0% found this document useful (0 votes)
391 views

Robotics - Gears and Gear Ratios

file

Uploaded by

pitamber
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
391 views

Robotics - Gears and Gear Ratios

file

Uploaded by

pitamber
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 258

NOVEL DOMESTIC DESIGN AND MANUFACTURING OF PELTON

TURBINE BUCKET: A KEY TO MANAGE AND ENHANCE SUB-SAHARAN


AFRICA’S HYDRO ENERGY POTENTIAL

Submitted by

Ebhota, Williams Saturday (B.Eng, M.Eng)

213573556

Supervisor: Prof. Freddie L. Inambao

In fulfilment for the requirements for the degree of Doctor of Philosophy in


Mechanical Engineering at the College of Agriculture, Engineering and Science,
University of KwaZulu-Natal.

2017
As the candidate' s supervisor, I have approved this thesis for submission.

~- '.5.:. .'~7E: -'~- ... ~ t?, 1..?


11
Signed ..... N.J.£.l'.CJ . . . . . . . . . .. Date ...

Name: Prof. Freddie L. Inambao

11
Declaration 1 - Plagiarism

I, Ebhota, Williams Saturday, declare that:

1. The research reported in this thesis, except where otherwise indicated is my original
research.

2. This thesis has not been submitted for any degree or examination at any other
university.

3. This thesis does not contain other persons' data, pictures, graphs or other information,
unless specifically acknowledged as being sourced from other persons.

4. This thesis does not contain other persons' writing, unless specifically acknowledged as
being sourced from other researchers. Where other written sources have been quoted,
then:

a) Their words have been re-written but the general information attributed to them has
been referenced.

b) Where their exact words have been used, then their writing has been placed in italics
and inside quotation marks, and referenced.

5. This thesis does not contain text, graphics or tables copied and pasted from the internet,
unless specifically acknowledged, and the source being detailed in the thesis and in the
References sections.

Signed . ..... ....~±. . . . ... . . . . . . 1.!.~. .:r.~~1 )-0l'.J-

111
Declaration 2 - Publications

This section presents the articles that form part and/or include the research presented in this
thesis. The following papers have been published or under review:

ISI/SCOPUS/DoHET Accredited Journals

1. W. S. Ebhota and F. L. Inambao, "Electricity insufficiency in Africa: a product of


inadequate manufacturing capacity," African Journal of Science, Technology,
Innovation and Development, vol. 8, no. 2, pp. 197-204, 2016. DOI:
10.1080/20421338.2016 (published).

2. W. S. Ebhota and F. L. Inambao, "Facilitating greater energy access in rural and


remote areas of sub-Saharan Africa: small hydropower," Energy & Environment,
2016. DOI: 10.1177/0958305X16686448 (Published Onlinefirst)

3. W. S. Ebhota and F. L. Inambao, "Sub-Saharan Africa power sustainability: a function


of a domestic small hydropower (SHP) design and manufacturing," Journal of Energy
in Southern Africa, 2016. (Under review.)

4. W. S. Ebhota and F. L. Inambao, "Design basics of a small hydro turbine plant for
capacity building in sub-Saharan Africa," African Journal of Science, Technology,
Innovation and Development, vol. 8, no. 1, pp. 111-120, 2016. DOI:
10.1080/20421338.2015.1128039 (Published).

5. W. S. Ebhota, A. S. Karun and F. L. Inambao, "Principles and baseline knowledge of


functionally graded aluminium matrix materials (FGAMMs): fabrication techniques
and applications," International Journal of Engineering Research in Africa Vol. 26, pp
47-67. DOI:10.4028/www.scientific.net/JERA.26.47 (Published).

6. W. S. Ebhota, A. S. Karun and F. L. Inambao, "Centrifugal casting technique baseline


knowledge, applications, and processing parameters: overview," International Journal
of Materials Research, 04 August, 2016. DOI: 10.3139/146.111423 (Published).

7. W. S. Ebhota and F. L. Inambao, "Functionally graded metal matrix composite by


centrifugal casting technique mathematical correlation," African Journal of
Science, Technology, Innovation and Development, 2016. (Under review)

iv
8. W. S. Ebhota and F. L. Inambao, "Smart design and development of small hydropower
system and exploiting of locally sourced material for Pelton turbine bucket
production," Iranian Journal of Science and Technology, Transactions of Mechanical
Engineering, 2016. (Under review).

9. W. S. Ebhota, A. S. Karun and F. L. Inambao, "Investigation of functionally graded


aluminium A356 Alloy and A356-10%SiCp composite for hydro turbine bucket
application," International Journal of Engineering Research in Africa, 2016. Vol. 26,
pp 30-46. DOI:10.4028/www.scientific.net/JERA.26.30 (Published).

10. W. S. Ebhota and F. L. Inambao, "Enhancing the wear and corrosion resistance of a
Pelton turbine bucket surface by centrifugal casting technique and heat treatment,"
Journal of the Southern African Institute of Mining and Metallurgy, 2016. (Under
review.)
International and DHET accredited conferences
1. W. S. Ebhota and F. L. Inambao, "Domestic turbine design, simulation and
manufacturing for sub-Saharan Africa energy sustainability," presented at 14th
International Conference on Sustainable Energy Technologies (SET), Nottingham,
UK, 25-27 August, 2015. (Appendix 1)

2. W. S. Ebhota and F. L. Inambao, "Examining the effects of production method on


Aluminium A356 alloy and A356-10%SiCp composite for hydro turbine bucket
application," in Proceedings of 18th International Conference on Mechanical and
Materials Engineering (ICMME), International Journal of Chemical, Molecular,
Nuclear, Materials and Metallurgical Engineering Vol:10 No: 10, 2016, Paris,
France, 24-25 October, 2016. (Appendix 2)

3. W. S. Ebhota and F. L. Inambao, "Novel domestic manufacturing of Pelton turbine


bucket: a key to enhance sub-Sahara Africa energy potential," in Proceedings of the
Industrial and Commercial Use of Energy, Vineyard Hotel, Cape Town, South Africa,
15-17 August, 2016.

4. W. S. Ebhota and F. L. Inambao, "Functionally graded materials and aluminum alloys


investigation for small hydro turbine blade application," presented at 9th International
Conference on Researches in Engineering, Technology and Sciences (ICRETS),
Imperial College London, London, September 17-18, 2015.

v
5. W. S. Ebhota and F. L. Inambao, "Functionally graded materials (FGMs) fabrication
techniques, processing parameters and applications: baseline knowledge and
overview," presented at 9th International Conference on Researches in Engineering,
Technology and Sciences Imperial College London, UK, September 17-18, 2015.

The candidate is the main and corresponding author respectively for all the publications while
Prof. Freddie L. Inambao is the supervisor.

vi
Dedication

This thesis is dedicated to my late father, John Aighayighan Ebhota, for his passion for
education, he passed away in 2007. May his gentle soul rest in the bosom of the lord, amen.
To my mother, wife, son, brothers, sisters, colleagues and friends for their love,
encouragement and support.

vii
Acknowledgements

To God, the author and finisher of my faith, goes my first appreciation and acknowledgement
who made this programme possible. My second acknowledgement goes to my lovely and
caring wife, friend, and reading mate, Chika, my son, Peculiar and Prof. Freddie L. Inambao
for his supervision and understanding. To my mum, brothers and sisters: Janet, Thomas,
Catherine, Lucky, Mary, Victor, Florence, Fr. Jacob-Neri, and Faith for their love,
encouragement and support.

To my childhood friends, Okoromi, Jude, Enojiela and Parker and to my Nnewi, NEDDI and
NASENI friends Ademola and family, Michael and family, Iduma and family, Godstime and
and family, Cajethan, Amos, Nnalue, Yusuf, Ugochukwu, Mgbemena, Iboi, Sunday,
Makinde and family, Victoria, Mr. Pawa, Engr. Ajulu, Charity, Anamasonye’s family, and
Okeke’s family.

To my friends in the University of KwaZulu-Natal Andrew (Bomboo) and Victoria, Samuel


and family, Chiemela, Adefemi, Segun, Gloria, Getihun (my best academic friend), Yuwa,
Young, Taty, Emmanuel, Ebeanizer, Usy, Kazeem, Shaun (my invaluable research tool
provider) and others too numerous to mention, I salute you all.

viii
Table of Contents

Declaration 1 - Plagiarism .........................................................................................................iii

Declaration 2 - Publications ......................................................................................................iv

Dedication.................................................................................................................................vii

Acknowledgements .................................................................................................................viii

Table of Contents ......................................................................................................................ix

Nomenclature.........................................................................................................................xviii

Acronyms ..............................................................................................................................xxiii

Abstract..................................................................................................................................xxiv

CHAPTER 1: INTRODUCTION...............................................................................................1
1.1 Introduction .......................................................................................................................1
1.2 Research rationale..............................................................................................................1
1.3 Problem statement .............................................................................................................1
1.4 Background to the study....................................................................................................2
1.4.1 Energy, human existence and national growth............................................................2
1.4.2 Generation of electricity by hydro...............................................................................3
1.4.3 Basic principles of small hydropower .........................................................................4
1.4.4 Turbine materials .........................................................................................................5
1.5 Aim of the study ................................................................................................................5
1.6 Objectives of the study ......................................................................................................5
1.7 Significance of the study ...................................................................................................6
1.8 Scope of the study .............................................................................................................7
1.9 Thesis layout......................................................................................................................7
Bibliography ............................................................................................................................9

CHAPTER 2: ANALYSIS OF ENERGY ISSUES IN SUB-SAHARAN AFRICA ...............12


Part 1: Electricity Insufficiency in Africa: A Product of Inadequate Manufacturing Capacity
......................................................................................................................................13
Part 2: Facilitating Greater Energy Access in Rural and Remote Areas of Sub-Saharan
Africa: Small Hydropower ...........................................................................................15
2.2.1 Introduction ..................................................................................................................16

ix
2.2.1.1 Problem statement: gross inadequate access to electricity in sub-Saharan Africa
despite the abundance of small hydropower resources ..........................................17
2.2.2 Regional electricity situation........................................................................................17
2.2.3 Small hydropower energy conversion principle...........................................................19
2.2.4 Small hydropower (SHP) system and access to energy in SSA...................................20
2.2.5 Small hydropower development barriers in sub-Saharan Africa .................................21
2.2.5.1 Cost of power projects............................................................................................22
2.2.5.2 Power generation and distribution policies ............................................................22
2.2.5.3 Inadequate SHP design and manufacturing infrastructure .....................................23
2.2.6 Way forward .................................................................................................................24
2.2.6.1 Domestication of SHP in SSA................................................................................24
2.2.6.2 Design and fabrication of hydro turbine components in SSA ................................24
2.2.6.3 Turbine blade material selection.............................................................................25
2.2.6.4 Policy and implementation .....................................................................................26
2.2.7 Conclusion....................................................................................................................27
Bibliography ..........................................................................................................................29
Part 3: Sub-Saharan Africa Power Sustainability: A Function of a Domestic Small
Hydropower (SHP) Design and Manufacturing ...........................................................33
2.3.1 Introduction ..................................................................................................................34
2.3.2 Hydro potential in Africa and benefits of small hydropower.......................................36
2.3.2.1 Large scale hydropower projects ............................................................................37
2.3.2.2 Small hydropower (SHP)........................................................................................37
2.3.3 Hydro turbine design and manufacturing procedures...................................................38
2.3.3.1 Sustaining power through domestic participation ..................................................39
2.3.3.2 Hydropower plant operation principle....................................................................39
2.3.3.3 Hydro turbine main components ............................................................................40
2.3.3.4 Selection of turbine and design of turbine..............................................................40
2.3.3.5 The Kaplan/Propeller turbine .................................................................................41
2.3.3.6 The Pelton turbine: Main elements of a Pelton turbine system ..............................42
2.3.4 Methodology.................................................................................................................43
2.3.4.1 Propeller turbine design for low head.....................................................................43
2.3.5 Design calculation and simulation of a Pelton bucket high head .................................44
2.3.5.1 Pelton design parameters ........................................................................................44

x
2.3.6 Material selection for Pelton bucket.............................................................................45
2.3.6.1 Evaluation of 6061-T6 Aluminium Alloy .................................................................46
2.3.7 Conclusion....................................................................................................................48
Bibliography ..........................................................................................................................49

CHAPTER 3: DESIGN BASICS OF A SMALL HYDRO TURBINE PLANT FOR


CAPACITY BUILDING IN SUB-SAHARAN AFRICA .......................................................52

CHAPTER 4: PRINCIPLES AND BASELINE KNOWLEDGE OF FUNCTIONALLY


GRADED ALUMINIUM MATRIX MATERIALS (FGAMMS): FABRICATION AND
APPLICATIONS......................................................................................................................54

CHAPTER 5: CENTRIFUGAL CASTING TECHNIQUE BASELINE KNOWLEDGE,


APPLICATIONS, AND PROCESSING PARAMETERS: OVERVIEW...............................55

CHAPTER 6: FUNCTIONALLY GRADED METAL MATRIX COMPOSITE BY


CENTRIFUGAL CASTING TECHNIQUE MATHEMATICAL CORRELATION..............57
6.1 Introduction .....................................................................................................................58
6.2 Mathematical expressions ...............................................................................................63
6.2.1 Particle and solid/liquid interface ..............................................................................63
6.2.1.1 The discussion on Stokes’ flotation velocity....................................................64
6.2.1.2 Evaluation of solid/liquid interface shape in particle vicinity..........................64
6.2.2 Forces acting on particle in a melt.............................................................................66
6.2.2.1 Gravitational force............................................................................................66
6.2.2.2 Drag force .........................................................................................................66
6.2.2.3 Repulsive/Van der Waals force ........................................................................67
6.2.2.4 Force balance equation, Fnet .............................................................................69
6.2.3 Significant conditions for pushing/engulfment transition .........................................69
6.2.4 Volume fraction resolution........................................................................................71
6.2.5 Particle matrix field temperature configuration 153..................................................71
6.2.6 Boundary conditions..................................................................................................72
6.2.7 Heat conduction expression.......................................................................................73
6.2.8 Governing expression ................................................................................................73
6.2.9 Composites thermophysical properties......................................................................73
6.2.10 Centrifugal casting system initial conditions...........................................................74
6.2.11 Boundary conditions................................................................................................74

xi
6.2.12 Formulation of heat-transfer coefficient..................................................................75
6.2.13 Composite thermal conductivity, K.........................................................................76
6.3 Conclusion.......................................................................................................................76
Bibliography ..........................................................................................................................77

CHAPTER 7: SMART DESIGN AND DEVELOPMENT OF A SMALL HYDROPOWER


SYSTEM AND EXPLOITATION OF LOCALLY SOURCED MATERIAL FOR PELTON
TURBINE BUCKET PRODUCTION .....................................................................................80
7.1 Introduction .....................................................................................................................81
7.2 Review .............................................................................................................................82
7.3 Theoretical framework and design considerations ..........................................................83
7.3.1 SHP system and principle of operation .....................................................................83
7.3.2 Designing and development of key components of a SHP system ...........................84
7.3.3 Civil design................................................................................................................85
7.3.3.1 Weir and intake.................................................................................................85
7.3.3.2 Headrace canal/open channel ...........................................................................86
7.3.3.3 Spillway and settling basin ...............................................................................88
7.3.3.4 Trash rack design..............................................................................................89
7.3.3.5 Forebay and penstock design............................................................................90
7.3.4 Hydro Pelton turbine mechanical design...................................................................94
7.3.4.1 Main categories of turbine and their applications ............................................95
7.3.4.2 Euler equation...................................................................................................95
7.3.4.3 For Pelton turbine .............................................................................................96
7.3.4.4 The real Pelton runner ......................................................................................97
7.3.4.5 Turbine shaft diameter......................................................................................99
7.4 Pelton turbine bucket production.....................................................................................99
7.4.1 Selection of material..................................................................................................99
7.4.2 Manufacturing of a Pelton turbine bucket .................................................................99
7.5 SHP system design results.............................................................................................100
7.5.1 Civil works design charts for SHP ..........................................................................101
7.5.2 Pelton turbine bucket design charts .........................................................................104
7.6 Prototype design parameters..........................................................................................107
7.7 Pelton bucket simulation results ....................................................................................107
7.8 Conclusion.....................................................................................................................109

xii
Bibliography ........................................................................................................................110

CHAPTER 8: INVESTIGATION OF FUNCTIONALLY GRADED ALUMINIUM A356


ALLOY AND A356-10%SICP COMPOSITE FOR HYDRO TURBINE BUCKET
APPLICATION ......................................................................................................................114

CHAPTER 9: ENHANCING THE WEAR AND CORROSION RESISTANCE OF A


PELTON TURBINE BUCKET SURFACE BY CENTRIFUGAL CASTING TECHNIQUE
AND HEAT TREATMENT...................................................................................................115
9.1 Introduction ...................................................................................................................116
9.1.1 Pelton turbine material and fabrication ...................................................................118
9.2 Experimental method.....................................................................................................119
9.2.1 Fabrication of a permanent mould for a Pelton turbine bucket ...............................119
9.2.2 Production of the mould ..........................................................................................119
9.2.3 Mould material ........................................................................................................120
9.2.4 A390-aluminium alloy formation............................................................................121
9.2.5 A390-5%Mg aluminium alloy formation ................................................................121
9.2.6 Electrochemical corrosion test.................................................................................123
9.2.7 Specimen preparation ..............................................................................................124
9.2.8 Hardness test............................................................................................................125
9.2.9 Heat treatment..........................................................................................................125
9.3 Theoretical background .................................................................................................126
9.4 Result and discussion ....................................................................................................127
9.4.1 Microstructure .........................................................................................................127
9.4.2 Effect of centrifuge and heat treatment on hardness ...............................................130
9.4.3 Electrochemical corrosion .......................................................................................132
9.5 Protective coating of Pelton bucket ...............................................................................133
9.6 Conclusion.....................................................................................................................133
Bibliography ........................................................................................................................135

CHAPTER 10: CONCLUSION AND FUTURE WORK......................................................138


10.1 Conclusion...................................................................................................................138
10.2 Future work .................................................................................................................139
10.2.1 Materials and manufacturing process ....................................................................139
10.2.2 Optimisation of domestic design and production ..................................................140

xiii
APPENDIXES........................................................................................................................141

xiv
List of Tables

Table 1.1: Classification of hydropower ...................................................................................3


