequency up. Dont get despondentaboutitall,itsnotworthit.Thinkofitasagame,andjust havefunwithit. Sabotaging Programming Commands In Part II I mentioned several instances of waking up and catching them in the middle of programming me while I slept. You will onlyseewhatswronganduglyintheworld!!andsoon.ImagineifI hadnt woken up and caught them in midsentencethen what?? Evenwiththeawarenessofthiscommand,Istillfoundmyselfslipping into that mindset during the time period when this occurred. It was a slumpIhadtopullmyselfoutof.Thinkofhowmanypeoplemaybe receiving these types of commands while they sleep and dont catch them, or, during abductions and dont remember them. How many others have I received that I didnt catch? How many are planted within my subconscious as I type this? For that reason, if youre an abductee you have to take extra measures to really monitor yourself in life. Every day, and throughout each day, pay attention to your

Part III Expanded Insights

195

moods, thoughts, urges, feelings, and overall emotional state in general, and note any changes and subtle shifts as they occur, and try to pinpointwhatmayhavebroughtaboutthe changeinattitude.And if you cant pinpoint the source, and it seems to have descended on you out of nowhere, then it could very well be a programming command kicking in, (or just an all around hyperdimensional/ psychic attack, a related concept mentioned earlier in this book). You never know. My boyfriend and I have gotten good at practicing this self monitoring and analysis a form of stalking, as its termed by the Toltecs that its second nature for us now, although I still definitely slipup,falling victimto negativemoodshiftsandplayingrightintoit. But Ive definitely gotten better. It makes me wonder though how I gotbyinlifewithoutmonitoringmyself.Scarytothinkabout.Butits why most of what happened to me in my 20s even happened lack of awareness,notpayingattention,notnoticingthings,notanalyzingand questioningallmythoughts,urgesandactions. Agoodpotentialexamplewouldbesomethingthatoccurredtome around September of 2005, in the middle of the afternoon while at a temp job. The day was warm, bright and sunny and calm, with a beautiful blue sky and green trees, as I sat in the office I was using at the time. My life was great in every respect living with Tom, who is a great boyfriend, working, making money at a temp job that to this day was probably the best temp gig Ive ever had. Yet there I sat in this officewith the most overwhelming urge to run away from my life.Abandoneverything and just..run.RIGHT NOW.To where,I dont know, to do what, I dont know, but the urge was powerful. RUN!!!!!!!!LEAVEMYLIFE!!!!!!!!RIGHTNOW!!!!!GETINMYCAR AND WALK OUT ON MY JOB AND JUST GO!!!!!! Leave my kitty behindwithmyboyfriendTom,andabandonbothofthembackinour apartmenthereinVirginiaandjust.go. The urge was so powerful, and yet so completely illogical and nonsensical that my mind was in a tug of war. So in the end I just sat gluedtomyswivelofficechair,myfingersclutchingintothechair,just staring blankly ahead like a deer caught in the headlights, completely motionless. If somebody had walked into my office right at that moment it would have been a really odd sight. Glad nobody did. I wasnt moving, but my mind was very busy with this back and forth tugofwar.Itwasveryintense,andtookabouttenminutestoridethis whole thing out. And in the end, after not acting on this crazy urge

196

Chasing Phantoms

from nowhere and sitting firm in my seat, it slowly subsided, and I wasabletoslowlyreturntomyjobduties. This wouldnt be the only time Ive had a strong urge to run away from my life, leave Tom, abandon Kitty and just run, but it was the mostnotablesinceitoccurredinthemiddleofaworkday,causingme tohavetorideit outinmyofficewiththe potential for otherpeopleto witness me acting strangely. Ive thankfully never acted on any of these urges. For that reason they dont seem to happen anymore. Ive proventobetoostrongalogicalthinker,notablindreactor. In retrospect, these urges seemed to be attempts at preemptive timeline manipulation. I hadnt yet written this book or formulated my website in September of 2005but it was coming up right around the corner. I purchased the domain name in2worlds.net in October of2005,onemonthafterthisincident,andbeganfuriouslyfinishingup the content of my website as of December, which I elaborate on in moredetailintheAboutsectiononmysite.Andthenbeganwriting this book in March of 2006. And that particular temp gig that the programming wanted me to abandon wound up giving me a lot of toolsthatIwouldneedforhowtoformatthisbook.Soyeah,somebig things were coming up within a matter of months. Hence, the intense urge to run away from my life and change the course of how everythingwouldgo,justpriortoitall. Sowiththatinmind,itbecomesabattleofretainingyoursentience andfreewill.Itseasytoslipandgetlazyandtoallowlifetodragyou aroundbythenose,soyoudonthavetothink.Thezooisdesignedto suckourenergyateveryturn,whichinturncontributestogettinglazy if were not aware and dont take precautions. This loss of energy is our weak point, the way that they can get in and chip away at our lives. So if youre an abductee, you have to find the energy to be able to stalk yourself and pay attention, and take back control over your ownlife.Itbecomesamatterofthinkingbeforedoing,everyday,with everything. Is that thought really your own? Is that urge you have really the optimal thing to be doing right now? Is it logical? Does it make any sense? Are you able to pause, breathe, detach, and foresee what the negative consequences would be from doing this? If so can you now resist acting on these urges (which most likely arent even your own) and go down a different pathone based on sentience and freewill?

Part III Expanded Insights

197

Another angle to this is having a strong sense of self. Too many people in this world are lost, and lack the ability for selfgenerated esteem. They look to others to make them whole, and to give them an identity and purpose. But if you have a strong sense of self, then you dont need to look to others for your esteem and identity, you will have an automatic innate sense of WHO YOU ARE. And nobody will be able to take that away from youwhich can also cause abduction programming to run afoul. If youre instilled with a negative, icky programming command that goes against the core foundation of who youareyoullbemorelikelytoresistitifyouhavethatstrongsenseof self.Theegotendstogetabadrapinspiritualpractices,butitservesa valuable purpose in this case. So a strong point for staving things off in your life is Know yourself. Actually, in truth, we can probably never truly know ourselves being that the ego is a tacked on fabrication, we have spiritual amnesia, and some people have compartmentalized multiples doing totally different things. But we can at least have a strong mind. We can think. Strong intuition coupled with a sharp mind that has analytical capabilities, pays attention and asks questions is a deadly combination. Intuition gives you a heads up advantage for seeing whos who and whats what beyond the borders of physical reality, while a strong mind means youll question things, wont get played for gullible and taken for a rideinlife. When I was first roommating in California with my brother, a mindcontrolledabductee,oneofthethingshescornedmeforwasthis very ability to think and pick things apart and critically analyze. At the time he scorned me for this I was unaware of my own abductee statusandsoIwassurprisedatthelevelofcontemptformethatdrove his words, like, Wowwhats THAT all about?! I pick things apart andscrutinizeeverythingtoomuch??Whatsittohim,youknow? Well,itwasntabouthim.Itwasaboutwhowasabductingbothof us, and how they wanted to use him to help modify my personality and steer me in a different direction in life. Then later in Portland I wastoldrepeatedlybymybrotherthatIneededtostopthinkingabout things so muchbut now the angle he used was that it had to do with tricking the matrix program of reality. (I get into this particular bit inaprevioussection.) Thinking is not good for them which means its a must for us. They NEED people who dont think, and are drifting along in a

198

Chasing Phantoms

dream state, on dopey auto pilot. I cannot emphasize this enough. Please reread that bolded sentence if you have to. This is the reason for why television and entertainment has become such a dominant force in our society, and why programs and commercials have gotten sohypnoticandnonsensical.Itsamassattempttolullthepopulation into a dreamlike trance stupor. So for us we must then adopt the countertactic of awareness and personal stalking. Thinking, questioning,analyzing.Youmayneverbeabletostoptheabductions, and you may never be able to fix or undo the mind control programming. But what you can do is be as sentient as you can be at all times. Make sure youre not just reacting to programming and manipulative urges that are not in your best interest. With every sabotaging programming command that you override through self awareness, the closer you get to personal freedom. In fact I highly recommend reading this solutionsoriented write up by Jerry Fallenberg regarding this exact subject undoing negative programming commands instilled by abductors/handlers. http://www.geocities.com/jerryf25/Letgo_1.htm Or, to quote the fortune cookie said that my boyfriend coincidentally;)receivedrecently: Youcontrolyourresponse, andthereinliesyourfreedom. Urges to move to certain locations

Relatedtothisishowmanypeoplewhoareinvolvedintheweird and the strange will have urges to up and move to various locations. Pay attention to the locations that people mention so often its the southwest. New Mexico, Arizona, Colorado and Utah. I myself had the persistent urge to move to the southwest for several years back in the 90s, after visiting there on several road trips. Other places I later had the overwhelming urge to relocate to were North Carolina specifically, Asheville, or the surrounding region, and northern California. While some urges to relocate may be in your best interest and coming from your higher good, the fact is, if youre an abductee then you still have to question everything. It turns out that the places Ive