Table 1.2: Classification of SHP by countries ...........................................................................4
Table 2.2.1: Categories of hydro turbine based on output size propagation ...........................20
Table 2.2.2: SHP Barriers peculiar to the different regions of Africa .....................................21
Table 2.3.1: Various size classification of SHP ......................................................................38
Table 2.3.2: Types of hydro turbine and their applications .....................................................41
Table 2.3.3: Nominal conditions for Kaplan/Propeller turbine design ....................................43
Table 2.3.4: Nominal conditions for Pelton turbine design .....................................................44
Table 2.3.5: Material (6061-T6 Aluminum) properties ...........................................................46
Table 2.3.6: Mesh information ................................................................................................46
Table 2.3.7: Study results for stress, displacement and strain .................................................46
Table 7.1: Common types of weir and intake flow rate ..........................................................86
Table 7.2: Headrace canal/channel design equations ..............................................................87
Table 7.3: Headrace canal/channel velocity and roughness coefficient ..................................88
Table 7.4: Calculation of settling basin ...................................................................................89
Table 7.5: Penstock flow velocity ...........................................................................................90
Table 7.6: Expressions for forebay and penstock design ........................................................92
Table 7.7: Manning's roughness coefficients, np, for common channel materials ..................92
Table 7.8: Relations to calculate the internal diameter of a penstock .....................................93
Table 7.9: Types of hydro turbine and their applications ........................................................95
Table 7.10: The calculation details of a turbine design ...........................................................98
Table 7.11: Main turbine design parameters and constants ..................................................107
Table 7.12: Mechanical properties of the bucket material ....................................................107
Table 7.13: Study properties ..................................................................................................108
Table 7.14: Von Mises stress, displacement, and strain results ............................................109
Table 9.1: OHNS material chemical composition .................................................................120
Table 9.2: Elemental compositions of A390 and A390-5%Mg ............................................121
Table 9.3: A390 and A390-5%Mg alloys in 3.5 % NaCl solution ........................................132

xv
List of Figures

Figure 2.2.1: Variation of electricity at different scenario .................................................................................... 18


Figure 2.2.2: No power for 7 days for the different kind of workers .................................................................... 18
Figure 2.2.3: SHP potential in regions of Africa .................................................................................................. 19
Figure 2.2.4. Energy conversion in turbine .......................................................................................................... 20
Figure 2.2.5: The development process of a SHP ................................................................................................ 21
Figure 2.2.6: SSA major sources of machinery imports ....................................................................................... 24
Figure 2.2.7. Production layout model of a pico hydro turbine system ................................................................ 25
Figure 2.2.8. Components of the design system ................................................................................................... 25
Figure 2.3.1: Regional access to electricity in 2015 ............................................................................................. 34
Figure 2.3.2: World TPES .................................................................................................................................... 35
Figure 2.3.3: Global primary energy supply and CO2 emissions .......................................................................... 35
Figure 2.3.4: Change in CO2 emissions by region (2011-2012 ............................................................................ 35
Figure 2.3.4: CO2 emission by sector .................................................................................................................... 36
Figure 2.3.6: Electricity generation by fuel .......................................................................................................... 36
Figure 2.3.7: Hydropower potential and installed capacity in Africa ................................................................... 37
Figure 2.3.8: Correlation between material selection and manufacturing process. .............................................. 39
Figure 2.3.9: Production layout model of a pico hydro turbine system ................................................................ 39
Figure 2.3.10: Schematic diagram of a hydro turbine system .............................................................................. 40
Figure 2.3.11: Head-flow range of small hydro turbines ...................................................................................... 41
Figure 2.3.12: Kaplan/Propeller runner blade parameters and parts ..................................................................... 41
Figure 2.3.13: Pelton turbine arrangement ........................................................................................................... 42
Figure 2.3.14: The general layout of a Pelton hydro turbine plant ....................................................................... 42
Figure 2.3.15: Runner and bucket parameters ...................................................................................................... 44
Figure 2.3.16: Turbine velocity diagrams ............................................................................................................. 44
Figure 2.3.17: Nodal stress distribution ................................................................................................................ 47
Figure 2.3.18: Nodal fatigue distribution ............................................................................................................. 47
Figure 2.3.19: Factor of Safety distribution .......................................................................................................... 48
Figure 6.1: Schematic of Gao and Wang experimental setup ............................................................................... 61
Figure 6.2: Representation of a particle near solid/liquid interface and the forces acting on the particle ............ 64
Figure 6.3: Depiction of solid/liquid interface shapes for various conditions ....................................................... 65
Figure 6.4: Depiction of solid/liquid interface shapes for various conditions ...................................................... 65
Figure 6.5: Representation of forces acting on a particle moving in molten metal .............................................. 66
Figure 6.6: Effects of thermal conductivity ratio .................................................................................................. 73
Figure 6.7: Direction of heat flows in a centrifugal casting system ..................................................................... 73
Figure 6.8: Schematic depiction of centrifugal cast system of metal matrix composites ..................................... 74
Figure 7.1: Schematic of a hydropower system and the direction of flow ........................................................... 84
Figure 7.2: SHP development stages .................................................................................................................... 84
Figure 7.3: SHP design and development layout .................................................................................................. 85
Figure 7.4: Schematic of a weir ............................................................................................................................ 85
Figure 7.5: Schematic of a submerged intake ....................................................................................................... 86
Figure 7.6: Common channel cross sections ........................................................................................................ 86
Figure 7.7: A normal spillway in a SHP system ................................................................................................... 88
Figure 7.8: (a) Side view and (b) Top view of a settling basin ............................................................................. 89
Figure 7.9: Schematic showing normal forebay in SHP system ........................................................................... 90
Figure 7.10: Components of the penstock assembly ............................................................................................ 91
Figure 7.11: penstock and powerhouse arrangement ............................................................................................ 94
Figure 7.12: Stemming jet impinges on splitter of a bucket ................................................................................. 94
Figure 7.13: The different types of turbine ........................................................................................................... 95
Figure 7.14: The Pelton wheel velocities triangle, showing the relative and absolute velocities of the flow. ..... 95
Figure 7.15: Theoretical variation of runner efficiency for a Pelton wheel with blade speed to jet speed ratio for
several values of friction factor k .................................................................................................................. 96
Figure 7.16: The arrangement of a runner ............................................................................................................ 97
Figure 7.17: Assembly of buckets on runner ........................................................................................................ 97
Figure 7.18: An offset of section X-X of a Pelton bucket .................................................................................. 100
Figure 7.19: Intake discharge vs sectional area .................................................................................................. 101
Figure 7.20: Canal discharge vs sectional area ................................................................................................... 101
Figure 7.21: Canal area vs depth and radius ....................................................................................................... 102
xvi
Figure 7.22: Notch discharge vs weir depth ....................................................................................................... 102
Figure 7.23: Canal sectional area vs perimeter wet ............................................................................................ 102
Figure 7.24: Length vs volume of settling basin ................................................................................................ 103
Figure 7.25: Discharge vs penstock internal diameter ........................................................................................ 103
Figure 7.26: Discharge vs penstock vent diameter ............................................................................................. 103
Figure 7.27: Discharge vs power of turbine ....................................................................................................... 104
Figure 7.28: Discharge vs jet diameter ............................................................................................................... 104
Figure 7.29: Velocity vs runner diameter of a turbine ........................................................................................ 105
Figure 7.30: Bucket design parameters .............................................................................................................. 105
Figure 7.31: Rotational speed vs specific speed ................................................................................................. 105
Figure 7.32: Turbine power vs turbine efficiency .............................................................................................. 106
Figure 7.33: Graph of torque against reaction force ........................................................................................... 106
Figure 7.34: Graph of turbine shaft against power ............................................................................................. 106
Figure 7.35: The designed bucket prototype ...................................................................................................... 107
Figure 7.36: Diagrammatic representation of simulation process and von Mises result .................................... 108
Figure 9.1: The design parameters of a bucket ................................................................................................... 119
Figure 9.2a: Exploded view of Pelton bucket mould assembly as designed ...................................................... 119
Figure 9.2b: Exploded view of Pelton bucket mould assembly as fabricated .................................................... 120
Figure 9.3: The manufactured mould components for Pelton bucket ................................................................. 120
Figure 9.4: Degassing of the molten metal with RID machine ........................................................................... 121
Figure 9.5: Vertical centrifugal casting machine ................................................................................................ 122
Figure 9.6: The arrangement of the buckets in the mould .................................................................................. 122
Figure 9.7: Castings from different casting techniques ...................................................................................... 123
Figure 9.8: The setup of the electrochemical corrosion laboratory workstation ................................................. 123
Figure 9.9: Preparing microstructural and hardness specimens .......................................................................... 124
Figure 9.10: Schematic of how the specimens were cut from the cylindrical casting ........................................ 124
Figure 9.11: Specimens for electrochemical test ................................................................................................ 124
Figure 9.12: Bucket test samples ........................................................................................................................ 125
Figure 9.13: Schematic of T6 heat treatment profile of A390 and A390-5%Mg ............................................... 125
Figure 9.14: Micrographs of centrifugally cast aluminium A390 alloy ............................................................. 127
Figure 9.15: Optical micrographs of A390-5%Mg by gravity casting method .................................................. 128
Figure 9.15b-g: Optical micrographs of A390-5%Mg by centrifugal casting method ....................................... 128
Figure 9.16: Optical micrograph of A390-5%Mg bucket fabricated by the centrifugal cast process ................. 128
Figure 9.17: The particles acceleration and centrifugal-gravity ratio curve ....................................................... 130
Figure 9.18: Hardness of A390-5%Mg as-cast by centrifugal casting in relation to the microstructure ............ 131
Figure 9.19: Optical micrographs of A390 and A390-6T as-cast by gravity casting ......................................... 131
Figure 9.20: Graphs of hardness variation of A390 and A390-5%Mg fabricated by centrifugal casting technique
...................................................................................................................................................................... 132
Figure 9.21 a: Tafel of A390 and A390-5%Mg ................................................................................................. 133
Figure 9.21b: Tafel of Specimens E1, E2, and E3 ................................................................................................ 133

xvii
Nomenclature

Symbol Description Unit

¨hl Total head loss m

¨W Work done kW

a Cavity width m

A Sectional flow area m2

Ach Open channel cross-sectional area m2

Aj Jet/nozzle cross sectional area m2

Aor Area of the orifice m2

Bd Bucket depth m

Bl Bucket radial length m

Bw Bucket axial width m

C Discharge coefficient m3/s

C1 Jet velocity m/s

C2 The absolute velocity at the exit m/s

Cc Chezy’s C

Cn Nozzle discharge coefficient

Csilt Silt concentration of incoming flow

Cw Spillway profile coefficient

Cw1 Input velocity of the whirl m/s

Cw2 Exit velocity of the whirl m/s

Dh Hub diameter m

Dj Jet/nozzle diameter m

Dp Penstock diameter mm

Dr Runner diameter m

Dt Blade diameter m
xviii
E Young’s modulus for the penstock N/m2

f Darcy-Weisbach friction factor

F Safety factor

FA Force acting on the runner N

Fd The deflector required force N

g Acceleration due to gravity m/s2

G Gravity acceleration

h1 Cavity length m

h2 Length to impact point m

hfld Flood level height in the canal m

Hg Gross head m

hh Downstream orifice water level m

Hn Net head m

hr Upstream orifice water level m

hsp Spillway crest height m

k Offset of bucket m

Kben Loss of head through bend mm

Kcon Loss of head through contraction mm

Kent Loss of head through entrance mm

ku Coefficient after impact

Kug, the tip-to-head velocity ratio

Kval Loss of head through valves mm

Lab Length of bucket moment arm m

Lp Penstock length m

N Runner speed rpm

na Number of bucket

xix
nch Roughness coefficient

np Manning's coefficient

Ns Specific speed

nz Number of nozzle

p Internal pressure kg/m2

Pfactor Water packing factor

Pti The input power to the turbine kW

Pto The output power to the turbine kW

Pw Wetted perimeter m

Q Flow rate m3/s

Qch Headrace canal m3/s

Qd Set design discharge m3/s

Qdin Intake design discharge m3/s

Qfld Flood flow through the intake m3/s

Qn Nozzle flow rate m3/s

Qp Water flow rate m3/s

Rbr Radius of bucket centre of mass to runner centre m

Rch Hydraulic radius of the section area m

rh Hub radius m

rh hub radius m

rt Blade radius m

rt Blade radius m

Sch Canal sides slope

T Blade torque N-m

tef Effective penstock wall thickness at upper end mm

textr Extra thickness for corrosion mm

xx
tp Minimum penstock thickness mm

Tsilt Silt emptying frequency s

Tt The torque produced by the turbine N-m

u Velocity m/s

U1 Bucket speed m/s

U1 Bucket speed m/s

U2 Bucket speed vector m/s

U2 Speed vector at the exit m/s

Vaxial Axial velocity m/s

Vb Volume of bucket m3

Vch Normal open channel velocity m/s

Vchc Chezy open channel velocity m/s

Vchd Darcy-Weisbach velocity m/s

Vchm Manning’s velocity m/s

Vchw Hazen-Williams velocity equation m/s

Vj Absolute velocity of water jet m/s

Vp Penstock velocity m/s

Vtr Tangential velocity of the runner m/s

Vvert Fall velocity m3/s

W Suitable basin width m

w1 Relative velocity at the inlet m/s

w2 Relative velocity at the exit m/s

xnb Distance between bucket and nozzle m


o
ȕ2 Jet inclined angle to the horizontal plane

Ș Efficiency %

Șt Efficiency of the wheel

xxi
ȡsilt Density of silt Kg/m3

Ȧ Turbine speed rad/s.

Greek Symbols

Symbol Description Unit

όth Turbine hydraulic efficiency

όtl total efficiency.

ȡ Density of water Kg/m3

ı Tensile stress N/m2

ĭ Flow coefficient

ȍs Specific speed

ȍsp Power specific speed

Ƚ Power coefficient rad/s

xxii
Acronyms

A- HT Alloy heat treated

AC As-cast

AC-C As-cast composite;

CCT Centrifugal casting technique

C-HT Composite heat treated

FGAAMCs Functional graded aluminium alloy matrix composites

FGMs Functionally graded materials

GDP Gross domestic product

GHG Greenhouse gases

IEA International Energy Agency

PM Powder metallurgy

PPP Public-private partnership

SHP Small hydropower

SSA Sub-Saharan Africa

xxiii
Abstract

This study, seeks to identify and discuss barriers responsible for the perennial power
challenges in the region. The identified limiting factors include insufficient fund in the power
sector; high cost of power projects; lack of adequate manufacturing infrastructure; lack of
adequate power generation and distribution policies; insufficient human and power
infrastructure capacities; insufficient public-private partnership (PPP); over reliance on
foreign power technology; and, inadequate domestic and regional participation in the design
and manufacturing of power devices and systems. Further, the study has singled out small
hydropower (SHP) schemes as the best power system for rural and remote areas and stand-
alone electrification in the region. This is due to the technology simplicity, environmental
friendliness, cost effectiveness, and the abundance of SHP potentials especially pico- and
micro-hydropower systems in the region. Additionally, hydro is a renewable energy source
with minimal emission of greenhouse gases (GHG).

The study opines that adequate power supply impediments in the region will best be tackled
through domestic participation in the design and manufacturing of SHP components and their
production technologies. However, the study revealed that the present dwindling
manufacturing sector in the region cannot adequately support the production of hydro turbine
blades, the most critical component in a hydropower system. The conventional materials for
hydro turbine blades are stainless based. The study further found that locally sourced
materials that their properties could be enhanced through manufacturing and heat treatment
processes should be promoted. Aluminium alloys and their composites are naturally suitable
for aerodynamic applications and corrosion resistance and should be exploited further for
turbine blade application. The study concluded with an investigation of locally sourced
aluminium based materials and manufacturing techniques in the production of a hydro Pelton
turbine bucket.

xxiv
CHAPTER 1: INTRODUCTION

1.1 Introduction

Africa has enormous hydropower potential of about 4,000,000 GWh/year spread throughout
the continent. The distribution of the hydro resources in the region has been described as
technically good for Small Hydropower (SHP) for rural and standalone electrification [1]. Of
this huge potential, which is enough for the power requirements of Africa, only 76,000
GW/year is being generated from a total of 20.3 GW installed capacity. This means that only
6 % of the feasible hydro energy available in Africa has been tapped as against 18 % in Asia,
18 % in South and Central America, 22 % in Oceania, 55 % in North America and 65 % in
Europe [2-4]. Generation of electricity from hydropower is least on the African continent
despite the perennial power problems and the huge SHP potential in the region. In sub-
Saharan Africa (SSA), the rate of average electrification is about 35 %. This situation is
severe in the rural areas where it is below 20 %. Over half of the population has no access to
electricity in 41 countries of Sub-Sahara Africa. Consequently, the region is faced with high
transaction costs, low productivity and efficiency, struggling small and medium enterprises
and sluggish economic growth [5, 6]. Other fallout from this insufficient and erratic power
generation and supply in the region are high rates of unemployment, abject poverty, and
insecurity.

1.2 Research rationale

In 2014 the International Energy Agency (IEA) reported that of the 620 million people of
SSA, about two-thirds have no access to electricity and other modern energy services [7]. It
was also reported that in the region, four out of five people depend on firewood (traditional
biomass) for cooking [8, 9]. The power sector is characterised by gross inadequacies of
generation, transmission and distribution facilities, erratic power supply, and emission of
greenhouse gases (GHG) from fossil fuel power plants. These challenges are coupled with
high cost of power project execution and generation.

1.3 Problem statement

Inadequate manufacturing capacity for small hydropower components and systems in sub-
Saharan Africa.

1
Inadequacies in manufacturing infrastructure has grossly affected the power sector in SSA.
Manufacturing and power are intertwined in such a way that deficiency of one directly affects
the other. Manufacturing is a product of power that needs to give back to the source in a
diversified manner. In this context, energy challenges will exist in the region if domestic
manufacturing is not able to deliver adequate, quality, affordable, and sustainable power
supply. Sub-Saharan Africa is lagging behind in technological advancement. The average
share manufacturing contributed to the gross domestic product (GDP) in 2013 was 11 %
which is equal that of 1990s [10]. Takahiro described the development of manufacturing in
SSA in 2004 as stagnant and that the process of industrialisation has not begun in most
countries [11]. Takahiro stated that manufacturing as a proportion of GDP of SSA in 2004
was about 13 % when South Africa is excluded. South Africa accounts for about 60 % of the
manufacturing in SSA. The World Bank Development indicator shows that manufacturing in
SSA GDP dropped from 17.16 % in 1975 to 11.32 % in 2014 [12]. South Africa is the only
country in SSA that generates and distributes fairly adequate, quality and affordable power.

The low level of manufacturing in SSA is the prime power limiting factor in a region that is
chronically short of electricity. The technical aspects of power production include design,
manufacturing, installation, operation, maintenance and repair of power devices and systems.
Failure of the region to tenaciously develop engineering design and manufacturing of power
equipment, has left the region with gross inadequate and erratic power supply along with
dependence on foreign power equipment, expertise, technology and exorbitantly high costs of
power project execution [5].

1.4 Background to the study

1.4.1 Energy, human existence and national growth

Energy is an indispensable component of human survival, national economic growth, and


promotion of health, manufacturing, security, research and development and transportation.
Adequate access to reliable, quality and affordable energy is a prerequisite and critical to
national security, employment, and acceptable standard of living. Social evolution relies on
energy conversion for human use and energy is a cornerstone to civilisation. Many people still
hold on to the belief that advancement and standard of living are proportional to the quantity,
quality and sustainable energy a society possesses. This pushes many people to accept this
correlation: energy = progress = civilization [13]. The earliest tools such as tools for hunting
animal, catching fish, plant harvesting, processing and moving foodstuffs to where they are

2
needed were products of energy. Subsequently, human existence has been grappling with the
age-old challenge of energy as it is needed to carry out virtually all daily activities.

In the same way that humans cannot do without energy, so it is with a country; no country can
develop without quality, adequate and sustainable energy. From the foregoing, it is clear that
energy is an essential input to all aspects of modern life. The United Nations Millennium
Development Goals (MDGs) recognised that the provision of modern energy services are vital
to the eradication of extreme poverty. To better comprehend the importance of energy in
human and national growth, the IEA recently developed an energy development index which
measures a country’s progress in its transition to modern fuels as well as the degree of
maturity of its energy end-use. After incorporating energy into the production function, the
IEA studies point to energy use as a contributing factor in development, rather than simply an
outcome [14]. In some cases, access to energy is a dividing line between the
poor/undeveloped countries and the rich/developed countries. For any nation to tackle the
problem of poverty, the country needs to provide adequate, quality, affordable and sustainable
energy for its citizens [15]. This explains the wide margin of energy per capita between
developed countries and the undeveloped countries.

1.4.2 Generation of electricity by hydro

The generation of electricity by hydro requires water to be in motion to possess kinetic energy
which strikes and turns the turbine blade. The blade is linked to the generator (alternator) via
a shaft that transmits the rotary motion of the blade to the generator. The generator then
converts the available mechanical energy into electricity. Hydro turbines are broadly
categorised into two types, namely, reaction and impulse turbines [16, 17]. Hydropower is
mainly categorised based on the head, capacity, and source of water, as presented in Table
1.1.

Table 1.1: Classification of hydropower

Capacity (output) Type of flow source Head


Large hydropower (>100 MW) Run-of-river High head (>300 m)
0HGLXPK\GURSRZHU ௅0: Storage 0HGLXPKHDG ௅P
6PDOOK\GURSRZHU ௅0Z Pumped storage Low head less than (<30 m)
0LQLK\GURSRZHU N:௅0: In-stream
0LFURK\GURSRZHU ௅N:
Pico hydropower (<5 kW)

3
There is no international standard of classification, but Table 1.2 presents some countries’
specific classification of small hydropower (SHP) in terms of power output. In this study,
SHP will be used for any small scale hydropower equal to or less than 20 MW, which means
that small, mini, micro and pico hydropower are grouped as SHP.

Table 1.2: Classification of SHP by country

Country SHP (MW)


United States 5-100
Sweden < 15
Norway < 10
India < 25
Europe < 20
China < 50
Canada <50
Brazil < 30

Small hydropower has been identified as a non-polluting, cost effective and environmentally
benign renewable energy source suitable for rural electrification [18, 19]. The use of SHP
schemes for rural electrification can increase access to reliable and adequate energy in the
region. Small hydropower is essential to industrialisation, improving the living standards of
the people, enhancing safety and security, and preserving a healthy environment. To boost
energy accessibility and sustainability sufficiently in SSA requires the region's active
participation in the manufacture of SHP equipment. This step has positive multiplying effects
on power as this will ensure a reduction in the cost of power projects execution compared to
the present cost situation. Further, the ability to design and manufacture will improve
operation, maintenance and parts availability problems and jobs will be created. Adequate
access to power in the region will provoke commercial and industrial activities and
consequently, raise the productivity and standard of living of the people [20, 21]. This can be
achieved through the popularisation and use of SHP technology for rural areas, industrial
estates and standalone electrification rather than the national grid [22].

1.4.3 Basic principles of small hydropower

Small hydropower is associated with the combining of head and flow of a river or any other
water source to produce energy that powers a turbine (hydro machine). The water must flow
to possess energy as still water has no energy and the amount of power that can be generated
is defined by head and the rate of flow. The flowing water is diverted away from the river
through an intake, channelled past a settling basing for desilting and flows to the forebay.
4
From there the water is directed through the penstock to drive the turbine, which subsequently
turns the generator to produce electricity. There are different types of turbines for different
applications. The selection of turbine type to be used is governed by the hydraulic properties
of the water source. Hydro turbines are broadly categorised into two types, namely, reaction
and impulse turbines [16, 17]. The blade is the most vulnerable turbine component because of
the pressure put on it by the striking water.

1.4.4 Turbine materials

The blade converts kinetic energy in a moving water or the linear momentum of a water jet
into rotational motion that turns the alternator for transformation into electrical energy [23].
As a result, blades are constantly under dynamic load, coupled with the aggressive and
notorious environment in which they work. The blades are prone to corrosion and erosion
wear caused by the flowing or impinging jet water that may contain sand and chemically
aggressive elements. Blades are sometimes used in seawater which is the most corrosive of
natural mediums containing corrosive halide reagents such as NaCl and MgCl2. The
compositional content of seawater depends on geographical location and varies over a wide
range, however, the salt content of the world’s oceans is approximately constant, about 3.1 %
[5, 6]. To satisfy both rigidity and environment requirements, stainless steel has been the
common material for buckets coated with epoxy or polyurethane based resins materials [24,
25]. The production of stainless based materials is complex, expensive and huge energy is
required for casting and welding. Production of stainless steels is not adequately supported by
the dwindling manufacturing infrastructure in sub-Saharan Africa (SSA).

1.5 Aim of the study

To analyse key barriers to adequate power supply in SSA, proffer solutions and to exploit
locally sourced materials and production facilities to domesticate SHP technology.

1.6 Objectives of the study

The objectives of the study are summarised as follows:

i. To present the power situation, limitations to adequate, reliable, affordability and


quality power and to discuss the correlation between manufacturing infrastructure and
rate of power accessibility in SSA.

5
ii. To examine and identify simple renewable energy technology schemes to supply
adequate, reliable, affordability and quality power to rural areas and standalone
electrification.

iii. To examine simple renewable energy technology schemes to enhance greater access to
greener energy and energy sustainability that could to be developed domestically to
reduce reliance on foreign technologies in SSA.

iv. To present a simplified and basic design process of SHPs, to accelerate local
fabrication of SHP components and plants in SSA.

v. To advance smart design and development of SHPs and exploitation of locally sourced
material for Pelton turbine bucket production.

vi. To research bulk fabrication technologies for functionally graded materials (FGMs)
that can enhance the mechanical properties of locally sourced aluminium alloys and
composites.

vii. To examine the mathematical correlation that exists between reinforcement particle
and metal matrix of composites produced by means of the centrifugal casting
technique.

viii. To investigate functionally graded aluminium A356 alloy and A356-10%SiCp


composites for hydro turbine bucket production.

ix. To enhance the wear and corrosion resistance of a Pelton turbine bucket surface by
using the centrifugal casting technique and heat treatment.

x. To submit the findings of this study to Department of Higher Education and Training
(DHET) recognised journals and conferences as required by the University of
KwaZulu-Natal for thesis by publication.

1.7 Significance of the study

The significance of the study is as follows:

i. Promotion of domestic design and manufacturing of small hydropower components,


systems and their production technologies in sub-Saharan Africa.

ii. Empowerment of rural dwellers through domestic design and fabrication of SHP
components and systems capacity building in SSA countries.

6
iii. Promotion of the use of locally sourced materials and technology for turbine blade
production.

iv. Promotion and sensitisation of the use of SHP schemes which are simple and cost
effective renewable energy source in SSA for rural and industrial estate electrification.

v. Use of centrifugal casting technique to fabricate and enhance the mechanical


properties of a non-cylindrical part, Pelton turbine bucket.

vi. Development of SHP design charts for smart design of SHP components and systems.

vii. Development of a novel manufacturing technique for Pelton turbine bucket


production.

1.8 Scope of the study

The scope of the study incudes:

i. The analysis of the power situation and barriers to adequate, reliable and affordable
power supply in SSA.

ii. Simplification of SHP components and system design processes and development of
design charts.

iii. Development of a production system for Pelton turbine buckets.

iv. Comprehensive literature review of bulk manufacturing techniques for FGMs.

v. Design and fabrication of a Pelton bucket prototype.

vi. Investigation of locally sourced materials and manufacturing processes for blade
production.

1.9 Thesis layout

Chapter 1 is the introductory part of this study, it provides the rationale, problem statement,
and highlights of the background of the study. It also presents the aim, overall objectives,
significance, scope, and highlights of the study contribution. This thesis is a product of
research publications and conference papers as required by the University of KwaZulu-Natal
for awarding of a doctoral degree. Altogether there are nine publications and/or conference
papers distributed through Chapters 2-9.

Chapters 2 deals with the analysis of power issues in sub-Saharan Africa and is divided into
three sections. Part 1 delves into the main barriers to adequate, quality and affordable power
7
in Africa and explores the relationship between power and level of manufacturing on the
continent. Part 2 discusses domestic participation in SHP design and manufacturing as a key
to overcoming the power challenges in the region. Part 3 advocates SHP as a suitable power
scheme for rural areas and standalone electrification.

Chapter 3 presents a simplified design process of a propeller hydro-turbine.

Chapter 4, deals with functionally graded materials (FGMs) bulk fabrication techniques, their
principles and applications.

Chapter 5, discusses baseline knowledge, applications, and processing parameters of the


centrifugal casting technique.

Chapter 6 discusses the mathematical correlation of functionally graded metal matrix


composite and the centrifugal casting technique.

Chapter 7 deals with the coding of SHP system design and the development of design
parameter charts and modelling and simulation of the Pelton bucket prototype.

Chapters 8 examines functionally graded aluminium A356 alloy and A356-10%SiCp


composite for the production of Pelton buckets.

Chapter 9 presents functionally graded aluminium A390 and A390-5%Mg alloys produced by
the centrifugal casting method and characterised for hydro turbine bucket production.

Chapter 10 draws conclusions and makes recommendations for future works.

8
Bibliography

[1] GSMA, "Tower power Africa: energy challenges and opportunities for the mobile
industry in Africa," GSMA Green Power for Mobile Programme, GSMA, London,
September 2014.

[2] M. C. Lokolo, "Enlightening a continent in the dark – prospects for hydropower


development in Africa," presented at the United Nations Symposium on Hydropower
and Sustainable Development, Beijing, 2004.

[3] T. J. Hammons, N. Pathmanathan and M. Lawrence, "Run of river bulk hydroelectric


generation from the Congo River without a conventional dam," Natural Resources,
vol. 2, pp. 18-21, 2011.

[4] T. J. Hammons, “Harnessing untapped hydropower,” in Electricity Infrastructures in


the Global Marketplace, Chapter 2, InTech, 2011.

[5] International Renewable Energy Agency (IRENA). (2012, 19/03/2015). Prospects for
the African power sector: scenarios and strategies for Africa project. Available:
https://www.irena.org/DocumentDownloads/Publications/Prospects_for_the_African_
PowerSector.pdf

[6] L. Habtamu, "Challenges to entrepreneurial success in Sub-Saharan Africa: a


comparative perspective," European Journal of Business and Management, vol. 7, pp.
22-35, 2015.

[7] International Energy Agency (IEA), "2014 FACTSHEET Energy in Sub-Saharan


Africa today," World Energy Outlook, Paris, 2014.

[8] C. Z. M. Kimambo, "Regional cooperation in academic capacity building – added


value or added challenges?" presented at NUFU-NOMA conference, Dar Es Salaam,
2011.

[9] International Energy Agency (IEA), "World Energy Outlook special report: a focus on
energy prospects in Sub-Saharan Africa," World Energy Outlook, Paris, 2014.

[10] C. Guangzhe, G. Michael and F. Minghui, "Manufacturing FDI in Sub-Saharan


Africa: trends, determinants, and impact," World Bank Group, Washington, 2015.

9
[11] F. Takahiro, "International competitiveness of manufacturing firms in sub-Saharan
Africa: why has the manufacturing sector remained small?" Discussion Paper No. 2,
Institute of Developing Economies, JETRO, Japan, 2004.

[12] WDI, (2016, 24/06/2016). World Development Indicators (WDI), September 2015.
Available: https://knoema.com/WBWDIGDF2015Aug/world-development-indicators-
wdi-september-2015?tsId=2794260.

[13] W. C. James, (2006, 20/01/2013). History of Energy. Available:


http://www.fi.edu/learn/case-files/energy.html

[14] F. Christopher and H. A. Molly, "The potential role of renewable energy in meeting
the Millennium Development Goals,” REN21 Network, Worldwatch Institute, 2005.

[15] U. Etiosa, A. Matthew, E. Agharese, O. G. Ogbemudia, P. U. Osazee and G. O. Ose,


"Energy efficiency survey in Nigeria: a guide for developing policy and legislation,"
Community Research and Development Centre, Benin City, Edo State, Nigeria, 2009.

[16] D. Ugyen and G. Reza, "Hydro turbine failure mechanisms: an overview,"


Engineering Failure Analysis, vol. 44, pp. 136-147, 2014.

[17] Tokyo Electric Power Company (TEPCO), "Micro-Hydro designing," Workshop on


Renewable Energies, Nadi, Republic of the Fiji Islands: Tokyo Electric Power Co.,
2005.

[18] H. Ramos and A. B. de Almeida. (2016, 30/08/2016). Small Hydropower Schemes as


an Important Renewable Energy Source. Available:
http://www.civil.ist.utl.pt/~hr/hidroenergia.pdf.

[19] US. (2006). Wind and hydropower technologies program: advantages and
disadvantages of hydropower. Available:
http://www.envirothonpa.org/documents/19bHydropowerAdvantagesandDisadvantage
s.pdf

[20] W. S. Ebhota and F. L. Inambao, "Electricity insufficiency in Africa: a product of


inadequate manufacturing capacity," African Journal of Science, Technology,
Innovation and Development, vol. 8, pp. 197-204, 2016.

[21] W. S. Ebhota and F. L. Inambao, "Design basics of a small hydro turbine plant for
capacity building in sub-Saharan Africa " African Journal of Science, Technology,
Innovation and Development, vol. 8, pp. 111-120, 2016.
10
[22] O. Paish, "Small hydropower: technology and current status. renewable and
sustainable," Energy Reviews, vol. 6 pp. 537-556, 2002.

[23] A. Priyabrata, K. R. Pankaj and M. Asis, "Selection of hydro-turbine blade material:


application of fuzzy logic (MCDA)," International Journal of Engineering Research
and Applications, vol. 3, pp. 426-430, 2013.

[24] Hydropower Advancement Project (HAP), (2012). Best Practice Catalog: Pelton
Turbine. Available:
http://hydropower.ornl.gov/docs/HAP/MechPeltonTurbineBestPracticeRev2_1.pdf.

[25] International Energy Agency (IEC), "Field acceptance tests to determine the hydraulic
performance of hydraulic turbines, storage pumps and pump-turbines," IEC
International standard 60041, 3rd Ed, 1991.

11
CHAPTER 2: ANALYSIS OF ENERGY ISSUES IN SUB-SAHARAN
AFRICA

This chapter is divided into three parts

Part 1: Electricity Insufficiency in Africa: A Product of Inadequate Manufacturing Capacity

Part 2: Facilitating Greater Energy Access in Rural and Remote Areas of Sub-Saharan Africa:
Small Hydropower

Part 3: Sub-Saharan Africa Power Sustainability: A Function of a Domestic Small


Hydropower (SHP) Design and Manufacturing

12
Part 1: Electricity Insufficiency in Africa: A Product of Inadequate Manufacturing
Capacity

W. S. Ebhota and F. L. Inambao, "Electricity insufficiency in Africa: a product of inadequate


manufacturing capacity," African Journal of Science, Technology, Innovation and
Development, vol. 8, no. 2, pp. 197-204, 2016. DOI: 10.1080/20421338.2016 (published).

13

 
       
 

  

 !" #$$%&' ( !" #$")&*  ( 


 
++,,,-
  - + +
./ !

0   /   


   

1


 



2
/-03 
456-
3

  /
 
       !
"##  !
$# %$&" #'" "# "( & !)$# *"#  )+ (!)
,-,& ).%)/01

  7 /


 &%223  (2 .2144.  10

5"
%*"

" !" 


6"

78 


789

:

"+
9
# 

"
 #"
&%22888 #  2 26"# ;6"9<6


 , 
3=>?7 @ +ABC$D>>?$+$E)=
 E 
4*")$%%
African Journal of Science, Technology, Innovation and Development, 2016
Vol. 8, No. 2, 197–204, http://dx.doi.org/10.1080/20421338.2016.1147206
© 2016 African Journal of Science, Technology, Innovation and Development

Electricity insufficiency in Africa: A product of inadequate manufacturing capacity

Williams S. Ebhota* and Freddie L. Inambao

Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal, Durban, South Africa
*Corresponding author email: [email protected]

Energy availability is fundamental and crucial for human survival and for national economic development. Energy
consumption per capita of a country or region is a measure of quality of life and industrialisation of a country or region.
This to certain extent explains why energy consumption is higher in technologically developed countries than the
developing ones. Africa is faced with chronic power problems and this stalls her economic growth, in spite of availability
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

of vast natural resources in the region. The number of Africans without access to modern energy is over 600 million
and the projected year of adequate power accessibility in Africa is 2080. This study shows that the main hindrances to
access to power in Africa are insufficient continental collective effort, inadequate application of academic based research
findings, inadequate manufacturing infrastructure and overdependence on foreign technology, insufficient human capacity
development and the high cost of power projects in the region. The study went further to identify small hydropower plant
(SHP) technology capacity building to facilitate domestication, establishment of regional energy research institutions,
transformation of research findings into real products, and adoption of Asian developing countries’ energy development
approach as formidable ways of tackling power problems and power sustainability in Africa.