Part III Expanded Insights

199

had urges to move to were areas that were known for their underground base/UFO activity. Asheville, North Carolina supposedly has an underground base, strong energy vortices and UFO activity galore, as well as a verifiable satanic occult issue happening although I never knew that back when I first had the intenseurgetomovethere.GladIdidtheresearchbeforeIjustupand moved. And northern California is a hotbed of weirdness, with Mt. Shasta, Bohemian Grove, military installations, and all the rest. And most reading this are probably well aware of the situation in the southwest with all its bases, both above and below ground, huge military presence, countless UFO sightings, energy vortices, and all aroundweirdnessthatdrawsintheNewAgerslikeamagnet. My later move to Florida also appears to have been a manipulated deal. I originally wanted to move there in 94, but changed my mind. Then in early 2001 in Portland while hanging out with Joe one night we were pondering where we would live next. Going back to SoCal was out of the question for both of us for different reasons, so, where else?IdcompletelyforgottenallaboutFloridaby thispointin mylife and hadnt mentioned it to Joe. But nevertheless, Joe looked at me with that weird look hed get, the glassy far away eyes, the strange knowingsmirk,andsimplysaidFlorida.Ihappenedtobeholdinga USA Today in my hand when he said it and glanced at the national weather/temp map they have, and saw that the southern tip of Florida was one of the only areas in the country, next to south Texas, where the temperature colors were yellow and orange. Everywhere else was green, blue and purple. So hot and tropical Florida it was! And why did I later pick Fort Lauderdale specifically? I have no idea. It was justin my head. Only after moving there and going through my big period of MILABS craziness from 20022004 did I later learn that other femaleMILABSexperiencedweirdnessinsouthFlorida,includingFort Lauderdale, as well. I had no idea until after writing the original versionofthisbook. A related concept is getting the urge to take a sudden trip to some place out of nowhere, for no logical reason. Ive also experienced this, asoutlinedinPart II,withregardsto my spurofthe momentroadtrip to Flagstaff/Sedona, Arizona, from California. If you keep tabs on yourself then this shouldnt be an issue. It becomes an issue when again, you lack awareness, and dont stalk yourself. If youre an abductee,andyouhaveanurgetojustdriveofftosomefarawayplace

200

Chasing Phantoms

alone and you cant track down where this urge may have come from, then maybe its best to hold off on going. It may not be in your bestinterest. The Hyperdimensional and Paranormal Phenomena

An important characteristic of someone who is an abductee is the strange hyperdimensional markers, or fingerprints, that become a part of their life: Ear tones/ringings, synchronicities, deja vus, number sightings, and so on. Ear tones/ringings usually tie in to implants and monitoring, deja vus seem to tie in to timeline manipulation, (which I dont get into here, but I do cover on my website) and synchronicities and number sightings can either be a message conveyed to you from something higher, or can also signify timelines being changed around. Very few sources make mention of any of these things, yet, when you start hanging around on the internet you see these things mentioned repeatedly. I write in depth on my website about it all, but heres the overview for those who havent read it, with some new information notincludedonthewebsiteversion:
Number Sightings

Thisisprobably themost commonoccurrenceinanabducteeslife, nexttoeartones/ringings.Whenyounoticethatcertainnumberskeep appearingtoyouontheclock,variouselectronicitems,oronstuff that come your way in life, then it usually means something. The more farfetched and unusual the occurrence, then the more meaningful it probably is. Ive documented my own number sightings in depth in ordertogettothebottomof whatthenumbersmeantforme,as noted on my website, and I highly recommend that others do that if they have this happening. Its extremely useful. Theonly way to get to the bottom of what a number sequence means for you is by logging the instancesofwhenithappens. For me, the main numbers that have followed me around for the longest time have been 119, 948, and 141. 119, for my birthday, 11/9. 9:48, for the time I was born. And 141well, it wasnt originally my number, but it transferred over to me. But more on that in a moment. In 2003, as my awareness grew, the number sightings branched out to

Part III Expanded Insights

201

include repeating numbers such as 111, 222, 333, 444, 555, 1111, etc., sequence numbers such as 123, 234 and 1234, and even more unusual yetmeaningfulnumberssuchas1133,1010and1212. So, about the whole 141 transfer thing: 141 had been my brothers personal number, something that supposedly followed him around. With Joe it was always 141 this and 141 that, although to be honest, I never saw any proof of this, I just took his word for it that it was happening. I myself didnt have numbers that followed me around like that. However, once I moved up to Portland, Oregon in November 2001, that started to change. My time in Portland was an unusual experience, something thatwas discouraged viaobstacles and problems set in my path to prevent me from going, but stubborn and persistentmepushedrightpastthem,moredeterminedthanever,and I went anyway. And not too long after arriving in Portland where I was roommates with my brother, I began to notice that I was seeing 11:09anawfullotontheclocks.Idgettheurgetoglanceatmydigital alarmclockathomeoratthecomputerclockatworkrightwhenitwas 11:09. My birthday is 11/9, so the number meant something to me. Coincidentally, before starting to see these numbers in Portland, Id recently begun assigning the numbers 119 and 948 to myself, usually within passwords and stuff. So Id consciously reached out to those numbers you could say, which plays a big part in how it can possibly start,Ithink. ThenthenightJoewasarrestedinPortland,caughtbreakingintoa building with stolen items on him from a previous burglary, everything changed. Its a long story, which I wont get into here, but that was thenight that 141 transferred over to me. Five minutes before the cops showed up with my brother in the back of their car I got another 11:09 on the clock. It literally made me stop in my tracks, frozen in place for a few seconds realizing Okay.this isnt rightsomethingishappeningThenthedoorbellrang.HowrightI was. Almost an hour an a half later when they were asking me to sign a warrant for them to search my belongings (since I roomed with him and was considered equally as guilty until proven innocent) I had to put the date and time on the paperwork. I glanced at the clock, which said 12:21. A mirror number, the same backwards and forward. Not only that, but my full given name adds up to 84 in numerology, and 8+4=12.Joesaddsupto21.;)Prettyclever. Butwaittheresmore!1221alsohappenstobreakdownto:

202

Chasing Phantoms

12+21 141

When the cops were finally leaving I glanced at the clock for only the third time that evening. And it was 1:41 a.m. exactly. The cops were leaving at 1:41, with my brother in tow, but the fun had only just begun. 141, and the other two numbers, came up repeatedly throughout the course of that insane weekend. Every time I had the urge to glance at the clock that weekend it was 10:41, 11:41, 1:41, 11:09, 9:48, or some combination,suchas4:11,10:14,11:14,1:14,11:19or9:11.EvenwhenI had the urge to look at my mileage odometer. I was sitting in my car in the Rite Aid parking lot intensely contemplating whether to bail my brother out of jail yet again then I had the urge to glance at the odometer, something I rarely pay any attention to. And it just so happened to be at exactly 119,974. My birthday is 11/9/1974. Close enoughforhorseshoes.Itwasabsolutelyoutofcontrol,andatthetime Ihadthefeelingthattherewas a tugofwargoing onbetween119 and 141. 119, my number, me, and 141, my brothers number, him, who was dragging me down in life and who I was trying to make a break from. 141hasbeenaregularpartofmylifeeversincethatweekend,four years ago. I would also come to discover that 141 is embedded within my brothers birthday. 1/31/1981. Breaking it down numerology style, whichreducesnumbersdowntosingledigits,weget:

1 3+1=4 1+9+8+1=19(=10=1)

Hyperdimensional fingerprints?
In my own log book I would document the date and time of my number sightings often, the time in itself IS the number sighting, since Id have urges to keep looking at the clock at key moments as well as noting anything that I was doing at the time of the number occurrence. Where was I, what was I doing, who was I talking to and what about, (if applicable) and so on. Then after you document enough number sighting incidents, along with any other surrounding

Part III Expanded Insights

203

corresponding phenomenon, you can begin to decipher what everything means. Its also highly recommended to learn the basics of numerology and what the common symbolic/esoteric meanings are behind numbers. What Ive discovered is that most things have multiplelayers.Thereisprobablyareasonwhythosespecificnumbers were picked for you in the first place, and thats where having a basic understanding of the language of numbers comes in handy, to decipherthenextlayerofitall. Sometimesrepeatedlygettinganumbersequencecanbeawarning of negative meddling, interferenceabductions coming up very soon. Other times it may be a sign that something has been tinkered with on the timeline, good or bad. A lot of new age nonabductee spiritual types believe that number sightings are just the universes way of trying to get your attention and wake you up. And that could very well be the case for them. For me, I just know that when Im doing exceptionally good in life and/or averting negative interference, Ill get 11:33, 9:48, 10:10, 11:11 and so on. (9:48 being specific for me personally.) But overall there is no acrosstheboard explanation that I can offer up for what number sightings mean numbers will usually betailoredtoanindividual,fromwhatIvebeenlearning. Howeverand there is always the exception to everythingI just discovered while reading a book about UFO researcher Barbara Bartholic that we both have had instances of receiving the same particular numbers 69. I experienced my 6 and 9 sightings mostly during a very specific time period in my life during the four months when I worked for what I nicknamed The Illuminati Hotel here in Virginia. And as Barbara knew, and as I myself discovered thanks to herwork,the69scanbeasignofalien/MILABSatwork.Forinstance, when I worked at the hotel I was assigned locker #69. Then my four digit code for logging into the computer and clocking in and out was 6169. I also began receiving a lot of 6:09s on the clock and in life in general, to the point where it became noticeable, although I had no idea what it meant. So if it wasnt for Barbaras book I would never have gotten the answer to this random piece of the puzzle that was sitting on the back burner all this time. She was the first source that Ive come across to even delve into the subject of number sightings in relation to abductions, and she relays in her book all the synchronistic, uncannywaysinwhich69sappearedtoherinlife.Iwasveryexcited

204

Chasing Phantoms

to find this talked about in her book. Finally, somebody else noticing thisandhavingthesameexperiences! Getting the 69s stopped only when I quit the hotel after four months. And only when doing this write up, reading the Barbara B. book and looking back at my time spent at the Illuminati hotel did the 69 sightings resume once again. For instance, in the middle of writingthisbookmyboyfriendandIweredrivingpasttheIlluminati hotel one afternoon, about to make a right hand turn at the intersection near where the front entrance is when I noticed that the last four digits on the license plate of the car in front of us was..6169.Theoddsofthecarinfrontofmehavingthesame four digit number as my log in/clock in code at the hotel and to be in front of me at the exact moment when passing by the hotel are astronomical. I also began receiving 6:09 and 6:19 again on the clocks during this write up, corresponding with some very bizarre alien dreams with MILABS programming, and possible soul abduction attempts where things were kicked up a few notches and became muchmoreovert. The summary of what I got (via pendulum dowsing) is that something was doing some very wacky things to the people who worked at that hotel, unknown to them. My own experiences that showed me something was amiss, which I decided not to get into here forspaceconstraints. AndIdidprimarilybeginreceivingtheMILAB 69s after working there, exactly as Barbara B. describes. (I only had one69indicatorbeforethat,backinFloridain2002,asnotedinPartII.) So when I saw Barbara B. mentioning her 6sand 9s, and saw that she connected it to MILABS/aliens abductions, I about fell out of my chair. This is exactly why I feel that the best way to figure out whats happening is by sharing our stories, and its why Ive found personal accounts to be the most helpful, versus detached, professional articles. Its the strange little random details like that which make the difference!http://www.in2worlds.net/numbersightings.

Ear tones

Again, one of the biggest things that tend to happen to abductees. Frommywebsite:(http://www.in2worlds.net/eartonesringings): Ear tones are intermittent short lived tones, occurring in either ear, which many people seem to experience. Often times they are

Part III Expanded Insights

205

preludedbyapronouncedmutingeffect,wherethesoundintheroom seems to abruptly shut out as the tone then fades in. So its a tone that fades in, goes on for a bit, then fades back out. But its not to be confused with tinnitus, the chronic condition of damaged eardrums where ones ear(s) constantly ring or hum, (as I understand it). Go to this link for http://montalk.net/eartone.mp3 for a simulation of what a muting followed by an ear tone ringing sounds like. This was created bymyboyfriend,anditssoaccuratethatitskindofscary.!! Ear tones can also leave residual after effects. For me, Ive experienced a burning fried feeling in my ears on several occasions whentheyveoccurred,muchlike Idbeen chatting onacellphonefor several hours. Sometimes the tone itself causes physical discomfort in theear, makingonecringe.Related tothis,Iveexperiencedsomething akin to a tuning fork, where the sound was coming from just outside myearandsoundedidenticaltoatuningfork.It feltlikeIwas literally being gonged and caused dizziness and disorientation for a fewsecondsafterwards. Other related aspects to ear ringings are ear clickings, thwumpings, (for lack of a better way to describe it) and muted pressurewithoutatone. Clickings are just that: clicking noises that seem to come from deepwithintheear.Myboyfriendhasexperiencedthis,whichishowI heardaboutit, and has proven for himself that its not natural or some biologicalmalfunction.Oftentimestheseclickingsoccurwhenhesnot consciouslyfocusedyettheystopassoonashefocusesinonthem. Thwumpings feel very similar to the effect of having fingers flicked in front of your ears according to those I know who have described it tome. The muted pressure is when the sound goes mute in an ear, accompanied by a pressure that usually feels quite uncomfortable. But no ringing or tone follows. This actually seems to be one new mode of operation within my own ear tone adventures, interestingly enough. ;) Since putting this write up out there on the net, not only are some of my ear tones now much fainter and shorter than they ever used to be, but theres also this new muted pressure thing as well. Another abductee I know who experiences the tones has recently noticed this changeinoperationsaswell. And a new one that a reader just informed me about are ear tones that sound like Morse code. To quote from her email (with

206

Chasing Phantoms

permission): .These are very very frequent for me, and in fact if I listen quietly enough, I can hear it running deep in the background most of the time. It is a series of two different notes or positive/negative soundstone semitone tone, in varying lengths of short and long. Morse code is the only thing I can liken it to I thought this was interesting enough to be worth mentioning, in case anybodyelsereadingthisalsoexperiencesit. But the most important factor, which cant be stressed enough, is the uncanny synchronistic timing of ear tones. They often happen during key moments, in conjunction with a specific comment said by somebody, or maybe a number sighting, or a dj vu. It is this aspect of ear tones that really got my attention and proved to me that they werent a natural, random biological happening with some scientific explanation. Ive had sporatic ear tones throughout my life, but the issue became so prevalent during 2002, due to what I was involved with in life, that I created an entire section of my log book devoted solely to documenting it. The log book contained the following information, if possible: Thedateandexacttimethetonehappened; Whichearitoccurredin; What the tone sounded like, (high, low, strong, faint, short in durationorlong;tuningfork,hum,mutingpressure,etc.); Whatphysicalaftereffectstherewere,ifany; WhatexactlyIwasdoing/sayingatthetimeithappened.What wasIthinkingabout?WhowasItalkingto?WherewasI?

Through documenting this information, I was able to determine over enough time that these ear tones are definitely not random, nor the result of a natural, biological problem with my ears, and most definitely did point to some external situation happening. I was also able to determine that there was a difference in meaning for right ear versus left ear. For me, the left ear has been negative, usually indicating straight up monitoring, or warning me that something is off about a person or situation, while the right was positive, sometimes seeming to confirm or reaffirm something Im thinking or reading. In fact I just came across a reference to ear tones in the book Masquerade Party at Secret Canyon by Jeannine Marie Steiner. The

Part III Expanded Insights

207

book is one psychic womans personal experiences into the realm of abductions, mind control, and MILAB harassment, and on page 73 she says:

On my way back to Ventura, I drove past Pt. Mugu Naval Base. Stopping at the red traffic light, suddenly, in my left ear I got a very loud ringing noise. To a psychic thats a strong warning that means something is very, very wrong. It means red alert. (Ringing in the left earisawarningandringingrightearispositive.)

That was exciting to find someone else noting the same thing Ive experienced.and who has independently come to the same conclusionasmyselfastothemeaningofleftearvs.right. The more you log, the more you can determine for yourself what may be happening with you and what it means. Its all about logging your stuff I cant stress it enough. Documenting things focuses your awareness,andindoingsoyougainmorepoweroveryourlife. Now, if you can rule out tinnitus and youve definitely noted a patternandmeaningfulsynchronistictimingtoyourearringings,then the culprit behind it all might be monitoring and/or implants. Abductees usually have implants its practically a given, for tracking and monitoring purpose. Many times these implants are located deep within their ears, (among other areas, such as the base of the skull/cerebellum area, orembedded up in the nose.) Implants are used for monitoring and behavior/thought pattern alteration aka programming. So in this regard, it makes sense why so many of these ear tones occur while having unusual thoughts about the weird stuff, talking to certain people, or during key times and dates. (Some recent ear tone happenings occurred within a day or two of a conflict erupting with somebody around me in life. I experienced three ear tones in my left ear within a 24 hour period between December 12, 2007, which is very unusual. That means something is up on the personal front. And by December 34 I was involved in a hiccup misunderstanding between myself and a guy that my boyfriend and I have known since about 2005, which had the potential to result in a permanent parting of the ways on negative terms with burnt bridges. In other words: timeline split. This guy is an abductee who runs several websites about UFO/abduction/alien researchersas well as promotingmywebsiteonhisvariouswebsites,whichgivesmealotof