Keywords: consumption, development, energy, manufacturing, power, research, R&D

JEL classification: L94, N67, N77, O55

Introduction human capital, land, natural resources and machinery are


Energy is a basic requirement for every human activity and critical to human welfare and a productive economy. It is
for forming and reshaping human conditions and is vital pertinent to realise that Africa’s economic relevance and
for human survival and national economic growth. But the wellbeing tomorrow depend and are anchored on today’s
developing countries of Africa have been bedevilled with energy R&D. This is because the socioeconomic strength
inadequate access to reliable energy supply and this has of a nation thrives on R&D. The economic future of Africa
led to underdevelopment, poor standards of living, poor dims without massive and strategic energy R&D to lift it
health systems and inadequate safety and security. The from where it is today (Winkler et al. 2011, Mohammed et
figure of Africans without access to modern energy is al. 2015, Ocampo 2005).
over 600 million and the projected year of adequate power
accessibility in Africa is 2080 (Ebhota, Eloka-Eboka, and Methodology
Inambao 2014, APP 2015). Human existence may no The methodology of this article is to draw on quantitative
longer be possible without energy because virtually every Africa energy situation studies, highlight the fundamental
activity that makes it possible needs energy. Some of these issues of access to affordability and quality energy and
activities are shown in Table 1. The same way as energy is discuss possible remedies to the key issues. The article
to man (no energy, no existence), so also it is to national considers and discusses the following as instruments to
growth (no energy, no industrialisation). tackle inadequate access to electricity in Africa: building
$ VFLHQWL¿F ¿QGLQJ RI GLIIHUHQW ZD\V IRU JRRGV DQG capacity for small hydropower (SHP) infrastructure; the
services delivery in industries, homes, and businesses, and establishment of regional energy research institutions;
investing in better paths to improving existing products,
services and production processes is termed research and Table 1: Energy needs for human activities (Ebhota,
development (R&D) (Encarta 2009). R&D could also be Eloka-Eboka, and Inambao 2014)
GH¿QHGDVDPHWKRGLFDOSURFHVVRIGDWDDQGLQIRUPDWLRQ Energy need category Activities
collection for the purpose of closer study for advancement Industrial/ Small to medium, industries, business,
RINQRZOHGJHLQDSDUWLFXODU¿HOG,WDWWHPSWVWRORJLFDOO\ commercial establishments (shops, offices, banks,
restaurants, bakeries etc.).
look for answers to intellectual and technical questions Domestic Cooking, lighting, domestic water
through the use of systematic methods. R&D products are pumping and distribution, television
basic discoveries and new principles or facts yet unknown and radio powering, water heating,
or unrecognised, which in most cases, are targeted to refrigeration, etc.
improving and safeguarding human existence. Agriculture Water pumping and distribution for
irrigation, drying, operation of various
(QHUJ\DYDLODELOLW\DQGFRVWDUHVLJQL¿FDQWSDUDPHWHUV agricultural equipment, etc.
IRU LQGXVWULHV¶ SUR¿WV DQG LQQRYDWLRQ LV WKH HQJLQH WKDW R&D Power laboratories, research
drives growth. Access to all forms of clean and reliable institutions, etc.
energy, especially electricity, is key to the economic and Community Hospitals, clinics, schools, barracks,
social development of a country. Energy coupled with prison houses, etc.

African Journal of Science, Technology, Innovation and Development is co-published by Taylor & Francis and NISC (Pty) Ltd
198 Ebhota and Inambao

adopting Asian developing countries’ energy development ,QVXE6DKDUDQ$IULFDWKHDYHUDJHUDWHRIHOHFWUL¿FDWLRQ


approach; and transformation of research findings into real is about 35%. This situation is severe in the rural areas
products. and is below 20%. Over half of the population has no
access to electricity in 41 countries of sub-Saharan Africa.
Africa and energy potential Consequently, the region is faced with high transaction
The presence of untapped energy resources, from fossil-based FRVWV ORZ SURGXFWLYLW\ DQG HI¿FLHQF\ VWUXJJOLQJ VPDOO
to renewable, for the generation of affordable electricity and medium enterprises and dwindling sustainable growth
in Africa is vast. Table 2 presents untapped renewable (IRENA 2012, Habtamu 2015).
energy sources in Africa with about 1 526 785 GWh hydro
potential in Congo River and the Upper Nile. The hydro Comparison of energy situations in Africa
energy potential on the continent, which is the least costly The total amount of power generated in the 49 countries
of renewable energy solutions today, is enormous. Other of sub-Saharan Africa with a population of about 1 billion
renewable energy sources that are in reasonable commercial is approximately the same amount of power generated
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

quantities in Africa are solar, onshore wind, biomass and by Spain with a population of 45 million (KPMG 2014).
geothermal energy (IRENA 2012). The power consumption in the region is barely 100 W per
This paper will focus more on hydropower because of its person, 3 hours a day.
advantages over other renewable and non-renewable sources Southern Africa has the highest power generation per
of energy. The main advantages include the following: capita and experiences least power outages, as presented in
• The technology is mature and reliable Figure 1. In 2007–2008, power outages were very high in
• It is a clean energy source Congo Democratic Republic and Angola.
• Its construction, maintenance and operation costs are Over half of the population has no access to electricity
comparatively low. in 41 countries of sub-Saharan Africa (IRENA 2012). The
Only 6% of the feasible hydro energy available in scenario of power accessibility is almost the same in the
Africa that has been tapped as against 18% in Asia, South countries of Sub Sahara Africa. Figure 2 shows selected
and Central America 18%, Oceania 22%, North America countries in the region and it presents Togo, Gabon and
55% and Europe 65% (Hammons 2011, Lokolo 2004). Zimbabwe leading the chart of countries with a very low
This means that hydro power development is the least in rate of access to power.
Africa and this gives viable opportunities to hydro power The amount of electricity generated in the different
developers to invest in Africa. regions is shown in Table 4. It is crystal clear from the

Energy generation and power infrastructure


performance in Africa Niger
Sub-Saharan Africa’s installed electricity generation South Africa

capacity is appromately 70 000 MW, of which 44 000 MW Zambia


Nigeria
is installed in South Africa (KPMG 2014). The effective
Zimbabwe
power generation has dropped drastically below the
Ghana
installed capacity as a result of aging power infrastructure, Ethiopia
however. Table 3 shows power infrastructure in the Gambia
different regions of Africa and its performance. Most of Angola
the present infrastructure was installed in the 90s and is Congo De Rep

currently bedevilled with increasing costs of maintenance 0 20 40 60 80 100 120 140 160 180 200

and frequent outages. According to the World Bank report NUMBER OF DAYS

on Africa’s infrastructure, short-term Africa power need is Figure 1: Days of power outages per year 2007–2008 (Dayo
put within the range of 70 000 MW (KPMG 2014). 2008)

Table 2: Some of untapped renewable energy in Africa (IRENA 2012; IEA 2010; Hammons 2011)
Untapped renewable Quantity
Where they are predominantly found
energies in Africa (GWh)
Hydro 1 526 785 Congo River and the Upper Nile
Wind (onshore) 1 750 North-West Atlantic coast, the Red Sea, the Horn of Africa, South Africa and Namibia
Geothermal 7–15 East African Rift Valley (Kenya and Ethiopia)

Table 3: Power infrastructure performance in the different regions of Africa (AFDB 2013)
Region ECOWAS CEMAC COMESA EAC SADC
Installed generation capacity (MW) 3 912 583 1 085 774 9 855
Net generation per capita (kWh/capita/year) 171 147 114 82 1 214
Outages number annually (day/year) 165 152 119 132 91
Outages value lost annually (% of sales) 7 5 7 8 2
Firms with own generator (%) 54 51 43 56 19
Collection rate of electricity (% of billing) 71 93 93 94 89
ECOWAS: Economic Community of West African States; CEMAC: Economic and Monetary; Community of Central Africa; COMESA: Common
Market for Eastern and Southern Africa; EAC: East African Community; SADC: Southern African Development Community
African Journal of Science, Technology, Innovation and Development 199

70 The pie chart in Figure 3 represents the net energy


60
generation per capita in the different regions of Africa
% POPULATION

50
and Figure 4 shows the electrical energy production and
40
consumption per capita of selected world countries.
30
In 2014, it was reported by KPMG (Table 5) that
20
South Africa annual energy per capita was 4 241.30 kWh
10
(KPMG 2014).
0

Comparison between population growth and


electricity production
As it stands today, power accessibility in Africa is in a
pitiable state. The situation does not correspond with the
Figure 2: Population without electricity access in sub-Saharan interventions, both domestic and international, that have
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

Africa (IRENA 2012) been made to stabilise the power sector. Table 6, shows
a steady growth in population and unsteady growth in
¿JXUHVWKDWRYHUWKHODVWWKUHHGHFDGHVQRWPXFKKDVEHHQ electricity consumption per capita. In 2004, the electricity
achieved in power generation in Africa. consumption per capita was 531 as against 735 × 106 total
In 2009, the per capita rate of energy consumption in population and dropped to 525 as against 855 × 106 total
sub-Saharan Africa excluding South Africa was 153 kWh, population in 2010.
against India’s 640 kWh and the world’s 2 730 kWh. The The difference in the degree of growth between
different values of per capita rates from 2007 to 2008 of population and electricity is shown in Figure 5. For
countries in the different regions is shown is Figure 3. Sub-
Saharan Africa has the world’s lowest electricity access South Africa
rate, at only 26%. The rural electricity access rate is only Libya
Egypt
8%, with 85% of the population relying on biomass for Algeria
energy (UNEP 2012). Morocco
Ghana
Nigeria

Table 4: Regional shares of electricity generation (1973 & Canada


2010) (IEA 2012) USA
France
Region 1973 (%) 2010 (%) Increase (%) Japan
Germany
Non-OECD Europe and 16.7 7.9 -8.8
Eurasia Australia
China 2.8 19.8 17.0 Taiwan
South Korea
Asia 2.6 9.7 7.1
Non-OECD America 2.5 5 2.5 Paraguay
Africa 1.8 3.1 1.3 Venezuela
Chile
OECD 73.1 50.7 -22.4 Argentina
Middle East 0.5 3.8 3.3
0 2 4 6 8 10 12 14 16 18 20
kWh/cap
KwH/capita/year Production kWh/cap Consumption kWh/cap

Figure 4: Electrical energy production and consumption per


30 capita of selected world countries (Dayo 2008)
30
Table 6: Population and electricity growth in sub-Saharan
20 (Economics 2015a, 2015b)
15 Electric power
Total Electricity
Year consumption
population production (kWh)
(kWh/capita)
265 2004 735 × 106 395 × 109 531
2005 750 × 106 400 × 109 533
2006 775 × 106 415 × 109 535
2007 795 × 106 418 × 109 526
2008 810 × 106 429 × 109 530
ECOWAS CEMAC COMESA EAC SADC
2009 830 × 106 427 × 109 517
Figure 3: Net generation per capita in Africa 2010 855 × 106 449 × 109 525

Table 5: Selected country profiles, 2014 (KPMG 2014)


Country Population (million) Installed capacity (MW) Power produced (TWh) Annual kWh per capita
Kenya 45.5 2,326.70 9.302 178.2
Mozambique 25.8 4,110 23.715 527.7
Nigeria 178.5 11,542.20 31.723 162.3
South Africa 53.1 49,578.90 251.328 4,241.30
Zambia 15 2,130 12.742 708.8
200 Ebhota and Inambao

9.00E+11 • High loss caused due to lack of operational competence


8.00E+11 and low revenue generation
7.00E+11 • Power losses (about 25%) caused by ineffective
6.00E+11 infrastructure of transmission and distribution
5.00E+11 • Politically motivated tariffs
4.00E+11
• Power industry unfavourable policies and regulations
3.00E+11
to private sector investment
2.00E+11
• Additional funding required to meet international
1.00E+11
environmental emission legislation and standards
0.00E+00
2004 2005 2006 2007 2008 2009 2010
• Inadequate funding to take care of development
Total population Electricity production (kWh)
expenses of viable projects
• Inadequate expertise to develop and execute projects
Figure 5: Population growth versus electricity production • Population growth influences, etc.
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

(kWh) in sub-Saharan Africa (Economics 2015; 1a, 2015; 1b)


Population growth without corresponding power
adequate power accessibility, the growth between the infrastructure growth
two must be simultaneous in a direct proportion pattern. Energy requirements are proportional to the size of the
Figure 5 compares the growth in population and electricity population of a given country. It has been reported that the
generated from 2004 to 2010. population of Africa will increase by 1.3 billion between
3RSXODWLRQ JUHDWO\ LQÀXHQFHV WKH DPRXQW RI HQHUJ\ 2013 and 2050 – the highest compared to other regions of
needed and is one the main factors responsible for the the world (Carl and Toshiko 2013). Figure 7 shows the
unsteady electricity consumption per capita. Figure 6 shows different regions of the world’s population projection.
the unsteady nature of electricity consumption per capita. This will have a lot of implications for power demand. To
ensure that Africans have adequate access to power, power
Factors responsible for power problems in Africa infrastructure needs to be improved correspondingly.
It is heartbreaking knowing that the power problems
in Africa are much as they were two decades ago. The Inadequate manufacturing infrastructure and over
challenges are conspicuously present; in some areas the dependence on foreign technology
problem has deepened despite the efforts and resources that Overdependence on foreign expatriates, power generation
have been expended trying to fix the sector. The challenges and distribution equipment are responsible for the high
are numerous and peculiar to different countries, but cost of power projects. The cost of power equipment is
this article addresses the challenges peculiar to African higher in Africa; on average it is put at twice the cost in
countries. Some of the causative elements are (Mohammed China (IRENA 2012).
et al. 2015, KPMG 2014): The region’s inability to manufacture has caused
• Population growth without corresponding power real problem in the sector. The technical (engineering
growth and technology) jobs in the power sector can be broadly
• Insufficient national and continental collective effort FODVVL¿HGLQWR
• Research results are not being used appropriately (1) Design
• Inadequate in manufacturing infrastructure and over (2) Manufacturing
dependence on foreign technology (3) Installation
• Insufficient human capacity development (4) Operation
• High cost of power projects in region (5) Maintenance.
• Under-utilisation of installed generation facilities due Inadequacies in design and manufacturing affect (3–5)
to low and inadequate maintenance negatively. However, the ability to do (1) and (2) guarantees
• High cost of primary energy to fuel present and new (3–5) capability. It is obvious that the region has failed to
build assets develop engineering design and manufacturing to the level
CONSUMPTION (kWh per capita)

580 5.3
POPULATION (BILLIONS)

560 4.3
540
520
2.4 2.4
500
480 1.1
0.9 0.8 0.7 0.7
0.6
460 0.4 0.4

440
All Africa S-Saharan Caribbean Asia North Europe
Africa America

2013 population 2050 population

Figure 6: Electric power consumption (kWh per capita) in Figure 7: Regions of the world population projection (Carl and
sub-Saharan Africa (Economics 2015b) Toshiko 2013)
African Journal of Science, Technology, Innovation and Development 201

where manufacturing of power equipment can be supported Research Framework Programme was proposed with the
adequately. This study tried to establish the number of PDQGDWHRISD\LQJDWWHQWLRQWRVSHFL¿HGUHVHDUFKQHHGVRI
PDQXIDFWXULQJ ¿UPV LQ WKH UHJLRQ ZLWKRXW VXFFHVV ,W range of energy options that will be economically viable in
therefore, concludes that power generating equipment short, medium and long terms basis (Commission 2006).
PDQXIDFWXULQJ¿UPVLQWKHUHJLRQDUHJURVVO\LQDGHTXDWH
The missing link
Insufficient and incoherent regional collective effort Over the years, solutions to the power challenges in Africa
There seems to be no purposeful and well driven energy have been propagated, evaluated and re-evaluated without
development strategy among countries in the region in significant implementation. The identified problems
practical terms. Though the leaders in the region have had and suggested research-based solutions are not linked
several joint power development programmes, there was sufficiently. Until they are linked adequately, the problems
no commitment to the implementation. This is evident will not only remain, but will increase in magnitude.
from the amount of electricity produced in Africa between 5HÀHFWLQJ WKH DFKLHYHPHQWV LQ SRZHU SURGXFWLRQ
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

1973 and 2010 as presented in Table 7. made by Asian countries, the missing link can easily be
LGHQWL¿HG ,Q &KLQD WKH VXFFHVV ZDV DWWULEXWHG WR VHOI
Disconnection between researchers and the government construction, self-management and value added tax on
The assemblage of energy intellectuals in energy electricity; 6% for SHP and 17% for large hydropower.
conferences, workshops and seminars in the region There were heavy investments in the manufacture of a
over the years has not significantly addressed the solar module in Malaysia. In other words, the research
power problem. These exercises, including journal results were developed into physical solutions and
publications of energy research results and postgraduate developmental energy policies were implemented. For the
and undergraduate research seem to be mere academic case of developing countries in Asia, Figure 8 shows the
exercises for individual and institutional academic growth. relation between problem and solution.
This happens because most governments in the region The developing countries in Africa have a different
have not adequately partnered with academic researchers scenario. Figure 9 represents the African scenario. The
in proffering lasting solutions to these problems. Quite development and policy implementation in Africa involves
a number of these researchers fund their research and massive purchase of foreign technologies and hiring of
this has caused disconnection and ultimately they affect expatriates for every aspect of the process (installation,
development of the research results into real solutions. The operation and maintenance).
results are lying and piling up in the archives. What are
the results doing in the archives? This is one of the many Energy R&D activities and power intervention
factors responsible for persistent energy issues in Africa. programmes in Africa
The region has not been able to fuse research and
GHYHORSPHQW SURSHUO\ DQG LW KDV EHHQ GLI¿FXOW IRU WKH Conferences and journal papers
region to action power policies that are knowledge-based Energy R&D activities in Africa seem to have only the
to the letter, unlike European countries that jointly fund R (research) and the D (development) is in oblivion, or
energy R&D and implement policies that will advance the missing, or the level of its activity makes it insignificant.
UHJLRQ 7KH\ VKRZ DGHTXDWH ¿QDQFLDO FRPPLWPHQW DQG The research is massive across Africa and energy
political will to the course. conferences (refer to Table 8), workshops and seminars
In Europe and America there are regional institutions are held annually in different parts of Africa. This has been
with different energy research mandates that are heavily occurring for over two decades and has availed Africans
funded. For example in 2006, the Seventh European the opportunity to discuss energy problems and solutions
and cross-pollinate ideas explicitly. Accordingly, many
Table 7: Regional shares of hydro production (1973 & 2010) energy studies have been published in high profile journals
(IEA 2012) and a high number of unpublished undergraduate and
Region 1973 (%) 2010 (%) Increase (%) postgraduate dissertations are centred on energy studies.
Non-OECD Europe and 11.6 8.9 –2.7 Despite these efforts and attempts to eradicate or ameliorate
Eurasia energy challenges in Africa to an acceptable level, the
China 2.9 20.5 17.6
Asia 4.3 7.5 3.2
issues still persist, and in some areas have deepened.
Non-OECD America 6.8 19.1 12.3
Africa 2.2 3.1 0.9 Government efforts
OECD 71.9 40.5 –31.4 Power production is a priority for governments of
Middle East 0.3 0.5 0.2 Africa and a very huge part of the annual budget is