208

Chasing Phantoms

traffic, and is much appreciated. And he also happens to be the target of some heavy duty harassment himself, and its not the first time that Ive gotten ear tones revolving around him. VERY interesting, to say the least. But this is why logging my ear tone occurrences was vital onlyafterthefactcouldIlookbackandseewhathappenedaroundthe time that I got them. In this instance it seemed quite clear why the sudden monitoring going on within a day of our weird misunderstandingandnearpartingoftheways.) Another explanation that has been offered up is that the monitoringitselfissilentanddoesnotcreateanaudiblenoise;instead, earringingsarethebodysownselfgeneratedmechanismforalerting you that youre being monitored/interfered with. In that case, right earversusleftearareactuallythebodysownselfdesignatedcode to distinguish the different sources and intent behind the monitoring. Both theories make sense to me, and I tend to think both can be happening, depending on the situation. For instance: the ear tones which leave an ear feeling hot and fried and the tuning fork hum gongs which cause disorientation and dizziness could be a result from the actual physicalimplant or even something in a neighboring realm affecting me. And the more benign, painless tones could be the bodys own selfgenerated warning system. And as mentioned earlier, what two years of logging has shown me for my personal situation is that left ear tones are usually more negative in nature. They occur typically when other abduction weirdness is going on, if Im speaking with somebody unusual, or when somebody says something very pointed and strange to me. My right ear tones are often in relation to specific thoughts Im thinking or important ideas Im reading. Sometimes they almost seem to be a confirmation of sorts, especially whenithappenswhenImthinkingaboutspiritualsubjects. AndrecentlyareaderfromIndiaemailedmetoreportthatforher: Ive found that there is a large natural calamity (Tsunami, flood, earthquake) about 23 days after I hear it. So I thought that was interestingandworthmentioning.Alsonotedinheremail,shedoesnt havetheabductionsthinggoingonthewayIdobecauseshesinIndia. The whole MILABs and alien abduction phenomenon seem to be running rampant in America, probably because the shadow government sold out theAmerican public decades ago in exchange for technology and power. But I digress. ;) So for those in other countries

Part III Expanded Insights

209

where MILABS and alien abductions arent prevalent, then ear tones mayhaveothermeanings. However, I encourage anybody reading this to research the matter on their own, using their own experiences. I have a friend (the aforementioned guy who runs several websites about abduction stuff) who noticed that for him, left is positive while right is negative. So everybodywillbedifferent. I learned how to utilize my ear tones as a heads up warning system. When they occur in the middle of the night, thats not a good sign. Abductions for me are a middle of the night/early morning occurrence, and so when Ive gotten an ear tone at 3 a.m. it usually meantsomebodywaslookinforme.;)Eartonesformearecommonly accompanied by other phenomenon throughout the day, and taken together, everything indicates that something is up. Thats why its so important to really pay attention to these things and keep a log of your phenomenon, and to pool everything together to see the Big Picture. For example, if you have a day where you experience several meaningful number sightings, some synchronicities/deja vu, and an ear ringing, then thats the universe trying to tell you something. And to discover what it all means you have to start somewhere, and thats one logged entry at a time. Then later you can go back over it all and seewhatwashappeningonwhatparticulardays. When sleuthing out the patterns, look at everything you can possibly look at. Pay particular attention to the days of the week, the number of the day of the month, the times when things happenedeverything. Maybe theres a pattern to when stuff is happening to you. There almost always is. And numbers are the best place to start dates and times. Through documenting my various anomalous phenomenon, I soon learned that my pattern involved the 1st3rdofthemonth,andthe20th23rdforabductions. On a closing note, something that cant be stressed enough here is the need to not get caught up in crazy paranoia regarding this, and other unusual happenings. Try your best to view it with an alert, attentive but yet, detached neutrality. When you start wigging out aboutthingsyourfrequencyplummetsandyoubecomeaneasytarget. Stuff loves nothing more than somebody whos freaked out, paranoid,orangryaboutthethingsthatarehappeningtothem,taking violent swings at empty air in the dark. Not good. If youre being monitored, theres probably not much you can do about it, so just go

210

Chasing Phantoms

withit.Viewyoureartonesasatool,aheadsupadvantage,a game notastheenemy.Ifnothingelseatleasttheymakelifeinteresting,and prove to you that theres a whole lot more to this reality then the mainstreamworldwouldhaveyoubelieve.Theyhelpkeepyouawake and on your toes, paying closer attention to your life than you would have otherwise, which is always a good thing. So, try to maintain a positive,balancedperspectiveonitall.
Real vs. artificial synchronicities

Frommywebsite:(http://www.in2worlds.net/synchronicities): if you are someone who experiences ear tones/ringings, deja vus, or frequent number sightings, or if you consider yourself to be an abductee with a lifelong history of the weird stuff happening, then itssafetoassumethatsynchronicityisanotheroccurrenceinyourlife. Synchronicities are meaningful coincidences. We all experiences coincidences in our lives, and many of them probably occur by statistical chance. But every so often there are those that are just so pointedandtailoredtoaparticulardetailandtosomethingaboutyou, specifically, that you cant dismiss it. When that happens, statistical probability doesnt matter. Throw it out the window. The only thing that matters at that point is whether it has meaning for you. For example, reading a word right as its said out loud next to you the more unusual the word, the more it means something; Objects coming yourwayorcrossingyourpath/fieldofviewthatcoincidewithanidea or theme you have been thinking about, or matching up to something thathaspersonalmeaningforyou,andsoon. Synchs are often time multilayered. Meaning, they happen several at a time, all connecting together in a cluster that can sometimes even connect to other strange happenings around you. I have a term for it all, which I call lining up. When you experience several synchs clustered together within a day or a few days time, thenitreallycanfeellikerealityisaligninginsomeway. Synchronicities can happen for various reasons. Several of my personal theories include timeline alteration, moving up/shifting up to something higher, messages being conveyed from our higher selves, andsoon. For an abductee however, synchronicities can also be artificially generated courtesy of their human/alien abductors, and usually done

Part III Expanded Insights

211

forthepurposeofinfluencing/reinforcingthepaththeabductiontarget is taking. Forthisreason,itbecomesnecessary forabducteesto learn how to differentiate between a natural synch, and one that is being artificiallygeneratedformanipulativepurposes. Ive experienced both types in life, and several of my own artificially generated synchs were documented in Part II, which perfectly illustrates this concept. The pen from nowhere, the Joseph license plate frame with the trailer hitch, and then there was another one not mentioned in this write up which had to do with moving to New Mexico. Shortly after arriving in Florida I was already thinking ahead about the possibility of moving to the southwest specifically, NewMexico.Iwasdrivingmycaroneafternoonneartheintersection of Sunrise Boulevard and Federal Highway pondering this, and I looked over and saw thatthe next car over from me had a New Mexico license plate. ! Wow! I thought. Synchronicity!! Possibly positively reinforcing the idea of moving there! Then the next day I was telling Tom about this as we drove along the same stretch of Sunrise and Federal Highway, only, going the other direction, at a different time of the dayand I looked over to find the exact same car,rightnexttous.Again.Theoddsofthisareastronomical.Nowit juststruckmeasbeingcreepy,andverysuspicious. In order to decipher whats what, it helps to understand how positiveforcesoperateversusnegative ones. Andthisisatopicthatis abitbiggerthanthescopeofthiswriteup,butIllsummarizeacouple of important points here since its relevant. But the big one to keep in mind is that positive stuff doesnt use glaring, flashy theatrics designed to Wow! you thats what the negs do when trying to manipulate people. And it usually works for those nave types who lack awareness, discernment, and healthy analytical and questioning abilities. Positive stuff also doesnt use tactics that appeal to the ego, or that which advocates fear, paranoia, anger, division, etc. But the negs do. If stuffs buttering you up and playing on your sense of self importance, or fanning the flames of discord then you can guarantee its not a positive force at work. Negs are also quite fond of feeding people lines about whatever they feel youll fall for, whatever your weak spot is, lying, taking credit for things they didnt do, just all arounddeception.Ingeneral,theruleforpositivestuffseemstobethe respect of freewill. They wait for you to come to them, not the other way around, they dont force anything on you or put pressure, and if

212

Chasing Phantoms

for some reason they do need to intervene to right a nono thats occurred they seem to like to slip in and out the door being as unobtrusive as possible, not drawing attention to themselves. This is what my research and personal experience has shown me. So, look at everything surrounding a farfetched unbelievable synch to see how itsplayingoutinordertodetermineifitspositiveornegative. Another thing worth noting about the nature of artificially generated synchs geared toward influencing abductees is that often times,theymayutilizepeople.Icanonlytheorizewhythiswouldbe, but Im thinking its because people are easy for stuff to work through andmanipulate.Peoplearealsoamoreeffectivetoolbecause they can directly vocalize something to us; were more apt to sit up and take notice of other people telling us weird, synchronistic thingsplain and simple. Human psychology. On a side note, if you do experience somebody in your own life taking part in a strange synch, try not to fall down the slippery slope of believing that all the people around youare knowing agents that are in on it! trying to get you. Ive gotten emails or read message board posts from people who wereslidingdownthatslope,anditsnotgood. Try to utilize your intuition and feel out a synchronicity. Artificiallygeneratedsynchs,forme,haveusuallyfeltweird,andeven a bit creepy. Theyre just too perfect in their timing and execution, too manipulative, and too inyourface. They try too hard. If youre an abductee, then you have to be alert and on guard with the events thathappentoyouinyourlife.Notinaparanoid,fearfulway,butin amatteroffact,awareway.Donttakethingsatfacevalue,anddont assume that synchronicities are always reinforcing that youre on the right path, or that a decision/idea is in your best interest. Stuff can easily orchestrate events to try to reinforce something that may be detrimental,soalwayspausetoquestion,feelthingsoutandanalyze.