Develop,
Problem Research Results manufacture and/or Solution
implement

Figure 8: Relation of problem and solution in Asia


202 Ebhota and Inambao

(a)

Problem Research Results Solution

(b) Insufficient
development and policy
implementation;
Problem Research Results Foreign technology with Solution
inflated cost
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

Figure 9: Relation of problem and solution in the African scenario

always appropriate for it. But it seems that the delivery Africa (Ogunlade and Stanford 2004). In the mid-1990s,
is not commensurate with the funding. Apart from giving public and private sources of aid to Africa for power
power a priority in the annual budget, some power sector development was put at US$600 million annually. China,
restructuring has equally been carried out. This is part India and the Arab States have recently joined significant
of repositioning the sector for better delivery in terms donor countries to Africa for power development.
quantity and quality. The World Bank has 48 power-related projects going
The activities of government in the power sector on presently in Africa and these include increased access
in most countries of Africa have been discretised for to power and rehabilitating war-torn grids. Despite this aid,
the purpose of simplicity and quick response. In some it has been reported that for Africa to increase access to
countries, a ministry of power coordinates the activities SRZHUVLJQL¿FDQWO\E\WKHDLGQHHGVWREHGRXEOHG
while agencies and parastatal are created and saddled with (World Bank 2015). Additional international assistance on
VSHFL¿FPDQGDWHV power projects in Africa are presented in Table 9.

International aid for power Campaign promises


The western world has been supporting Africa with The power issue in Africa is one of the areas that the political
different types of power development aid for a very long class pick on to make promises during campaigns. They will
time. One such is the Oversea Development Assistance always give high hopes of fixing the mess in the sector and
(ODA) targeted at pro-poor programmes in sub-Saharan very often it has turned out to be a mere political promise.

Table 8: Some Africa-based energy related conferences for 2015 (Altenergymag 2015, Conal 2015).
S/N Conference Place Date
1. Powering East Africa Nairobi, Kenya March 25–27, 2015
2. CSP Today South Africa 2015 Cape Town, South Africa April 21–22, 2015
3. Solar & Off-Grid Renewables West Africa Conference Accra, Ghana April 21–22, 2015
4. 4th Power & Energy Africa 2015 Nairobi, Kenya April 27–29, 2015
5. Powering Africa: Mozambique 2015 Maputo, Mozambique May 7–8, 2015
6. African Utility Week 2015 Cape Town, South Africa May 12–14, 2015
7. Clean Power Africa 2015 Cape Town, South Afric May 12–14, 2015
8. Energex Africa 2015 Johannesburg, South Africa May 20–22, 2015
9. Africa Future Energy Forum Nairobi, Kenya May 27–28, 2015
10. Africa Energy Forum 2015 Dubai, UAE June 8–11, 2015
11. 2nd Annual Wind Energy Summit Cape Town, South Africa March 16, 2015
12. SASEC 2015: 3rd Southern African Solar Energy Conference Skukuza, South Africa May 11, 2015
13. Solar PACES 2015 – Concentrating Solar Power and Chemical Energy Cape Town, South Africa October 13, 2015
Systems
14. 26th ICDE World Conference Sun City, South Africa October 13, 2015

Table 9: Additional International Assistance on Power (Fortune and Collins 2014, KPMG 2011, OPEC 2010)
International Donors Project Amount
World Bank/IDA Ugandan Energy for Rural Transformation Project II US$75 million
IBRD, CTFM, AfDB and Agense Francaise de Development Sere 100 MW wind farm project in South Africa US$350 million
World Bank, DEG, AfDB and other partners Bujagali 250 MW hydro power plant in Uganda US$250 million
Chinese Bank and DBSA Kariba North Expansion Project (KNBEP) in Zambia US$430 million
World Bank and OPEC Energy Development and Access Project (EDAP US$118 million
APL-2) in Mozambique
German Investment Corporation, European Development OLKARIA III geothermal project in Kenya US$119.7 million
Finance Institutions and smaller donors
African Journal of Science, Technology, Innovation and Development 203

Factors that guarantee energy sustainability 2014). Exchange energy technology programmes should
Provision of adequate, affordable, reliable and quality be encouraged and strengthened among member states.
energy services that satisfy social, economic and
environmental requirements defines energy sustainability Adopting the approach of Asian developing countries
(Fortune and Collins 2014). The success of energy Small hydropower (SHP)
sustainability in Africa depends on several factors and In the case of China’s 20 years commitment to SHP for
some of the steps favourable to energy sustainability are rural electrification, in 2004 the total of SHP installed was
discussed below (WEC 2005). put at 34 GW and this amount was increased to 38 GW
in 2005. The percentage generation growth from 2000
Building capacity for small hydropower (SHP) in Africa (25 GW) to 2005 (38 GW) was reported to be 52%. This
“Infrastructure plays critical and positive role in economic achievement reflects the determination and strong political
development and it interacts with the economy through will of the government, acceptance and level of adoption of
multiple and complex processes” (Ebhota, Eloka-Eboka, the technology. The success was equally attributed to self-
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

and Inambao 2014). One of the ways to overcome the construction, self-management and the value added tax
electricity problem in sub-Saharan Africa is through on electricity, 6% for SHP and 17% for large hydropower
technology domestication approach. Massive indigenous (Oparaku 2007, Altinbilek, Seelos, and Taylor 2005).
capacities in SHP technologies should be built to facilitate
rapid local manufacture of SHP facilities. Solar photovoltaics (PV)
Building local design and manufacturing capabilities in China’s policy and implementation on PV were similar
power generation and distribution technologies (especially to that of SHP. In Malaysia, favourable conditions were
SHP), will provoke an increase in local content of power created for the development through a rural electrification
generation, transmission and distribution projects. This programme. This prompted the partnership between BP
will lead to project cost reduction, availability of parts, solar and an indigenous company to set up a module
adequate operation and maintenance personnel, more manufacturing plant of 5 MWh/year in the country. Again,
job creation and make power sustainability a reality. Malaysia in 2005 invested in the Building of Integrated
Sub-Saharan Africa needs to build capacity in SHP Photovoltaics (BPV) with the United Nation Development
design, production, and development of local materials Programme (UNDP) and Global Environmental Facility
for renewable energy devices applications for her own providing 80% of the cost (Oparaku 2007).
economic growth (Sambo 2005).
Although, some African countries have started Transformation of research findings into real products
promoting domestic manufacturing of power equipment, The relevance of academic research work is a function
the rate is not close to the enormous problems in the power of the problem the research is directed to and it becomes
sector. There is a wind turbine producer in Egypt, Senegal effective if the application of its findings leads to expected
is strengthening the operations of her power organisation end. The research finding needs to be developed to a level
to be able to satisfy the demands of neighbouring countries before it can be applied to real life situation, otherwise it
(like Mali, Guinea and Niger), NASENI in Nigeria is becomes ineffective. The development could be in form of
manufacturing solar PV, and Algeria is in partnership with manufacturing or policy implementation or both. But it is a
a German company to produce solar PV equipment as well. mere academics exercise when the research results are kept
A lot of effort and resources need to be put into this because in the archives without development. All the renewable
local content development is crucial component for fast energy academic research work should coordinated and
growth of power infrastructure and sustainability in Africa. re-evaluated to find feasible lasting solutions to the power
perennial problems in Africa. Funds should be provided
Establishment of regional energy research institutions and monitored to move researches from mere academic
Like the western world, the countries of Africa should exercises to industries for transformation into real products
employ the advantages of synergy and jointly establish (solutions) and to the market for wealth creation.
energy research institutions with specific mandates. The
framework of this programme should cover the present The roles of assemblage of energy research intellectuals
and future of the region’s entire energy system. The in energy sustainability
programme should be technologically driven with set The coming together of energy researchers and experts in
indicators that will better use human and infrastructure form conferences, seminars and workshops in the region
resources in both public and private investments in the should include:
member states. (1) Harmonising energy technologies, across ideas and
The programme’s responsibility will include policies suggested by authors in their research
the provision of adequate fund for researchers, data  ,GHQWL¿QJIHDVLEOHDQGPDUNHWDEOHHQHUJ\WHFKQRORJLHV
harmonisation and transfer of research results to the (3) Evaluating the growth using the set key performance
industries, market and decision-makers for implementation indicators by the regional leadership
considerations. (4) Reviewing regional position on energy development
The complexity of modern technology requires (5) The energy experts should have a harmonised energy
synergy and combination of the different innovations of position and push it to the regional governments for
dissimilar disciplines (Ebhota, Eloka-Eboka, and Inambao implementation.
204 Ebhota and Inambao

Conclusion Encarta. 2009. Research and Development. In Encarta Premium


Energy is fundamental in shaping human and economic Encyclopedia Microsoft
conditions and is crucial for human survival and national Dayo, Felix B. 2008. Clean Energy Investment in Nigeria.
International Institute for Sustainable Development.
economic growth. The magnitude of energy consumption Manitoba: IISD.
per capita of a country or region reflects directly on the Fortune, Ganda, and C. Ngwakwe Collins. 2014. “Problems
quality of life and industrialisation of that country or of Sustainable Energy in sub-Saharan Africa and Possible
region. Access to energy separates the underdeveloped Solutions.” Mediterranean Journal of Social Sciences 5 (6):
countries from the developed ones. This explains why 453–463.
Habtamu, Legas. 2015. “Challenges to entrepreneurial success in
energy consumption is higher in technologically developed sub-Saharan Africa: A comparative perspective.” European
countries than the developing ones. Journal of Business and Management 7 (11): 22–35.
In most countries of Africa, power (electricity) demand Hammons, T. J. 2011. “Harnessing untapped hydropower.” In T.
by far outstrips the supply and this same undersupply is J. Hammons (ed.), Electricity infrastructures in the global
equally erratic. The continent is faced with a chronic marketplace, 79–139. Rijeka, Croatia: InTech.
Haub, Carl, and Kaneda Toshiko. 2013. World Population Data
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 01:12 23 June 2016

power problem and this has deterred her economic Sheet Population Reference Bureau, Washington, DC, USA.
development programmes, notwithstanding the availability IEA. 2010. “Renewable Energy Essentials: Hydropower.” http://
of enormous natural resources in the region. Some of the www.iea.org/publications/freepublications/publication/
KLQGHULQJIDFWRUVDUHLQVXI¿FLHQWQDWLRQDODQGFRQWLQHQWDO hydropower_essentials.pdf.
collective efforts, research results not being used IEA. 2012. “Key World Energy Statistics.” The International
Energy Agency. https://www.iea.org/publications/
appropriately, inadequate manufacturing infrastructure freepublications/publication/KeyWorld_Statistics_2015.pdf
DQGRYHUGHSHQGHQFHRQIRUHLJQWHFKQRORJ\LQVXI¿FLHQW IRENA. 2012. Prospects for the African Power Sector. Masdar
human capacity development and the high cost of power City, Abu Dhabi, United Arab Emirates: IRENA. https://
projects in the region. In tackling these power problems www.irena.org/DocumentDownloads/Publications/
and for sustainability, the continent needs to build capacity Prospects_for_the_African_PowerSector.pdf
KPMG. 2014. “Sub-Saharan Africa Power Outlook 2014.”
for small hydropower (SHP), establish regional energy Africa Infrastructure & Major Projects Group. http://www.
UHVHDUFKLQVWLWXWLRQVWUDQVIRUPUHVHDUFK¿QGLQJVLQWRUHDO kpmg.com/ZA/en/IssuesAndInsights/ArticlesPublications/
products, and adopt Asian developing countries’ energy General-Industries-Publications/Documents/2014%20
development approach. Sub-Saharan%20Africa%20Power%20Outlook.pdf.
Lokolo, Michel Claude 2004. “Enlightening a Continent in the
Dark – Prospects for Hydropower Development in Africa.”
Acknowledgement United Nations Symposium on Hydropower and Sustainable
The authors hereby acknowledge the Centre for Engineering Development Beijing, 27-29 October.
Postgraduate Studies (CEPS)/HVDC/Smart Grid Centre of the Mohammed, Modu Aji, Gutti Babagana, K. Highina Bitrus,
University of KwaZulu-Natal. and A. Hussaini ustapha. 2015. “Challenges to Energy
Sustainability in Nigeria as a Developing Nation and the
References Way Forward.” Applied Research Journal 1 (2): 46–50.
AFDB. 2013. State of Infrastructure in East Africa. Tunisia: Ocampo, José Antonio. 2005. “The Path to Sustainability:
Statistics Department Africa Infrastructure Knowledge Improving Access to Energy.” Energy & Environment 16
Program. (5): 737–42. doi:10.1260/095830505774478585.
Altenergymag. 2015. “Alternative Energy Event Calendar: Ogunlade, Davidson, and A. Mwakasonda Stanford. 2004.
Alternative Energy Africa “ Accessed 21/03/2015. http:// Electricity Access to the Poor: A study of South Africa and
www.altenergymag.com/events.php. Zimbabwe. Cape Town: Energy and Development Research
Altinbilek, Dogan, Karin Seelos, and Richard Centre, University of Cape Town.
Taylor. 2005. “Hydropower’s Role in Delivering Oparaku, O. U. 2007. Decentralised Power Generation in
Sustainability.” Energy & Environment 16 (5): 815–24. Nigeria: Role of Renewable Energy Resources. Proceedings
doi:10.1260/095830505774478503. of the 1st International Workshop on Renewable Energy for
APP, Africa Progress Panel. 2015. Power People Planet: Seizing Sustainable Development in Africa (IWRESDA), University
Africa’s Energy and Climate Opportunities. In Africa of Nigeria, Nsukka, Nigeria.
Progress Report Geneva, Switzerland. OPEC. 2010. World Oil Outlook. Vienna: Organization of the
World Bank. 2015. Fact Sheet: The World Bank and Energy in Petroleum Exporting Countries.
Africa. Sambo, A. S. 2005. “Renewable Energy for Rural Development:
European Commission. 2006. Energy Futures: The Role of The Nigerian Perspective.” ISESCO Science and Technology
Research and Technological Development. Brussels: Vision 1.
Directorate-General for Research, Information and UNEP. 2012. Financing renewable energy in developing
Communication Unit. countries. Geneva: UNEP.
Conal. 2015. “Conferences in South Africa.” http://www. WEC, World Energy Council. 2005. “Delivering Sustainability:
conferencealerts.com/ Challenges and Opportunities for the Energy Industry.”
Ebhota, W.S., A.C. Eloka-Eboka, and F. I. Inambao. 2014. Energy & Environment 16 (5): 722–728.
“Energy Sustainability through Domestication of Energy Winkler, Harald, André Felipe Simões, Emilio Lèbre la Rovere,
Technologies in Third World Countries in Africa.” Industrial Mozaharul Alam, Atiq Rahman, and Stanford Mwakasonda.
and Commercial Use of Energy (ICUE), 2014 International 2011. “Access and Affordability of Electricity in Developing
Conference on the Energy efficiency in buildings, Cape Countries.” World Development 39 (6): 1037–1050.
Town. 10.1109/ICUE.2014.6904197. doi:10.1016/j.worlddev.2010.02.021.
Economics. 2015a. Electric power consumption (kWh per capita)
in sub-Saharan Africa. http://www.tradingeconomics.com/
sub-saharan-africa/electricity-production-kwh-wb-data.html
Economics. 2015b. Total Population in sub-Saharan Africa.
http://www.tradingeconomics.com/sub-saharan-africa/
population-total-wb-data.html
Part 2: Facilitating Greater Energy Access in Rural and Remote Areas of Sub-Saharan
Africa: Small Hydropower

W. S. Ebhota and F. L. Inambao, "Facilitating greater energy access in rural and remote
areas of sub-Saharan Africa: small hydropower," Energy & Environment, p.
0958305X16686448, 2017. (Onlinefirst).

15
Facilitating Greater Energy Access in Rural and Remote Areas of
Sub-Saharan Africa: Small Hydropower

Williams S. Ebhota1 and Freddie L. Inambao2


1
Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal,
Durban, South Africa; [email protected]
2 Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal,
Durban, South Africa; [email protected]
Correspondence: [email protected]

Abstract௅Flowing water has hydraulic energy that can be transformed into electrical energy.
Sub-Saharan Africa (SSA) has an abundance of hydro resources that are untapped. In this
study, various barriers limiting the use of small hydropower to tap the abundant hydro
potentials for power generation are discussed. These barriers include insufficient fund; lack of
adequate manufacturing infrastructure; lack of adequate power generation and distribution
policies; inaccurate hydrological data; insufficient human and power infrastructure capacities;
and, inadequate domestic and regional participation in design and manufacture of SHP
component devices and systems. This study sees hydro as a cleaner energy source and SHP as
the best power system for rural and remote areas and for stand-alone electrification. For
power sustainability in the region, public-private partnership (PPP), domestication of SHP
technologies, and less reliance on foreign technologies and international support are key
factors.

Index Terms: Sub-Saharan Africa; Characterisation; Crossflow; Hydropower, Manufacturing


processes; Turbine blade; Small hydropower barriers; Small hydropower policies

2.2.1 Introduction

In a 2014 factsheet the International Energy Agency (IEA) reported that two-thirds of SSA’s
population of around 620 million people has no access to electricity and other modern energy
services [1]. And in the region, four out of five people depend on firewood (traditional
biomass) for cooking [2, 3]. The power sector is typified by gross inadequacies of generation,
transmission and distribution infrastructure, poor quality power supply, and emission of
greenhouse gases (GHG) from fossil fuel power plants. These challenges are coupled with
high the cost of power projects and generation.

16
Africa is blessed with enormous hydropower potentials, put at about 4,000,000 GWh/year.
The distribution of hydro resources in the region can be described as technically good for
SHP for rural and standalone electrification [4]. Of this huge potential, which is enough for
the power requirements of Africa, only 76,000 GW/year is being generated from a total of
20.3 GW installed capacity. The countries of SSA did not recognise the importance of small
hydropower (SHP) in a growing economy early. Asia, Europe and America have provided
reasonable power for domestic use, agriculture, industry, etc. through SHP schemes. Although
SHP has been accepted in SSA as a reliable option for the provision of electricity for rural and
remote areas in the region, the installed capacity is very low. This occurrence is attributed to
several factors including financial, technical and environmental issues.

2.2.1.1 Problem statement: gross inadequate access to electricity in sub-Saharan Africa


despite the abundance of small hydropower resources

This study examines power accessibility limitation factors in SSA and discusses possible
ways of using SHP to enhance the energy available in the region. There is a correlation
between energy consumption, economic activities and level of poverty. Access to modern,
adequate, affordable, green and sustainable energies will provoke productivity and
consequently, reduction of poverty.

2.2.2 Regional electricity situation

The power sector performance in SSA (excluding South Africa) is wrecked by inadequate
generation and leakages caused by poor and sub-standard transmission and distribution
facilities. The average access rate of electricity is less than 31% in sub-Saharan Africa
countries excluding South Africa. The total annual power generation in sub-Saharan Africa is
about 145 TWh which is almost what Spain generates. Out of this total, South Africa alone
generates 35 GW, meaning that the rest put together generates 28 GW [5]. Globally, Africa
has the weakest power per capita of 620 kWh/year which drops to 153 kWh/year when SSA is
considered without South Africa. The consumption in India is equal to four times the
consumption in SSA (excluding South Africa). Presently, the capacity of the power installed
in Africa is 147 GW which is equivalent to the amount China installed in two years [4].
Research carried out by Bob and Magali in 2010 is represented in Figure 2.2.1 and shows the
electricity available in various scenarios [6].

17
Figure 2.2.1: Variation of electricity in various scenarios [6]

The rural areas of SSA are worst affected by inadequate power supply despite the fact that the
inhabitants of the rural areas are engaged with agriculture which is a key economic sector of
the region. The study of Bob and Magali found that 62 % of the working class in the rural
area has no access to the grid. A median of 62 % of the rural adult population in surveyed
countries have some type of work, compared with a median of 52 % among urban adults. But
the lack of access to the power grid is especially acute for rural workers. This is noteworthy as
agriculture is a key economic sector in many countries across the sub-continent and many
farmers live at subsistence levels. A scenario of power received for 7 days between urban and
rural shows 34 % and 72 % respectively. No power for 7 days for various types of workers is
depicted in the pie chart in Figure 2.2.2.

Figure 2.2.2: No power for 7 days for various types of workers

The countries where Bob and Magali’s survey was conducted are Nigeria, Uganda, Liberia,
Senegal, Tanzania, South Africa, Botswana, Mali, Niger, Zimbabwe, Chad, Ghana, Central
African Republic, Burkina Faso, sierra Leone, Kenya and Cameroon.

18
The perennial inadequacy of electricity supply has become a way of life in most countries of
SSA. In these countries, electricity is provided by costly diesel and petrol generators with a
cost rate from 3-6 times higher than the average grid system price across the world. The
consequences of this are slow employment growth, uncompetitive Africa-based
manufacturing sectors and reduction of annual GDP growth by from one to three percentage
points [7]. Sub-Saharan Africa has abundant SHP potential as shown in Figure 2.2.3 that is
not sufficiently tapped [8]. The amount of SHP potential present in the region is enough to
solve the chronic power problem in the region if harnessed optimally. Many of the SHP sites
are yet to be developed and this has been attributed to several reasons [9-11]. The reasons can
be classified into policy for rural electrification; insufficient fund for SHP; nature of
electricity market; inadequate synergy among the stakeholders; non-implementation of energy
research outputs in the region; inadequate human and manufacturing facility development.

Figure 2.2.3: SHP potential in regions of Africa [8, 12]

2.2.3 Small hydropower energy conversion principle

Moving water possesses hydraulic energy which the turbine blade converts into circular
motion via the shaft to turn the generator that subsequently converts the mechanical energy
into electrical energy. The sources of this moving water could river, ocean, stream, waterfall,
storage tank, etc. [13, 14]. Hydro turbine plants are rotating machines that convert the
hydraulic energy in flowing water into torque to turn the alternator for electricity production.
Turbines are classified into two types, impulse and reaction turbines and their application
depends on the method of water energy transfer [15-19]. The energy conversion in the process
is represented in Figure 2.2.3:

19
Figure 2.2.4. Energy conversion in turbine

Hydro turbine classification can be based on capacity as shown Table 2.2.1, although
internationally there is no standardised classification [12]. Europe and some countries accept
the classification according to Table 2.2.1 and which has 10 MW as the SHP upper limit [9,
20]. In this study, SHP is taken as being equal or less than or equal to 20 MW (SHP <
10MW).

Table 2.2.1: Categories of hydro turbine based on output size propagation


Category Capacity Storage source
Pico < 10 kW Run-of-river
Micro < 100 kW Run-of-river
Mini < 500 kW Run-of-river
Small < 10 MW Run-of-river
Medium < 100 MW Dam and reservoir
Large > 100 MW Dam and reservoir

2.2.4 Small hydropower (SHP) system and access to energy in SSA

Small hydropower systems have been portrayed as a suitable power scheme for SSA due to
their merits compared to large hydropower systems and the other power sources. Application
of SHP systems in the region is favoured by the abundance of SHP potential in the region;
simplicity, especially pico- and micro-hydropower systems; the possibility of being designed,
manufactured and installed locally; and, environmentally friendly. Additionally, hydro is a
renewable energy source with minimal emission of greenhouse gases (GHG). The best power
system for rural and stand-alone electrification is SHP. In 2004, the Intergovernmental Panel
on Climate Change (IPCC), reported that energy production contributed highest to world
GHG emissions (26 %), with forestry (17 %), transport (13 %) and agriculture (13 %) the
main consumers [21]. The majority of emissions in the power sector was due to the use of
fossil fuel for power generation [22]. Though SSA region is not known for significant
production of GHG, it is imperative that the region participates in global GHG reduction
initiatives.

Other benefits of SHP are [12, 23]: A renewable energy generation system that produces the
lowest cost of electricity of between 0.02/kWh and 0.05/kWh USD; suitable for rural, remote
and standalone electrification that produces an average level cost of energy (LCOE) of

20
0.05/kWh USD; hydropower is already supplying the largest proportion of renewable power
generation; SHP schemes have environmental benefits compared to large scale schemes; and,
SHP can be domesticated. From the aforementioned, SHP schemes can fast track adequate
reliable, affordable and sustainable power for the promotion of the socio-economic
development of SSA rural and remote hinterlands.

2.2.5 Small hydropower development barriers in sub-Saharan Africa

The development of SHP may be broadly divided into five processes as shown in Figure
2.2.4. They are hydrological study, design, manufacturing, installation and post-installation
operations. The process usually starts with the hydrological evaluation of the hydro resource
to establish if it is technically feasible.

Figure 2.2.5. The development process of a SHP

Although, the development of SHP looks conventional, the design transformation is generally
limited in SSA by: insufficient funds; lack of adequate manufacturing infrastructure; lack of
appropriate power generation and distribution policies; inaccurate hydrological data of some
of the identified sites; inadequate domestic and regional participation in the design and
manufacture of SHP component devices, installation, operation and maintenance. However,
there are barriers that are peculiar to different regions are presented in Table 2.2.2.

Table 2.2.2: Barriers peculiar to the different regions of Africa hindering SHP development

Regions of Africa SHP Barriers in SSA


Eastern Lack of hydrological and up to date data
Insufficient awareness of SHP
Lack of road infrastructure to access sites in the in remote areas
Lack of public-private partnership with both domestic and foreign investors
Inadequate human capacity
Power distribution cost
Middle Lack of clear cut renewable energy policy
North Lack of motivation and suitable SHP site
Lack of SHP merits awareness by the public
Lack of support policies and technical capacity
South Lack of SHP components and system, insufficient human capacity on SHP
Unfavourable climatic condition

West Lack of reliable and up to date hydrological data


Inadequate SHP project financing and no incentive to attract domestic and foreign
SHP investors

21
Various degrees of insufficient technical expertise for equipment design,
manufacturing, civil construction, operation and maintenance
Effect of climate change on water bodies like river
Other common barriers Long distance between potential sites and consumption points
Low electricity demands due to low population density
Long distance between consumers (scattered settlement)
Low utilisation factor
Prohibitive high capital costs

2.2.5.1 Cost of power projects

Funds re always scarce when it comes to infrastructure provision, though the region has
heavily depended on central governments and development partners. The region needs a huge
capital injection to increase access to power adequately, considering the high cost of power
projects. Over dependence on foreign power equipment, technology and human resource is
responsible for the high cost of SSA power projects. It has been observed that the cost of a
power projects in the region is two times higher than in China [24]. The difference in the
project costs is due to the cost of consultation, equipment transportation and hiring of foreign
expertise for installation and in some cases for operation and maintenance. In addition to
these costs, is the cost of facility monitoring and protection in the region.

2.2.5.2 Power generation and distribution policies

In many countries in SSA it is not possible for individuals or organisations to generate and
sell electricity directly to customers (consumers). In many cases, the state government is not
allowed to independently generate electricity without connecting to the national grid.
However, in an attempt to increase access to electricity, the Nigerian government in 2003
approved a national energy policy that encourages the use of all effective energy sources. The
policy advances the use of viable sources of energy for national economic sustainability
through joint efforts between the government and active private participation. The policy
states that special attention will be given to SHP for development in line with emerging
technology [25, 26].

In some cases, insufficient or absence of SHP policy and regulatory structure to monitor the
development and implementation of the system discourages SHP project developers from
investing in SHP. The lack of cooperation between stakeholders in SHP development involve
agriculture, power utilities, water resources and environmental management, national and
local authorities, and fund providers.

22
2.2.5.3 Inadequate SHP design and manufacturing infrastructure

This study identifies inadequate infrastructure for designing and manufacturing of SHP
components and devices as the strongest element mitigating against the development of SHP
in the region. This factor is as a result of insufficient human and manufacturing infrastructure
capacity building. A study by UNESCO of some regions revealed that from 2008-2010,
engineering, manufacturing and construction in undergraduate studies was lowest in SSA
[27].

Presently, manufacturing plays an insignificant role in the economies of most countries in


SSA compared to the role it plays in other developing regions. The power problems in the
region are a reflection of the weak manufacturing performance over the years, associated with
weak productive abilities and insufficient enabling logistics and policies. Further, there are
shortages of the necessary skills and new productive capabilities [28]. These factors often
yield low product quality and standards, insufficient volume, high cost of production and low
rate of production. The result is insufficient locally manufactured product to meet domestic
need or for export and consequently, the region is forced to heavily depend on foreign
products and technologies. Su-Saharan Africa’s sources of power, transport equipment and
other machinery mainly come from Japan, South Korea, Germany, the United Kingdom,
China, and the United States as shown in Figure 2.2.5 [29].

Figure 2.2.6: SSA major sources of machinery imports

23
2.2.6 Way forward

2.2.6.1 Domestication of SHP in SSA

The power problems in SSA will continue as long as the region heavily depends on foreign
power equipment and technologies. Over dependence has severe consequences on power
projects, installation, maintenance and repair costs and downtime duration. Power
sustainability in the region will only be feasible if human resource capacity is increased and
power equipment manufacturing infrastructure is enhanced to meet the present challenges.
For sustainability reasons, which means being less dependent on donors, there is a need for
the region to strategise on how to fund power projects. This could be achieved through active
public-private partnership and lending from financial institutions.

Many governments in SSA have realised the inadequacy in human capacity and the
importance of human development for the realisation of SHP benefits [30]. To address this
situation and to remove the limiting barriers, some international agencies have agreed to
support the region to develop SHP and these include: United Nations Development Program
(UNDP); United Nations Industrial Development Organisation (UNIDO); Japan International
Cooperation Agency (JICA); United Nations Environment Programme (UNEP); and,
Practical Action [9]. In 2006, UNIDO established regional SHP training and support centres
in Nigeria to provide technical support within Economic Community of West African States
(ECOWAS) [31]. The UNIDO also built demonstration SHPs in Tanzania, Mali, Rwanda and
Kenya [32]. However, these interventions are not sufficient and the impact is yet to be felt
adequately in the sector. For wider local participation, the hydrological study, design and
fabrication methodology should be as simple as possible and the use of computer-aided
design (CAD) should be encouraged.

2.2.6.2 Design and fabrication of hydro turbine components in SSA

There is an urgent need for power capacity building for personnel and manufacturing facilities
as existing ones are outdated and unable to support present needs. The capacity building
should include simple design and manufacturing processes of SHP components, using locally
sourced material and facilities. This should follow the conventional production layout as
shown in Figure 2.2.6.

24
Figure 2.2.7. Production layout model of a pico hydro turbine system

Sub-Saharan Africa comprises low-income countries, therefore industrial development is


fundamental and a priority area for human development and to meet the Sustainable
Development Goals (SDGs) in the region. The design of SHP systems includes civil work,
mechanical design and electrical design as shown in Figure 2.2.7. Design and fabrication of
the civil aspect is domestically done while major mechanical components especially the blade
and bearings are imported. The electrical components are also sourced outside the region.

Figure 2.2.8. Components of the design system

2.2.6.3 Turbine blade material selection

The generation of electricity by hydro requires water to be in motion to possess kinetic energy
which strikes and turns the turbine blade. The blades are in different kinds and number, and
the river or stream flow characteristics define the choice of the turbine to apply [33, 34]. The
turbine names are derived from turbine arrangement and their relationship with the flow of
water. Hydro turbines are categorised into two types, namely, reaction and impulse turbines
[35, 36]. The blade is the most vulnerable turbine component because of the pressure put on it
by the strike water. The blade experiences erosion wear and corrosion caused by silt and the
flowing water.

Stainless steel materials are the most common materials for hydro turbine blades [37]. The
materials are complex to produce, need huge energy for casting and welding and are very
expensive. Stainless steels production is not adequately supported by the dwindling
manufacturing infrastructure in the developing countries of SSA. However, good hydro
turbine products can still come out of the region if material and manufacturing inadequacies
are considered early in the design process. Most times projects fail when the design process in

25
not anchored in the available transforming elements. The choice of material should not be
controlled by only operational requirements but also by availability, cost and the
manufacturing processes obtainable in the region. In designing for manufacturing, a relation
exists between the material and the production processes. For successful turbine project
execution, this relationship should be factored into the design process from an early stage.

If the desirable is not available, the available becomes desirable. In the modern world, the
relevance and economic vibrancy of a country are tied to its manufacturing strength which is a
cornerstone of a healthy economy. The use of locally sourced materials and the beneficiation
of their properties through manufacturing and heat treatment processes should be promoted.
Aluminium alloys and their composites are naturally good for aerodynamic applications and
corrosion resistance and should be exploited further for turbine blade applications.

2.2.6.4 Policy and implementation

There are several policies that have been put in place by individual countries in SSA to
promote SHP. If these are strenuously implemented a lot of progress will be made in
increasing power accessibility in the rural areas in the region. In Kenya for instance, the
Electric Power Act of 1997 was amended and the new Act allows the following: the use of
SHP integrated mini-grid systems for rural electrification; a licence is not required only a
permit for generation capacity from 100 kW to 300 kW; licence or permit is not required for
generation capacity if less than 100 kW [12, 38]. In 2010, Nigeria inaugurated a standing
committee through the Federal Ministry of Power to develop hydropower capacity for the
country. The government of Mali formulated the following key energy policy papers in 2006:
National Energy Policy (2006), and the National Strategy for the Development of Renewable
Energies (2006). These strategies were targeted at 25 % renewable energy penetration by
2015 [39].

Other countries in the region have similar policies which are focused on general renewable
energy development. It is sad to note that most of the renewable energy policies formulated
by these countries have not yielded the expected results. This might not be unconnected to the
fact that the policies have no clear cut on specific renewable energy type. Kenya tends to have
well-focused SHP policies compared to Nigeria and Mali as cited. In the case of Nigeria and
Mali, the policies are in a general framework on renewable energies without being specific.
With the level of inadequate power accessibility in the region, one would have expected SHP
policies to incorporate key performance indicators.

26
This study identifies insufficient policy support for SHP technology domestication and
inadequate implementation. China managed to increase electricity generation from 25 GW in
2000 to 38 GW in 2005, about a 52 % increase. This can be attributed to self-management,
self-construction, and a value added tax on electricity of 6 % for SHP and 17 % for large
hydropower [40, 41]. There is a cyclic correlation between supporting policies, technology
enhancement and cost reductions in SHP. For realisable, affordable and sustainable SHP
schemes in SSA, policies should be centred on technology domestication. The region’s SHP
policy, therefore, should support the following:
i. Strict implementation of SHP rural electrification projects with key performance
indicators.
ii. Periodic updating of hydrological data of the SHP potentials in the region.
iii. Encouragement of public-private partnership in SHP schemes.
iv. The sale of energy generated by individuals to the grid and directly to consumers.
v. Promotion of research and development of domestic SHP materials and technologies
in higher education institutions through research grants.
vi. Encouragement of SHP component manufacturers to establish manufacturing
companies in the region through tax incentives for SHP foreign investors and waivers
on SHP production machines.
vii. Promotion of local participation in design, manufacture, operation, maintenance and
repair.
viii. SHP Standards and codes formulation for best practices and to safeguard the right of
customers.
ix. Provision of incentives to financial institutions that give loans to SHP scheme
developers.
x. Active synergy of the stakeholders for better delivery of SHP projects.