The paranormal

A secondary characteristic that usually emerges in the life of an abducteeisparanormalactivity. While living in Florida in 2002 2003, my apartment became a portal you could say. Itwas similar to what I wrote about in my write upTheVortex,whichappearsonmywebsite.TheVortexwasthe apartment I lived in with my brother for a year in SoCal and that was

Part III Expanded Insights

213

completely inundated with paranormal activity. The activity happening in California was a mix of various things, whereas Florida seemed to directly correlate to abductions, and had a negative alien element/feeltoitall. The front main window in Florida had something going on with it, and my cat was attacked in it one night, and almost again on two moreoccasions.AndasIrelayedinPartII,Ihadmydreamwherea (UFO?) craft emanating bluewhite light descended outside that particular window and blew it in. Also, the corner next to the front door was a hot spot, causing my cat to jump up as high as she could towards it, repeatedly boinging like a springboard, trying to propel herself up into itexactly as she used to do with the portal above my doorway in California. Shed jump up, then claw into the wall to try to pull her way up to it, only to slide back down, nails screeching against the wall. Entity harassers came around a few times, one of them we nicknamed Ralph the rustling plastic bag (youve got to have a sense of humor about it all, remember!) because he was an all blackthing.that would paralyze me into my bed then vigorously shake himself around in my face, making a strange crinkling rustling noise that reminded me of a plastic bag, trying to terrifymeandfeedonthefear. There were the times when stuff would try to pull me out of my body, also documented in Part II. Another instance where an all black entity entered through the kitchen area, blew through the living room and then disappeared into the front wall/window hot spot area. And still other times when stuff would come around in general, which I would pick up on psychically. There was the occasional weird flashing, where the lighting or the room and surroundings in general would seem to be flashing very rapidly. Both Tom and I witnessed that on several occasions, so it wasnt just one of us imagining it. And on and on and on. I talk about some of these instances more in depth inthiswriteuponmywebsite:http://in2worlds.net/andalltherest During 2002 and into 2003 the apartment had a yucky feel to it. It didntstartoutthatwaywhenImovedin,butitbecamethatwayover time as harassment activity and abductions progressively got worse and worse. I gleaned my bit of very important insight though into the Fear Frequency in April of 2003, a year after moving in, and that changedeverything.Myfearstopped,theharassmentandparanormal craziness trickled off as a result, and by the time Tom came back to

214

Chasing Phantoms

Florida in May of 2003, after supporting his family through some personalissuesbackhomeinIowa,itwaslikeawholenewapartment. I didnt have to do a cleaning on it the way I did to my room in SoCal, described in The Vortex, but it felt so much cleaner. Very calm. Positive.WhenTomcamebackitwaslikeafreshstart,becauseallthe stuff that had previously been happening before he left was gone. He also had a whole new mindset, and between the two of us, and our new mindsets and awareness and understanding, the apartment remained (relatively) clean. Stuff occasionally did still happenbut it was nothing like before. It was doable, and it didnt taint the feel of theplace. Paranormal side effects occur in the lives of abductees for several reasons. For starters, the very nature of nonhuman abductors creates paranormal activity, simply because of who they are. Wherever they go, the paranormal phenomenon as we view it and label it, follows. Also,whenyouhavestuffcomingandgoingfromyourlivingspace, whether it be alien or human, and theyre snagging you on a regular basis and keeping an eye on you in general, then that seems to open doorwaysinyourhome,allowingotherstufftogetthrough. Most importantly though, is that as long as an abductee is the active target of a fear campaign then they will find themselves surrounded by these sorts of fearinducing happenings. It goes with theterritory,becausestuffislookingtosinktheabducteeinlife,and to do so relies on a persons negative/fearful/paranoid personal frequency. Think about what happens to people who are immersed in crazy paranormal happenings and harassment. Their effectiveness in life is drastically reduced, and any positive things they could be doing in life to help themselves, and others in the world, is virtually eliminated. Unless that person gains awareness and can snap out of it and put a stop to it, theyre effectively removed from the picture. Another one down! Mmmwwahahahahaha! And in the meantime, thefeedersgetanallyoucaneatbuffetoutofthedeal. Right now as I type this in Virginia, we have none of that stuff happening anymore. Absolutely nothing.and I had been taking that for granted in fact, until writing this section forgetting how it used to be! As far as I can tell, we still have abductions occurring, but none of the paranormal and anomalous happenings that have typically gone with it in the past. When youre aware and know exactly what to do and what mindset to adopt, they dont bother. Theres nothing for

Part III Expanded Insights

215

them to latch onto. [On a funny side note, as I was typing that last paragraph, we experienced a power surgethree power glitches in a row. Thats never happened in the year and a half weve lived in this apartment. It could be just a coincidence, but really, what are the odds. And the number three has often been noted as an announcement marker of nonhuman intelligences, whether its three knocks, or what have you. So, I took it as a funny little reminder, that Hellowere still here And the fact that something is around and aware of us but yet isnt kicking up a stink anymore says something,tomeanyway.]

The Chosen Ones


Alien souls incarnating on a mission, or mind control?

Abductees will often feel as is theyre here on a mission, with an agenda to accomplish, and that they are different in some way. Some even feel as if they have to help save the world, thats how strong the urge is that drives them. Ive experienced the feeling of having a missionandsomethingimportanttoaccomplisheversinceIwasakid. Its something thats always there, right under the surface. It never goesaway. Some people even take it to the point of believing that theyre not from Earth, theyre alien souls in human bodies Wanderers, Star Seeds,Indigos,andvariousotherlabelsthatarefloatingaroundonthe internet and in books. So whats going on with this? Are we really here on a mission? Are there really alien souls in human bodies right now? Is this just programming, designed to mess with abduction targets?Orisitboth,depending? 1. Incarnationgoals

In my opinion, it seems that positively oriented souls do arrive here from other realms with an intended goal or plan, with something theyd like to contribute to the world, adding their little bit to the pile to help shape and influence the outcome of life here on planet Earth during these times. I myself dont go around proclaiming to people that Im an ET soul, yet, I definitely feel as if Im here to do something big I cant just be some normal person content to live out

216

Chasing Phantoms

their life and die. And I can easily see myself having existed as non human beings on other planets. So one possibility is that this feeling couldindeedtieintobeinghereonaStarSeedmission. However, even if I have incarnated elsewhere, as other types of beings, I dont identify with being an alien as many of these supposed Star Seeds do,and I dontmentally reject being human, here on Earth. (For some though it gets taken to that level.) So another possibility is that this mission/drive could be a general all around incarnationalgoal,theirlifeplanasahumansoul,ifnothingelse.

2. Programming

But then theres the possibility that some people have been programmed to feel this way because its serving somebody elses agenda, such as MILABS projects, or New Age disinformation, (crystal children, starseeds indigos rainbows etc.) If one realizes that they are a MILAB, or an alien abductee in general, then they need to look very closely at their beliefs about being nonhuman, special, different, here on a mission, chosen, and so on. Especially memories they may have that are associated with this belief. Mind control programming is apparently very vivid and believable and yes, quite effective on many. I dont mean to throw a wrench in the works for people, but for those who can acknowledge that they are a MILAB, then it becomes imperative to question everything one thinks they believe or know about themselves, because the fact is, they are programming people, and they are experimenting on people, playingthemlikelabrats. MILABS projects. In the book Taken by Dr. Karla Turner, she even getsintothis:

Ten days later, Angie recalled another abduction, but this one differed dramatically from the previous encounters. [} Inside the van, Angie saw bench seats, carpet, and a large control panel. The other men entered, and Angie wondered if they belonged to some militarygroup.

Are you all with the Army, Air Force, Navy or Marines, she inquired.

Part III Expanded Insights

217

The oldest man replied, but she was beginning to have a hard time understanding everything he said. She thought he said the group belongedtoanorganizationcalledHighShelfwhichworkedmainly in special underground stations. He also told her that she and other Chosen Ones were part of a mindcontrol project, to carry instructions and temperance, via thought transference to other people.Taken,pages157158 Targets who are long term investments in various MILABS programs would in then fact be special and chosen and different. For that reason they really are here to do something.for MILABSblackprojects,thatis. Theres also the idea of taking people who genuinely are here on a higher level positive soul mission and derailing them into believing that it really is all just mind control programming, and nothing more. Get them rerouted and sidetracked away from realizing who they reallyare. On a side note, in the 2005 scifi movie The Island, the clones in the cloning facility receive some heavy doses of mind control programming while growing and forming in their pods. And one of thebigprogrammingcommandswastoberepeatedlytoldthattheyre special.theyve been chosen.theyre special.theyve been chosen While were not clones on an island (at least.I dont think we are.! :D You never know.) just the idea that a movie featured mind control programming based on getting targets to believe that theyre special, different and chosen of all things was very interesting in light of what Ive been pondering in this book. I think thereslotsofbitsoftruthtuckedintofictionmovies. Now this doesnt mean that all people whobelieve/feel themselves to be alien, special, different and here on a mission are programmed, but, some certainly may be. In Part II I mentioned what seems to be a dream of an abduction memory where I was being told of my reptilian genetics. Yet the fact that I was clearly lying on an exam table under a light, being told this fact by a hypnotic male voice while having some sort of hallucination of little gecko lizards pouring out of my chest doesnt exactly lend credence to the idea. Definitely programming.Butitsveryinterestingthatsomethingwantedmeto believe this about myself. Getting a target to believe theyre part Reptilian, Gray, or some sort of nonhuman entity in general when

218

Chasing Phantoms

theyre actually not can serve a variety of negative, manipulative purposes.Soifyouveeverhadsimilarideas,thenaskyourselfthis:

How long have you felt this way? Is it as long as you can remember? Or did it begin around a certain age? If so, what age? Canyoupinpointtheexacttimeormomentthatitbegan?

What effect did the belief have on you? Has it changed the way you go about your life in any way, and if so, how? Has it altered your personality? What effects, if any, has it had on your relationships with other people? Has it been positive, negative, or neutral?

Are there groups or activities that youre involved with as a result of this belief that you wouldnt have been involved with otherwise? If so, again, what are the effects of these activities/groups on you, your life, and your personal relationships?Isitpositive,negative,orneutral?

These are important questions to ask for anybody who has found themselves convinced that they may be an alien hybrid or special chosen alien soul on a mission of some sort, apart from the rest of humanity.Takeamomenttothinkaboutwhatabelieflikethatcould do. Getting the target to identify with their abductors, and identify with their traits is one thing, for starters. Were part of the same teamwere on your side, and youre one of us. Also, if the target is somebodywhowasworkingforthegoodguysdoingpositivethings in life, it can be a form of sabotage to derail them, get them relating to thebadguysinstead. Something I have to wonder is: Before the big New Age movement of the 20th century and all the black ops mind control projects,didpeoplestillgoaroundbelievingthattheywerealiensin human form? The military/government has had a hand in shaping and influencing the modern New Age movement with everything it entails. With that in mind you have to wonder then if they are the ones who are behind creating these ideas and labels in the first place, as part of some sort of experimentation of sorts, where people are messed with and programmed to see what they can get them to believe.

Part III Expanded Insights

219

The kicker for me is that I once experienced a supposed pre incarnationalmemorywhereIwasapparentlynothuman,andcoming here on a mission (which Ill get into in a moment), and I also do believe that there is a hybrid breeding program going on in the population, and that this planet has been hijacked by nonhuman entities. So I can totally accept the idea of hybrids and nonhuman incarnations on other planets, but the way New Agers typically approach the subject has always rubbed me the wrong way. There seems to be a lot of manipulated disinfo. bunk going on. So possibly another angle is that the infiltration into these New Age/metaphysical movements has been to distort what are actually some valid concepts, leading the herd astray. So many possibilities! One has to do a lot of carefulunravelingwhenanalyzingwhatmayreallybegoingon. Then theres the subject of the military/governments involvement in tracking those children who have been labeled by their parents as Indigos and one of the new gifted children. No surprise, but the government has a keen interest in children with exceptional mental and psychic abilities, as evidenced by the declassified government documents detailing their mind control experimentation over the decades. Get the New Age parents scoping their childrens talents, slappinglabelsonthemandannouncingittotheworldontheinternet and symposium gatherings, doing the brunt of the talent scouting work so the government doesnt have to. Pretty clever. I didnt come up with this theory though, this is a word of caution Ive seen from variouspeople. In summary Ill leave off with the aforementioned anecdote regarding a preincarnational mission memory. It happened one morning in early 2005, right after waking as I was laying in my bed. I had a spontaneous image where I could feel myself in the middle of a group of beings, getting ready to come here. We were not human it seemed. It was a big blur of whooooosh motion as we took off. And weweredefinitelyonawarriortypemission,somethingwesignedup todoyoucouldsay.Thewholefeelingbehinditwasliketheblastofa triumphant trumpet. It was also telepathically conveyed to me that thismissionwasthereasonIvehadprotectioninthislife. Yet I cant just take this as a face value memory, because again, if I canadmitinonebreath that ImaMILAB targetwhosbeenabducted, usedandprogrammed,thenIjustcannotacceptthisasbeingmytruth. Maybe as time goes on Ill tap into something that will give me some

220

Chasing Phantoms

real and valid insight into who I am in the bigger scheme of things, why Im here and how I came to get here, but until then, I cant just automatically believe this. But I know that other MILAB targets out therehavesimilarstoriestothis,andmanypeopleouttherewouldjust automatically believe something like this, without exercising any sort of discernment. And yetI have my own personal proof for why this visionwouldactuallybetrue,varioustidbitstoriesthatdoconfirmthis butwhichIwontsidetrackontohere. Now, saying that it were true, in a mundane life, something like this can be a welcome ego boost and something to spice things up. In fact, later when I pendulum dowsed it I had a bit of the ego wank going on, I admit it ;) For my line of questioning regarding the protection I have, I asked if it was because Im a more advanced, higher up soul? Got a loud NO. Is it because Im special, you know, likehigherup thenothersouls?(noticemyinabilitytoget away from that line of questioning. :D ) NO. No? huh. (admitted disappointment. Who doesnt want to think theyre special, right? haha)IsitjustbecauseofwhatIsigneduptodothen?YES.Thatsit? YES. Oh. So basically anybody who signed up to do that then would get the protection? YES. Oh, okay. Got it. Its part of the package. Sign up for suchandsuch job, you automatically get the full coverage insurance.;)Butitsnotduetobebeingspecialandbetter. So either something is programming targets to believe mind controlleddelusionsforvariousagendas,or,peoplearebeinghonedin on and abducted because that really is who we are, and as such, we attractattentiontoourselves.AsalwaysIsaytakeyourpick.Ithink itcanbeamixofboth,dependingonthepersoninvolved.

Abduct me and make me feel special!

Recently we were watching a DVD of hypnotist/author/speaker Dolores Cannon giving a talk at a UFO symposium, and one of the things that really jumped out at me was a particular anecdote she relayed. She has what she calls the thems (aliens) who will sometimes speak to her through herhypnotized clients, andone of the big revelations that was relayed to her by them was that they are specially selecting people to abduct and genetically upgrade increasing their DNA strands, and tweaking them overall to be a part of the aliens master plan for a new Earth, and new people. Dolores

Part III Expanded Insights

221

recounted how she had been telling the audience this revelation at a previous conference, and how some guy in the audience had piped up with, Where can I sign up! She chuckled as she relayed this to her current audience, and the overall implication was that this alien revelation is real, and its a good thing, and there are definitely people outtherewhodlovetosignupforthisandteamupwiththealiens. Now, I really enjoy the works of Dolores Cannon and recommend several of her books on my website, I think shes a great author, but when I heard that I was like, AHHH! NO! slapping my forehead with myhand.Itsahugemistakethatmanypeoplemake,andmakeforall the wrong reasons. The idea of being one of the selected few who gets chosen to have special DNA upgrades by the Godlike aliens is appeal to the ego, as well as relinquishing your power to something outside ofyourself. If a person has a mundane life though this can be quite exciting and thats understandable. Many abductees get a kick out of being targeted, because it sets them apart from others, it makes their life interestinganddifferent,andsomedogoasfarastobelievetheymust be special as a result of it all. And theres really nothing that can be said to a person whos in that mindset. They have to figure it out on their own, in their own way, for their own reasons. Can they be content to find excitement and stimulation in other, everyday ways, and not rely on their aliens and abductions to provide that kick? A person can still be apart from the herd and carve out a nice little independent, freethinking niche for themselves in this reality without relyingontheiralien/militaryabductionstoprovidethatforthem. And we definitely dont need aliens helping us to evolve via nifty little upgrades. They are not God or the Creator Source, and theyre definitely not something we need to be submissively subservient to, giving ourselves up to them. A person is not going to be better than their neighbor or coworker for having been specially selected for supposed DNA upgrades. If anything, they are now the aliens little puppet, as I call it, their guinea pig personal property. How can that beagoodthing??Well,unlessofcoursetheybelievetheabductorsare goodandGodlikeandthatwesomehowneedthemtoimproveus. And then theres the fact that aliens that abduct and tinker with you are aliens that also lie, to put it bluntly. Theyll tell you whatever you want to hear and whatever you want to believe if it means youll willingly let them keep abducting you. We dont know what were