2.2.7 Conclusion

The most suitable and sustainable electrification scheme for provoking developments and
economic activities in the rural and remote areas is SHP. It is regarded as a matured power
technology that has low operation and maintenance cost and provides the lowest power
generation prices of all off-grid technologies. Small hydropower schemes have been tested
globally and certified as a formidable scheme for power production in developing countries.

27
Sub-Saharan Africa as a region is blessed with abundant SHP potential and should no longer
accept the situation of gross inadequate access to power with these resources being untapped.
The paradigm of the total importation of power generation and distribution devices should
change. Reliable data dissemination regarding the potential of SHP is key to policy
development, energy planning and as a guide to investors in participating in the hydropower
energy market. Human and infrastructural capacities should be built in the design and
manufacturing of SHP components and system centred on domestic participation and
sustainability. Power policies and infrastructure for manufacturing should be enhanced in the
region to accommodate SHP equipment and plant production.

28
Bibliography

[1] International Renewable Energy Agency (IEA), "2014 FACTSHEET Energy in Sub-
Saharan Africa today", World Energy Outlook, Paris 2014.

[2] C. Z. M. Kimambo, "Regional cooperation in academic capacity building – added


value or added challenges?" presented at NUFU-NOMA conference, Dar es Salaam,
2011.

[3] International Renewable Energy Agency (IEA), "World Energy Outlook special
report: a focus on energy prospects in Sub-Saharan Africa," IEA, Paris, 2014.

[4] GSMA, "Tower Power Africa: energy challenges and opportunities for the mobile
industry in Africa," GSMA Green Power for Mobile Programme, London, 2014.

[5] United Nations Environment Programme (UNEP), "Regional report on efficient


lighting in Sub-Saharan African countries," UNEP, Nairobi, 2012

[6] T. Bob and R. Magali. (2012, 21/05/2016). In sub-Saharan Africa, most workers are
without electricity. Available: http://www.gallup.com/poll/151889/sub-saharan-africa-
workers-without-electricity.aspx.

[7] A. Castellano, A. Kendall, M. Mikomarov and T. Swemmer, "Brighter Africa: the


growth potential of the Sub-Saharan electricity sector,", Mckinsey & Company, New
York, 2015.

[8] H. Liu, D. Masera and L. Esser, "World small hydropower development report 2013."
United Nation Industrial Development Organization (UNIDO) and International
Centre on Small Hydropower (ICSHP), 2013.

[9] C. S. Kaunda, C. Z. Kimambo and T. K. Nielsen, "Potential of small-scale


hydropower for electricity generation in Sub-Saharan Africa," International Scholarly
Research Network, vol. 2012, pp. 1-15, 2012.

[10] F. Mtalo, R. Wakati, A. Towo, S. Makanu, O. Munanyeza and B. Abate, "Design and
fabrication of crossflow turbine," Nile Basin Capacity Building Network (NBCBN):
Hydraulic Research institute Cairo, Egypt, 2010.

[11] W. J. Klunne, "Small hydro a potential bridge for Africa’s energy divide," World
Rivers Review vol. 28, pp. 6-7, 2012.

29
[12] H. Liu, D. Masera and L. Esser, "World small hydropower development report 2013."
United Nation Industrial Development Organization (UNIDO) and International
Centre on Small Hydropower (ICSHP), 2013.

[13] M. J. Khan, M. T. Iqbal and J. E. Quaicoe, "River current energy conversion systems:
progress, prospects and challenges," Renewable and Sustainable Energy Reviews, vol
12, no. 8, pp. 2177-2193, 2007.

[14] J. B. Johnson and D. J. Pride. “River, Tidal, and Ocean Current Hydrokinetic Energy
Technologies: Status and Future Opportunities in Alaska.” Alaska Center for Energy
and Power, 2010. Prepared for the Alaska Energy Authority.

[15] B. A. Nasir, "Design of high-efficiency Pelton turbine for micro hydropower plant,"
International Journal of Electrical Engineering and Technology (IJEET) vol. 4, no. 1,
pp. 171-183, 2013.

[16] L. Gudukeya and I. Madanhire, "Efficiency improvement of Pelton wheel and


crossflow turbines in micro-hydropower plants: Case Study," International Journal of
Engineering and Computer Science, vol. 2, pp. 416-432, 2013.

[17] L. Barelli, L. Liucci, A. Ottaviano and D. Valigi, "Mini-Hydro: a design approach in


case of torrential rivers," Energy, vol. 58, pp. 695-706, 2013.

[18] J. F. Claydon. (2015, 18/05/2015) Turbines. Available:


http://www.jfccivilengineer.com/turbines.htm.

[19] Energypedia (2014, 02/06/2013). Hydropower Basic


https://energypedia.info/wiki/Hydro_Power_Basics#Classification_of_Hydro_Power

[20] European Small Hydropower Association (ESHA), "Guide on how to develop a small
hydropower plant." ESHA, Brussels, Belgium, 2004.

[21] S. Singal, "Planning and implementation of small hydropower (SHP) projects, "Hydro
Nepal, vol. 5, July 2009.

[22] Spatial Plans and Local Arrangement for Small Hydro (SPLASH), "Guidelines for
micro hydropower development," Spatial Plans and Local Arrangement for Small
Hydro, SPLASH Project, European Commission, Brussels, 2005.

[23] International Renewable Energy Agency (IRENA), "Renewable power generation


costs in 2014," IRENA, 2014.

30
[24] International Renewable Energy Agency (IRENA). (2012, 19/03/2015). Prospects for
the African power sector: scenarios and strategies for Africa Project. Available:
https://www.irena.org/DocumentDownloads/Publications/Prospects_for_the_African_
PowerSector.pdf.

[25] L. L. Ladokun, K. R. Ajao and B. F. Sule, "Hydrokinetic energy conversion systems:


prospects and challenges in Nigerian hydrological setting," Nigerian Journal of
Technology (NIJOTECH), vol. 32, no. 3, pp. 538-549, 2013.

[26] A. S. Sambo, "Policy and plans on renewable energy in Nigeria," presented at the
Keynote Presentation made at the two day Workshop on Impact of Hydropower on
Host Communities, Ilorin. Kwara State, Nigeria, 2012.

[27] Deloitte, "Sub-Saharan Africa power trends: power disruption in Africa,"


Johannesburg, 2015.

[28] N. Balchin, S. Gelb, J. Kennan, H. Martin, D. W. te Velde and C. Williams,


"Developing export-based manufacturing in Sub-Saharan Africa," Overseas
Development Institute, London, 2016.

[29] R. Atta-Ankomah, "Chinese technologies and pro-poor industrialisation in Sub-


Saharan Africa: the case of furniture manufacturing in Kenya," The European Journal
of Development Research, vol 28, no. 3, 397-413, 2015.

[30] M. Gaul, F. Kolling and M. Schroder. (2012). Policy and regulatory framework
conditions for small hydropower in Sub-Saharan Africa. Available:
http://kerea.org/media/2012/12/Policy-and-regulatory-framework-conditions-for-
small-hydro-power-in-Sub-Saharan-Africa.pdf.

[31] A. Esan, "UNIDO Regional Centre and small hydropower development in Africa—
Abuja, International Centre for Science and Technology," in Proceedings of the
Instruments and Potential for the Use of Renewable Energies for Regional
Development Conference, International Centre for Science and Technology and
UNIDO (United Nations Industrial Development Organization), Trieste, Italy, Trieste,
Italy, May 2011.

[32] United Nations Industrial Organization (UNIDO), "UNIDO projects for the promotion
of small hydropower for productive use: independent thematic review," UNIDO,
Vienna, Austria, 2010.

31
[33] J. Goodell, J. Lange, T. Newville and F. Semmler, "Grand Rapids public utilities
commission’s hydro turbine generator," Final Technical Report, Iron Range
Engineering Fall 2012.

[34] W. S. Ebhota and F. L Inambao, "Design basics of a small hydro turbine plant for
capacity building in sub-Saharan Africa," African Journal of Science, Technology,
Innovation and Development, vol. 8, pp. 111-120, 2016.

[35] U. Dorji and R. Ghomashchi, "Hydro turbine failure mechanisms: an overview,"


Engineering Failure Analysis, vol. 44, pp. 136-147, 2014.

[36] Tokyo Electric Power Company (TEPCO), "Micro-Hydro designing," Workshop on


Renewable Energies, Nadi, Republic of the Fiji Islands: Tokyo Electric Power Co,
2005.

[37] P. Adhikary, P. K. Roy and A. Mazumdar, "Selection of hydro-turbine blade material:


application of fuzzy logic (MCDA)," International Journal of Engineering Research
and Applications, vol. 3, pp. 426-430, 2013.

[38] J. Muriithi, "Developing small hydropower infrastructure in Kenya," presented at the


2nd Small Hydropower for Today Conference INSHP, Hangzhou, 2006.

[39] African Development Bank Group (AfDB), "Renewable energy in Africa: Mali
country profile,", AfDB, Côte d’Ivoire, 2015.

[40] O. U. Oparaku, "Decentralised power generation in Nigeria: role of renewable energy


resources," In Proceedings of the 1st International Workshop on Renewable Energy
for Sustainable Development in Africa (IWRESDA), University of Nigeria, Nsukka,
Nigeria, 2007.

[41] D. Altinbilek, K. Seelos and R. Taylor, "Hydropower’s role in delivering


sustainability," Energy & Environment, vol. 16, no. 5, pp. 815-824, 2005.

32
Part 3: Sub-Saharan Africa Power Sustainability: A Function of a Domestic Small
Hydropower (SHP) Design and Manufacturing

W. S. Ebhota and F. L. Inambao, “Sub-Saharan Africa power sustainability: a function of a


domestic small hydropower (SHP) design and manufacturing,” Journal of Energy in Southern
Africa, 2016. (Under review.)

Sub-Saharan Africa Power Sustainability: A Function of Domestic Small


Hydropower (SHP) Design and Manufacturing

Williams S. Ebhota1 and Freddie L. Inambao 2


1,2
Discipline of Mechanical Engineering, University of KwaZulu-Natal, South Africa

Correspondence email: [email protected]

Abstract–The quest for alternative energy sources is on the increase in Sub-Saharan Africa
due to gross power inadequacy coupled with a global trend of greenhouse gas emission. This
study identifies solar, geothermal, wind and hydro which are renewable energy sources as
options. Small hydropower (SHP) has been singled out as the best alternative power system in
the region. But there is insufficient local content in terms of design and manufacturing of SHP
devices and systems in the region. To boost local participation, the study simplified the design
process for low (3 m) and high (60 m) heads for Kaplan/propeller and Pelton pico hydro
turbines respectively. The design of a propeller turbine started with a river hydrological data;
flow rate (Q) 0.2 m3/s and head (Hn) 3 m using rotational speed (N) of 1500 rpm. In the case
of the Pelton turbine, given flow rate (0.02 m3/s), net head (60 m) and rotational speed (1500
rpm) were used to design 8.2 kW output power Pto with specific speed Ns of 26.16. CAD
modelling and simulation software was used to evaluate the mechanical properties of
aluminium alloy (6061-T6) for Pelton bucket application. The study concludes that adaptive
design, domestic manufacturing and regional joint SHP research are factors that promote
sustainable power development.

Key words: Power; Turbine Design; Pelton turbine; Propeller turbine; Sub-Saharan Africa;
Small hydropower

33
2.3.1 Introduction

The power situation in sub-Saharan Africa (SSA) is in a pathetic state despite several
intervention measures [1]. The problems and challenges that trail the power sector in the
region seem as fresh as they were two decades ago and even deepened in some areas. Truly,
this is heart breaking considering the resources and efforts that have been put in to fix it. The
International Renewable Energy Agency (IRENA) reported in 2012 that the average rate of
electrification in SSA is about 35 %. It added that the situation is worse in the rural areas
which was below 20 %. Further, over 50 % of the population in 41 countries in the region had
no access to electricity [2]. One billion sub-Saharan Africans have been projected to have
access to electricity in 2040 with 530 million people without access especially in the remote
areas [3]. Internationally the regional access to electricity in 2015 is shown in Figure 2.3.1.
Some of the factors responsible for this ugly situation are under developed manufacturing
infrastructure, over reliance on foreign power technologies, exorbitant cost of power projects
and under developed human capacity in the power sector [4].

The search for ways of increasing access to power and alternatives to conventional energy
sources (fossil fuel) to supply power to remote and rural areas in the region is massive. This
has led to several power schemes. The identified options include solar, geothermal, wind and
hydro and they are generally called renewable energies. However, hydropower has been
singled out as the most abundant alternative renewable energy source with the potential of
increasing access to power in the region. The World Bank has stated that only 8 percent of the
hydropower potential in SSA has been developed [5].

Figure 2.3.1: Regional access to electricity in 2015 [6]

The Framework Convention on Climate Change (UNFCCC) of United Nations has


recognised the challenge of Greenhouse Gases (GHG). The goal of the Convention is to
stabilise GHG concentrations to a level that would prevent hazardous anthropogenic meddling
with the climatic condition of the atmosphere [7]. The use of energy was reported to be the
highest source of GHG due to CO2 being a by-product of carbon oxidation during fossil fuel

34
combustion. Global total primary energy supply (TPES) demand which depends mainly on
fossil fuels more than double from 1971-2012 as depicted in Figure 2.3.2 [8].

Figure 2.3.2: World TPES [7]

Coal accounts for 29 % of the global TPES but represents 44 % of the world CO2 emissions
while carbon-neutral fuels represent 18 % of TPES [9] (Figure 2.3.3).

Figure 2.3.3: Global primary energy supply and CO2 emissions [7]

Greenhouse gas emissions in 2012 decreased in North America (-3.7 %), Annex II Europe (-
0.5 %) and Annex I EIT (-0.8 %), but increased was in China (3.1 %), Africa (5.6 %), Asia
excluding China (4.9 %) and the Middle East (4.5 %) as represented by Figure 2.3.4.

Figure 2.3.4: Change in CO2 emissions by region (2011-2012)

35
In 2012, electricity and heat generation emitted about two-thirds of global CO2 emission
which is about 42 %, while transport accounted for 23 % as illustrated by Figure 2.3.5.
Although use of renewable energies has gained ground in the region, SSA still relies heavily
on coal and fossil fuels for electricity and heat generation.

Figure 2.3.5: CO2 emissions by sector [7]

Amongst the major forms of fuel for power generation, coal emits the highest GHG while
hydro produces the least as represented in Figure 2.3.6.

Figure 2.3.6: Electricity generation by fuel

2.3.2 Hydro potential in Africa and benefits of small hydropower

Hydropower is the most used renewable energy in the region due to its large scale potential
development and the cost of electricity generated is lower than other technologies both
renewable and non-renewable. The effective hydropower potential available in Africa is put at
283 GW which is more than 300 % the current electricity consumption in SSA [1]. Over 50 %
of this potential is in Central and East Africa (Cameroon, Congo, DR Congo, Ethiopia and

36
Mozambique). Reasonable amounts also exist in Southern Africa (Angola, Madagascar,
Mozambique and South Africa) and West Africa (Guinea, Nigeria and Senegal). DR Congo
has the largest hydropower potential as proposed by the 44 GW Grand Inga project which
when actualised will transform African power supply tremendously. Despite gross
inequalities in access to electricity and hydro abundance in the region, only 20 GW of
hydropower capacity is installed as depicted by Figure 2.3.7. This is less than 10 % of the
effective available hydro potential.

Figure 2.3.7: Hydropower potential and installed capacity in Africa

2.3.2.1 Large scale hydropower projects

Exploration of large hydropower projects are associated with the following challenges:
i. Large sums of upfront capital.
ii. Exportation of large amounts of generated electricity is limited due to low levels of
interconnection in the region – domestic markets are generally too small to absorb all
the power generated by large scale hydropower projects.
iii. Supply is a function of seasonal and annual variations.
iv. Hydro dams pose environmental concerns such as displacing communities and may
adversely affect water availability for other uses.
v. Inadequate technical expertise in hydropower development in some countries, etc.

2.3.2.2 Small hydropower (SHP)

Small hydropower refers to the generation of electrical power from a water source on a small
scale, usually with a capacity of not more than 10 MW. However, there is still no
internationally agreed upon definition of small hydropower as capacity classification varies
from country to country as shown in Table 2.3.1 [10, 11]. For rural and electrification of
remote areas in developing countries, SHP or micro-hydropower has been described as the

37
most effective energy scheme [12]. The technology is environmentally benign, extremely
robust and long lasting – lasting for 50 years or more with little maintenance [13]. Other
striking benefits include [14]: minimal vandalisation of power facility; reduction in
transmission losses; reduction in network problems (especially during raining season);
reduction in illegal electricity connections to the national grid; the resource is in abundance
and largely untapped; it emit low GHG (CO2) and is regarded as a clean renewable energy
source; it can create jobs; and it encourages energy diversification of systems thereby
enhancing energy supply reliability in the region, etc. The global quest for cleaner energy to
replace or minimise the use of fossil fuels which are the bulk of electricity generation in SSA
favours the use of SHP. This will consequently reduce GHG emission [15]. Aggressive use of
renewable energy in SSA will reduce CO2 emissions by 27 % in the region [1].

Table 2.3.1: Various size classifications of SHP

Country Micro (KW) Mini (KW) Small (MW)


United States < 100 100-1000 1-30
China - < 500 0.5-25
USSR < 100 - 0.1-30

France 5-500 - -
India < 100 101-1000 1-15
Brazil < 100 100-1000 1-30
Norway < 100 100-1000 1-10
Nepal < 100 100-1000 1-10
Various < 100 < 1000 < 10

2.3.3 Hydro turbine design and manufacturing procedures

There is a strong correlation between material selection and manufacturing processes. They
could be said to be elements of the universal set called the Design Process. Figure 2.3.8
represents the relation that exists between material selection and manufacturing processes. For
successful product design, the design process should provide an interphase between material
selection and manufacturing process. This interphase is subjected to material and
manufacturing facility availability. The manufacturing system in SSA is not as advanced and
adequate compare to what is obtainable in Europe and America or even in Asia. However,
good hydro turbine products can still come out of the region if material and manufacturing
inadequacies are factored into the design process early.