222

Chasing Phantoms

signing up for or what weve just given ourselves over to. So just because theyre aliens doesnt make them better than us, Godlikeor eventruthful. And not only that, but it may not actually be aliens that were dealing with. Now theres a thought. What if its a screen memory? Whatifitshumanblackopsmilitaryfactionsdoingtheabductingand programming, convincing one to believe that theyre dealing with happy little Grays from Zeta Reticuli? There the target is, willingly giving themselves up to them, Choose me! Upgrade me! Make me better and special! and they meanwhile, are programming with drugs and hypnosis and laughing their asses off as they do it. This happens. This is actually whats going on for many people, unfortunately.So,somethingtokeepinmind. Because abductions are so shadowy and covert, and because we cant fully know or trust what were actually dealing with, its in my opinion that we should just say no to ALL abductions. Turn your back.Walkaway.Trulypositiveforcesareavailabletoyou whenever you needwho dont have a need for abductions, promises, and flashytheatrics.

The Big Boys with their Alien Toys

As the reader has probably already figured out for themselves, whatever is going on in my situation is a confusing mess. There have clearly been humans involved in my abductions, and yet, the technology theyre utilizing is nothing that the mainstream public is aware of. And the way events are being orchestrated is beyond time, to put it simply, something that only nonhuman intelligences are supposed to be capable of. Or so we thought. So whats going on here? How can this be? Researchers only rarely talk about military abductions, let alone human/military factions that are acting like aliens. And its exactly the reason I have had such difficulty in getting answers for my personal situation. Were usually presented with a black and white version of whos behind abductions its either regularoldhumanmilitaryagentswhoaretechnologicallyonparwith therestofthepublic,or,itssuperGodlikealiens.Period.Takeyour pick.

Part III Expanded Insights

223

X! Try again. What Ive been seeing are super Godlike humans doing stuff that only aliens are supposed to be capable of. However when Ive pendulum dowsed my abduction situation on several occasions Ive gotten some unusual answers. When I asked, Am I being abducted by human military? fully expecting the loud Yes and already mentally moving on to the next question, the answer insteadcamebackas....Maybe. ??Ithought.Maybeformemeanskeepdigging,theresmoreto this then just simply yes or no. So then I asked, Am I being abducted by aliens? And got another maybe. Maybe?? I thought. What does it mean, maybe? It can only be humans or aliens...right? What is this weird wrench in the works! I asked again and got the same Maybes. hmm. Finally at a loss for why it wasnt black and white yes/no, and notsurewhereelsetogowiththislineofquestioning,Ifinallythought toask,AmIbeingtakenbyhybrids?? And I got a very clear YES. And Ive gotten a clear yes every time Iveaskedthatquestion. For starters, theres always the big possibility that pendulum dowsing is nonsense and it means nothing at all. But if its valid, then this answer can mean different things. While one possibility is that yes, Im being taken by literal alien/human genetic hybrids, a secondary meaning could be human military spooks utilizing alien technology with alien buddies. So, an operation that is a hybrid of thetwosides. Theres a reason Ive gone around in my life and on the internet saying that the set up of this reality, and the things they want us to believe are lies. There are government/military factions running around out there completely removed from the mainstream government. They have technology were supposed to think doesnt exist. I know this because of the things Ive seen, which arent supposed to be possible according to the accepted laws of reality on thesurfacecivilianworldofthesheepherd.Meanwhile,wethepublic are still driving around in metal boxes on rubber wheels and flying in the sameold combustible engine driven aluminum tubes, completely immersed in personal dramas, entertainment fluff, and illusory world strife thatservestodistractus.Thereareclearlytwoworldsormore happening,andtheyvesuccessfullygot about95%ofthe population herdedverytightlyintoonerealityoption.

224

Chasing Phantoms

What researchers know from experience and by talking to abducteesisthatthemilitarynowhastheabilitytobeammessagesvia microwaves/ELF waves at people, as well as being able to communicate to a target via their implant(s), creating that voices in the head phenomena. I myself believe I witnessed what appeared to beabeammeuplaser,aswellashavingpersonalexperienceswhere it seemed as if I was plunked back into bed very suddenly from someplace else. And somebody was quietly moving about my apartment Florida, barely disguised with some sort of cloaking technology. This is all pretty far out there stuff, but yet still relatively easy for the brain to digest, and all quite plausible when you stop and ponderit. But then what about when we get to the areas involving reality manipulation, time manipulation, and synchronicities?? Those are concepts that the brain doesnt have such an easy time trying to decipher and seems beyond the range of human capability. If that infamous pen from nowhere back in Portland mentioned in Part II really was what I think it was, then how is that possible? Thats literally like somebody was sitting behind a curtain that separated my reality from theirs, and was able to reach into this reality and alter it from behind the scenes, so to speak. Butbehind the scenes where? Whereisbehindthescenes? Thisisthepointwherepeoplebegintothinkithastobethealiens, but again, Ive had experiences that show humans being intricately involved in these activities. Aliens dont speak with sarcastic human male voices and toss around very human writing instruments. And thats when its time to face the music there are human elements on this planet who can do these things, and it doesnt matter what the media, schools and Powers That Be tell you about whos who and whats what here on Earththeres a whole reality going on right under our noses, and were purposely being shielded from it. That shielding is exactly how they can keep doing what theyre doing. Were still driving around on those metal boxes with rubber wheels, mind youbut do you think thats all The Powers That Bearecapable of? If all those reports over the decades of alien contact are real, then why wouldnt the two sides have joined forces? Theres always that possibility though that humans got there on their own, in which case, its highly likely that some snazzy high level physicists have been spirited away to work for the government black ops and to develop

Part III Expanded Insights

225

teleportation technology, time travel, realm and time manipulation, and the like. It seems possible and highly likely, considering that the Navy was experimenting with invisibility and time holesduring WWII,withtheirPhiladelphiaExperiment.Andthatwas70yearsago. 70+ years from 1944 should put us into some pretty advanced technologicalterritory. The only problem iswhat were seeing here on the good old surface world is relative stagnation. Most people arent noticing this though.Becausetheircellphonemodelsbecome morerefinedandcar bodiesgetslightlytweakedandwehavemoredistractiontactictechno gadgetstoplaywith,weresupposedlyprogressing.;)Keepinmind that electronic swipe cards and flat screen computer monitors just to name a couple of recent technological advancements were old hat tothesecretmilitaryfactionsdecadesago.Whenyoudotheresearch into military abductions youll find abductees describing these yetto beinvented technologies during abductions that took place many yearsago. Its been said that They are 30 years ahead in their technology versus what the public is allowed to know. 30 is a low estimate I think, the number is probably a lot higher. Its also one of those oft quotedsayings,whichmakesitsuspicious.Itsabitsillytoeventryto make estimates about where the technology timeline is really at when we the public are missing most of the story. What Ive experienced/understood about this secret technology has led me to seriously question just how far behind we, the general population, have been held back, and how much reality has been manipulated to keep us asleep and out of the loop. Whats actually going on here on this planet anyway? It really reminds me of the scene in The Matrix when Morpheus tells Neo, You believe its the year 1999, when in fact its closer to 2199. I cant tell you exactly what year it is because we honestly dont know. So while it may be 2006, the fact is the mainstream public is being held down, held back, and kept out of the loopofprogress,whichineffectcreatesadistortionaboutwhere/when we really are. Stuff has gone on without us, and they dont want to bring the common riff raff along with them. ;) And actually I can understand that, Im just neutrally bringing this fact to peoples attentioniftheyhaventalreadyfigureditoutforthemselves. An interesting thing that Ive also noticed is how many average people believe that if this secret government technology and these

226

Chasing Phantoms

other layersof reality existed, well, they (Joe Average) would certainly know about it, right? The fact that they havent heard about it and dont know about it means it plain old just doesnt exist, and that the rest of us who say differently are quite obviously crazy. Well, not to burst their bubble, but honestlywho is this Joe Average to them? Nobody. So why does Joe Average think they would or should know about it? The slave owner doesnt report to his slaves. Its the otherwayaround.Butthesurfaceworldhasdonealottopumpupso many peoples egos and confidence, making people think that theyre somebody special and important because the media tells them so twenty times a day, and also because they may even have a lot of money, a special title, a big house and three or four cars and a stock portfolio. It creates confident knowitalls with highly inflated egos who believe they should and would be aware of such things. In truth, theyre still an ant like the rest of us, despite their money, titles, houses and cars. Just a rich, glorified ant with a few more privileges. Thatsall.Andtheyrestillgoingtobeouttheloopaboutwhatsreally going on here on Planet Earth, whether their ego can handle hearing thatornot.Andfortherestofuswhohavediscoveredthatsomething is amiss, we only know about it because we stumbled onto it accidentally due to being abductees. Otherwise we wouldnt have a clueaboutiteither. Its not an easy topic to address, as it sounds very pessimistic and negative.But Iput it outthereinamatteroffactway.(Andtoclarify when I refer to us as ants Im not implying that were forever destined to be powerless drones at the mercy of higher forces. Humans have boundless potential that most of us never realize or tap into. But aslong as we continue to not realize who we areand not tap into our potential, then yes, we will continue to be ants. The biggest part of not realizing who we are involves us behaving as disempoweredvictims,whichisdiscussedinotherareasofthisbook.) The biggest obstacle in overcoming the confusion surrounding my abductions was realizing this very simple fact there are human military/government factions utilizing what we would consider to be alien technology, doing things that would really stretch a few brains. So either they managed to get there on their own, or, they had a little help from their alien friends and are now working side by side with them.Sowhichoneisit?

Recommended Reading

There were a few sources mentioned throughout this work, but out of those here are the handful that I would really recommend for further information regarding MILABS, mind control and hyperdimensional reality. Directly click on any of the links if youre reading the electroniccopyofthisbook...

Mind Control Operation Open Eyes Five Easy Steps for Creating a Manchurian CandidateGuntherRassbacher.

http://www.rumormillnews.com/operation.htm Excellent article that outlines the governments selection and training of youths from Americas incarceration system to become programmed Manchurian Candidates. As noted elsewhere in this piece, the things Gunther noted matched my own brother Joes situation to a T, who spent ages 1417 in various juvenile lock ups, which is why I have to recommend thispiece.

MindControl,WorldControlandMassControlJimKeith. Two books that give a solid overviews of all things relating to government mind control on both individual targets and the massesatlarge,bythelateJimKeith.

Secret,DontTellTheEncyclopediaofHypnotismCarlaEmery.

http://www.hypnotism.org/

Comprehensive historical overview of hypnosis that delves into the use of unethical hypnosis, as well as government mind control projects. Well researched, extremely detailed, and a very valuable resource that also contains many additional book, article and website links and references. The late Ms. Emery, who was a victim of mind control herself, put a lot of time and effort into compiling this work and even went into hiding while writing it. If it wasnt for the intervention of something higher one night, then this book wouldnt existatall,asexplainedintheveryfirstopeningintroduction.!

228

Chasing Phantoms

Letting Go of Programming Jerry Fallenberg. Good write up that just came out regarding one mans lifetime of negative mind control programming designed to derail himand how he set about to undo it. Mr. Fallenberg describes near identical negative programming to what I talk about in Part II of this book, and were definitely not the only targets out there whove been instilled with these sorts of self defeating, mood altering commands. What sets this write up apart is that he gets into timelines, something that most people arent talking about, and how these negative programming commands are used as preemptive damage control in order to shift targets onto negative timelines and change the course of their life. This write up is a must readasitscompletelysolutionsoriented. http://www.geocities.com/jerryf25/Letgo_1.htm

The Illuminati Formula for Creating a Totally Undetectable Mind ControlledSlaveandDeeperInsightsintotheIlluminatiFormula FritzSpringmeierandCiscoWheeler.

http://www.theforbiddenknowledge.com/hardtruth/illuminati_form ula_mind_control.htm (Or try this link if the other one doesnt work): http://www.scribd.com/doc/2547057/TheIlluminatFormulaUsedto CreateanUndetectableTotoalMindControlSlaveHandsdownthe single most detailed and comprehensive source on Illuminati/occult based mind control, and the source for where I learned about the symbolisms and techniques used within mind control. But.....not a booktobereadstraightthroughasaregularbook,becauseitsnotwell writtenandisallovertheplace.Thebookoutlinesthetechniquesthat are supposedly employed to compartmentalize the mind (this is the heavy duty dark material I forewarn the reader about in a moment), how the systems are set up within the mind, what the symbolisms, trigger words and number codes are (sometimes supposedly minus a few words or numbers so as to not trigger programmed people who may be reading), as well as information regarding electronic mind control, implants, ritual cult programming and assigning demons to targets,amongmanyotherthingsincludingDisney,andtheWizardof Oz. Its like a handbook in a way getting into some heavy duty dark material. Not for the faint of heart. Recommend easing yourway into the subjectwith lighter fare first if you are new to the topic. Theres a

Recommend Reading

229

lot of personal controversy surrounding Fritz, as one can find when doing searches on the net, but theres still no question for me that so much of what is reported in Illuminati Formula is apparently spot on. (the proof of what he talks about can also be found running rampant within the media: http://in2worlds.net/mindcontrolthemes andprogrammingtriggersinmovies) Since I see evidence in the world for what hes talking about I continue to recommend the book, despitewhateverweirdandquestionablethingsmaybegoingon with Fritzpersonally. Alien/Military Abductions TakenKarlaTurner,Ph.D.www.karlaturner.org

The late Dr. Turners book regarding eight womens personal case histories as alien/military abductees. Nice sampling that gives a broad overview on the topic, and which is guaranteed to provide at least a few answers and fill in some missing puzzle pieces for MILABs. At Karlaturner.org you can find free online copies of her books (her surviving husband has given his blessing for it) as well as downloadablevideosfromhervariousspeakingengagements.

MILABSOperationsJamesBartley

http://theuniversalseduction.com/MilabOperations.pdf

Excellent article that covers many aspects of MILABS not being discussed anywhere else. Mr. Bartley aptly covers everything from Beam me up transport technology to the fact that the secret factions have the ability to manipulate time and space. He also gets into off planetary operations, frequency control of targets, both the physical and astral ops, physical abductions versus virtual reality/dream time programming, endtimes apocalyptic programming, preferential or abusive treatment of targets, the differences between MILABS and Monarchs,andmuchmore.

AndformoreofMr.Bartleyswritings,visithiswebpageat:

www.theuniversalseduction.com/bartley

230

Chasing Phantoms

MILABS Military Mind Control and Alien Abductions Dr. HelmutLammerandMarionLammer.

Having never heard of the idea of the military/government taking and messing with people, I was stuck in unanswered question limbo back during 2002until reading this book. It provided my big Eureka! breakthrough moment, which is why I still have to recommend it despite its flaws. There are many useful insights and corroborations to be found in the Lammers MILABS, but do read withdiscernmentasthereseemstobeasubtleagendagoingonwith thisbooktodismisscertainaspectsofabductions,aswellasusingsilly comic bookstyle illustrations that undermine this important subject. But,stillamustreadforanyMILABS/mindcontrolresearcher.

TheAlienJigsawhttp://www.alienjigsaw.com/Milabs/pom1.html

Useful insight into the MILABS subject. Whats funny is I hadnt realized until April 2008 that the Alien Jigaaw site went along with a bookbythesamename,whichisonewomanspersonalexperiencesas a MILAB target. When I redid the cover of this book in April I chose puzzle pieces over a labrat style maze, tying into themes discussed in my book, only to realize after looking closer at the Alien Jigsaw site and downloading Katharina Wilsons PDFs that she also features puzzle pieces in the theme in her own work. ! I guess its a popular theme with us MILABS, since were always trying to solve that unsolvablepuzzle

Barbara: The Story of a UFO Investigator Barbara Bartholic, as told toPeggyFielding.

http://www.peggyfielding.com/BookDisplay.cfm?isbn=0970750773&f=r

The life and times of UFO abductee and researcher Barbara Bartholic whoworkedwithJacqueValleeforsevenyearsandeventuallybecame a MILABs target as well. Written by Peggy Fielding, and based on interviews that Barbara gave to her, its an interesting read that gets into aspects of the abduction scenario Ive never seen mentioned elsewhere,paintingadarker,morerealisticpictureofalienabductions, counterbalancingthetypicalNewAgeviewpoint.

Recommend Reading

231

Miscellaneous

www.montalk.net High quality website with articles by the author Montalk regarding metaphysics, conspiracy, alternative science, aliens/abductions,andtheMatrixControlSystem.

You might also like