38
DFM – Design for manufacturing
Figure 2.3.8: Correlation between material selection and manufacturing process

2.3.3.1 Sustaining power through domestic participation

Domestic participation in the design and manufacturing of SHP devices and systems in SSA
will promote access to electricity in the region and the creation of jobs. Power sustainability
in the region will always be threatened by overdependence on foreign technology due to high
cost of power project execution, inadequate skilled personnel for installation, operation,
maintenance and repair challenges. This participation can be activated through regional joint
capacity building for SHP technology in the following areas: foundry technology;
mechatronics; fluid mechanics; manufacturing processes; and material development
engineering.

A simplified hydro turbine production procedure can be categorised into twelve sequential
steps as shown in Figure 2.3.9.

Figure 2.3.9: Production layout model of a pico hydro turbine system

2.3.3.2 Hydropower plant operation principle

Hydro turbine plants are rotating machines that transform the mechanical energy in flowing
water into torque to turn the generator for the purpose of electricity production. Turbine can
be categorised into two types, namely, impulse and reaction turbines [16-18]. This
classification depends on the water energy transfer method.

For impulse turbines, water is projected from the nozzle as a jet and strikes on the buckets that
are arranged on the circular edge of the runner. The buckets are made up double
hemispherical cups. The nozzle is at the end of penstock while the buckets discharges used

39
water into the tailrace. A schematic diagram of a Pelton turbine is shown in Figure 2.3.10. In
a reaction turbine, the runner or spinning wheel (blade) is completely immersed in the flow
and uses water pressure and kinetic energy of the flow. They are appropriate for low to
medium head applications. The two main types of reaction turbine are the propeller (with
Kaplan variant) and Francis turbines.

Figure 2.3.10: Schematic diagram of a hydro turbine system [19]

2.3.3.3 Hydro turbine main components

The hydro turbine is composed of the following main components as shown in Figure 2.3.10:
x Dam/Weir – is a wall across the river or flow channel to store water.
x Headrace – The reservoir created by the dam/weir.
x Penstock – the pipe that connects the headrace to the turbine runner.
x Runner – the aspect of the layout that converts the energy of the flowing water into
torque that drives the generator via a shaft. The runner of a turbine has a wheel and
buckets or cups for Pelton turbine, or blade and hub for Kaplan, Turgo and Francis
turbines.
x Shaft – this connects the blade and the generator.
x Generator – this is the device that receives the mechanical energy through the shaft
and converts this energy into electrical energy.
x Tailrace – the used water flows out of the turbine through this channel.

2.3.3.4 Selection of turbine and design of turbine

There are two factors that determine the kind of turbine to be used. These factors are products
of hydrological study of the hydro potential like river or water falls. The parameters are head
(H) and the volumetric discharge (Q) of the river (Figure 2.3.11).

40
Figure 2.3.11: Head-flow range of small hydro turbines [13]

The type of turbine to be used according to head classification; the head is classified into low
(> 10 m), medium (10 m to 50 m) and high head (above 50 m). Table 2.3.2 shows type of
turbines and the various head domains where they are applied.

Table 2.3.2: Types of hydro turbine and their applications [19, 20]

Turbine Head Classification


High (> 50 m) Medium (10-50 m) Low (< 10 m)
Impulse Pelton, Turgo, crossflow, Crossflow
Multi-jet Pelton Pelton, Turgo,
multi-jet Pelton
Reaction Francis (spiral case) Francis (open-flume),
Propeller, Kaplan, Darius

2.3.3.5 The Kaplan/Propeller turbine

The Kaplan or propeller turbines are appropriate for low head and large discharge operations.
Figure 2.3.12 shows a schematic diagram of a Kaplan/Propeller turbine blade. The Kaplan is
an adjustable runner blade with high, almost constant efficiency over a wide range of load.
The range of Kaplan turbine applications has been greatly improved, which has favoured the
improvement of numerous undeveloped hydro sources previously discarded for economic or
environmental reasons. The Kaplan Turbine generation efficiency is sometimes over 90% at
low heads and high flows [21].

Figure 2.3.12: Kaplan/Propeller runner blade parameters and parts

41
2.3.3.6 The Pelton turbine: Main elements of a Pelton turbine system

This turbine is typically used in small-scale micro-hydro systems (with power of up to about
100 kW) and a head ranging from 10 m to 200 m. It consists of a wheel (or runner) with a
number of buckets attached around its edge, which are shaped like two cups joined together
with a sharp ridge between them as shown in Figure 2.3.13. In addition, a notch is cut out of
the bucket at the outside end of the ridge. Water is directed to the turbine through a pipe and
nozzle to this ridge. Its shape allows for the production of a lot of power from such a small
unit and it is easy to manufacture.

Figure 2.3.13: Pelton turbine arrangement

As the water strikes at the symmetrical line it then distributes into the two halves of the
bucket while some water is reflected back to the nozzle. The angle of jet deflection
theoretically for a perfect hemispherical bucket is 1800. This is not possible to obtain
practically so the angular deflection of 1650 is used in practice [16]. The main parts of Pelton
turbine are penstock, spear, nozzle, wheel and buckets, shaft, generator, valves and
powerhouse (Figure 2.3.14). Water flows from the headrace through the penstock to runner.
The penstock has a nozzle at its exit before the runner.

Figure 2.3.14: The general layout of a Pelton hydro turbine plant [19]

42
The flow rate of the water jet from the nozzle can be controlled with the use of a spear
(evident in Figure 2.3.13). This spear helps to adjust the flow rate to balance the change
caused by site conditions.

2.3.4 Methodology

This study, explored a simple design approach in SHP design and development processes, to
facilitate rapid and increased uptake of SHP schemes in SSA. The design process was based
on locally available material and manufacturing facilities. Calculus forms of equations were
avoided and simple CAD drafting and simulation software was used.

2.3.4.1 Propeller turbine design for low head

Table 2.3.3: Nominal conditions for Kaplan/Propeller turbine design (refer to Figure 2.3.12) [22]

Step Relevant Equations Answer


Turbine capacity, Pti. Pti U g Q Hn 6 kW

Specific speed, Ns N Q 294


Ns
H n 0.75
Velocity, u u K ug 2 gH n 13.04 m/s

The angular velocity of the 2S N 157 rad/s


turbine runner, rad/s Z
60
The blade tip radius, rt K ug 2 gH n 0.083 m
rt
Z
The blade tip diameter, Dt Dt 2rt 0.166 Mm
0056
The hub diameter, Dh Dh 0.058 m
0.35
Dt
Cross sectional area, A S 0.019 m2
A
4
D t
2
 Dh 2

Axial velocity [m/s] 4Q 10.53 m/s


Vaxial
S Dt 2  Dh 2
Flow coefficLHQWĭ Q 0.044
)
NDt 3
3RZHUFRHIILFLHQWȽ P 1.4*10-8
*
U N 3 Dt 5
(QHUJ\FRHIILFLHQWȌ gH 4.7*10-4
<
N 2 Dt 2

43
Where A - area; Q - flow rate and; rt - blade radius; rh - hub radius; Dt - blade diameter and; Dt - hub diameter;
Kug, the tip-to-head velocity ratio (Dh/Dt  ȡ - density of water (kg/m3); g - acceleration due to gravity
(9.81 m/s2); Hn - QHWKHDG P DQG‫ڦ‬tl – total efficiency.

2.3.5 Design calculation and simulation of a Pelton bucket high head

2.3.5.1 Pelton design parameters

Figure 2.3.15: Runner and bucket parameters

Figure 2.3.16: Turbine velocity diagrams

Table 2.3.4: Nominal conditions for Pelton turbine design (refer to Figures 2.3.15 and 2.3.16) [19, 21, 23,
24]

GiYHQTXDQWLWLHV4 PV+Q P&Q ȡ .JP[ QM /SW 


Pࣜ DQGș ƒ7KHJHQHUDWRULVUDWHGDWZDWWVDQGWKHURWDWLRQ 1 LV
rpm.
Parameters Relevant Equations Answer
The input power to the turbine, Pti Pti U g Cn 2 H n Q 8.48 kW

Specific speed (Ns) 26.16


N Pti
Ns 5
Hn 4
Jet velocity, Vj (m/s) Vj Cn 2 g H n 33.62 m/s

Jet/nozzle diameter, Dj 0.024 m


4 Q
Dj
S n j V j
Tangential velocity of the runner, Vtr Vtr x V j 15.47 m/s

44
Runner diameter Dr, (m) 60 Vtr 0.20 m
Dr
S N
Jet/nozzle cross sectional area, Aj S Dj2 4.5*10-4
Aj
4
3
Nozzle flow rate, Qn (m /s) Qn V j Aj 0.015 m3/s

Distance between bucket and nozzle, xnb xnb 0.625 Dr 0.125 m


(m)
Radius of bucket center of mass to runner Rbr 0.47 Dr 0.094 m
center Rbr(m)
Bucket axial width, Bw (m) Bw 3.4 D j 0.082 m

Bucket radial length, Bl (m) Bl 3D j 0.072 m

Bucket depth, Bd(m) Bd 1.2D j 0.029 m

Cavity Length, h1 (m) h1 0.35 D j 0.008 m

Length to Impact Point, h2 (m) h2 1.5 D j 0.036 m

Offset of Bucket, k(m) k 0.17 D j 0.004 m

Cavity Width, a (m) a 1.2 D j 0.029 m

Number of bucket na Dr 19
nb 15 
2D j
Length of bucket moment arm, Lab (m) Lab 0.195 Dr 0.039 m

Volume of bucket, Vb (m3) Vb 0.0063 Dr 3 5.04x10-5 m3

The output power to the turbine, Pto (kW) ª V j  Vtr º 8.20 kW


Pto U Q Vtr « »
¬ 1 \ cos I ¼
7XUELQHK\GUDXOLFHIILFLHQF\‫ڦ‬th Pto 97 %
Kth 100
Pti
The torque produced by the turbine, Tt (N- 0.054 N-m
Q Dr V j  V tr
Pto
m) Tt
Z
The deflector required force, Fd: Fd U Q V j 672.4 N

Force acting on the runner, FA; FA 2 U Qn (Vj  Vtr ) 555.2 N

Where Cn – nozzle discharge coefficient (0.98); N – runner speed (rpm); x – ratio of Vtr to Vr; Q - flow rate; g -
acceleration due to gravity (9.81 m/s2); Hn - QHWKHDG P ȡ- density of water (kg/m3)

2.3.6 Material selection for Pelton bucket

Material selection is a very important part of design and manufacturing. One of the variables
for design process iteration is material and it influences on the manufacturing process. In this
study, the selection of material for the bucket was determined by availability, functional
requirements, cost and manufacturing facilities available. Aluminium alloy (6061-T6) was
45
selected because aluminium is readily available in SSA and it can be easily worked. Table
2.3.5 shows the material’s properties.

Table 2.3.5: Material (6061-T6 aluminium) properties

Model Reference Volumetric Properties


Name: 6061-T6 aluminium alloy Mass: 0.249492 kg
Model type: Linear elastic isotropic Volume:9.24044e-005 m^3
Yield strength: 2.75e+008 N/m^2 Density:2700 kg/m^3
Tensile strength:3.1e+008 N/m^2 Weight: 2.44502 N
Elastic modulus:6.9e+010 N/m^2 Shear modulus: 2.6e+010 N/m^2
Poisson's ratio: 0.33 Thermal expansion coefficient: 2.4e-
005 /Kelvin

2.3.6.1 Evaluation of 6061-T6 Aluminium Alloy

The necessary design parameters in Table 2.3.4 were used in the simulation to validate the
stress and fatigue of the part (bucket). The results of the simulation are shown is Tables 2.3.6
and 2.3.7 and Figures 2.3.12 and 2.3.13.

Table 2.3.6: Mesh information

Mesh type Solid Mesh Total Nodes 14895


Mesher Used: Standard mesh Total Elements 8568
Total Nodes 14895 Maximum Aspect Ratio 19.602
Total Elements 8568 % of elements with 97.5
Aspect Ratio < 3
Jacobian points 4 Points % of elements with 0.0817
Aspect Ratio > 10
Element Size 4.52077 mm % of distorted elements 0
(Jacobian)
Tolerance 0.226039 mm Time to complete 00:00:07
mesh(hh;mm;ss):
Mesh Quality High

Static analysis (von Mises) shows that the highest stress (1.95904e+008 N/m^2) as a result of
the load is located at node 723 as indicated in Table 2.3.7 and Figure 2.3.12. This value is less
than the material’s yield stress of 2.75e+008 N/m^2 as presented in Table 2.3.5.

Table 2.3.7: Study results for stress, displacement and strain


Name Type Min Max
Stress VON: von Mises stress 1959.97 N/m^2 1.95904e+008 N/m^2
Node: 812 Node: 723

46
Displacement URES: Resultant 0 mm 0.209923 mm
Displacement Node: 177 Node: 435
Strain ESTRN: Equivalent Strain 5.56279e-008 0.00172423
Element: 3484 Element: 3816
Stress Displacement Strain

Figure 2.3.17: Nodal stress distribution

The fatigue distribution along the longitudinal section is shown in Figure 2.3.17. The highest
fatigue value was recorded at nodal 723 as shown by Figure 2.3.18.

Figure 2.3.18: Nodal fatigue distribution

The minimum Factor of Safety (FOS) value is 1.404 and this value was recorded at nodal
point 723 as show in Figure 2.3.19. However, the FOS is > 1. Using Solidworks software, the

47
FOS benchmark is 1.4. The value of FOS (1.404) recorded from the simulation validates the
design.

Figure 2.3.19: Factor of Safety distribution

2.3.7 Conclusion

The manufacturing infrastructure in SSA is inadequate to support energy sustainability. As a


result, the region heavily depends on foreign technology and this leads to high cost of power
projects. This has left the region’s socio-economic situation in dire straights. In order to
increase access to electricity in the region, it is therefore pertinent to building capacity in
power technology. The design process should focus on local contents in terms material
selection and manufacturing facility. This study recommends capacity building in SHP
technology, establishment of joint regional energy research institutions, transformation of
research findings into real products, and adoption of China’s energy development approach of
massive use of micro hydro turbines. The use of local materials should be encouraged as the
performance of aluminium alloy (6061-T6) was shown by simulation results to be
satisfactory.

48
Bibliography

[1] A. Castellano, A. Kendall M. Mikomarov and T. Swemmer, "Brighter Africa: the


growth potential of the sub-Saharan electricity sector," McKinsey & Company, New
York, 2015.

[2] International Renewable Energy Agency (IRENA). (2012, 19/03/2015). Prospects for
the African Power Sector: scenarios and strategies for Africa project. Available:
https://www.irena.org/DocumentDownloads/Publications/Prospects_for_the_African_
PowerSector.pdf

[3] International Renewable Energy Agency IEA, "A focus on energy prospects in Sub-
Saharan Africa," World Energy Outlook Special Report, IEA, France, 2015.

[4] W. S. Ebhota, A. C. Eloka-Eboka and F. I. Inambao, "Energy sustainability through


domestication of energy technologies in Third World countries in Africa,"
Proceedings of the Industrial and Commercial Use of Energy (ICUE), 2014
International Conference on “Energy efficiency in buildings". 2014, pp. 1-7.

[5] K. Codi, Zambia electricity shortage highlights Africa’s hydropower shortfalls, Circle
of Blue, Jul 22, 2015. Available: http://www.circleofblue.org/2015/world/zambia-
electricity-shortage-highlights-africas-hydropower-shortfalls/2015.

[6] O. Mohammed, "Charted: how electricity problems are limiting growth in many
African countries," Quartz Africa, June 08, 2015. Available:
http://qz.com/422357/charted-how-electricity-problems-are-limiting-growth-in-many-
african-countries/.

[7] International Renewable Energy Agency (IEA), "CO2 emissions from fuel combustion
statistics highlights," IEA Statistics, 2014 Edition, , IEA, Paris, 2014.

[8] Intergovernmental Panel on Climate Change (IPCC), "Revised 1996 IPCC Guidelines
for National Greenhouse Gas Inventories " IPCC, Bracknell, UK, 2007.

[9] M. Nachmany, S. Fankhauser, M. Townshend, T. Collins, T. Landesman, A.


Matthews, et al., "The GLOBE climate legislation study: a review of climate change
legislation in 66 countries," GLOBE International and the Grantham Research
Institute, London School of Economics, London, 2014.

49
[10] British Hydropower Association (BHA), "A guide to UK mini-hydro development,"
British Hydropower Association, Gussage St Michael, Wimborne, UK, 2012.

[11] D. Basnayat, "Background material: fundamentals of small hydropower technologies,"


Renewable Energy and Energy Efficiency Partnership, Nairobi, Kenya, 2006.

[12] D. J. Obadote, "Energy crisis in Nigeria: technical issues and solutions," presented at
the Power Sector Prayer Conference, Nigeria, 2009.

[13] P. Oliver, "Small hydropower: technology and current status. Renewable and
sustainable," Energy Reviews, vol. 6, no. 6, pp. 537-556, 2002.

[14] S. van der Wat, (2013, 2/11/2015). Hydro in Africa: navigating a continent of
untapped potential. HRW-Hydro Review Worldwide. Available:
http://www.hydroworld.com/articles/print/volume-21/issue-6/articles/african-
hydropower/hydro-in-africa-navigating-a-continent.html.

[15 M. Kimani, "Powering up Africa’s economies: regional initiatives can help cover
deficits," Africa Renewal, vol. 23, no. 3, p. 8, 2008.

[16] B. A. Nasir, "Design of high efficiency Pelton turbine for micro hydropower plant,"
International Journal of Electrical Engineering and Technology (IJEET) vol. 4, no. 1,
pp. 171-183, 2013.

[17] L. Gudukeya and I. Madanhire, "Efficiency improvement of Pelton wheel and


crossflow turbines in micro-hydropower plants: case study," International Journal of
Engineering and Computer Science vol. 2, pp. 416-432, 2013.

[18] L. Barelli, L. Liucci, A. Ottaviano and D. Valigi, "Mini-Hydro: a design approach in


case of torrential rivers," Energy, vol. 58, pp. 695-706, 2013.

[19] Energypedia, (2014, 02/06/2013). Hydropower Basics. Available:


https://energypedia.info/wiki/Hydro_Power_Basics.

[20] J. F. Claydon. (2015, 18/05/2015). Turbines. Available:


http://www.jfccivilengineer.com/turbines.htm.

[21] W. Stone, "Corazón del Bosque Hydroelectric Scheme: engineering design


document," Appropriate Infrastructure Development Group (AIDG), Guatemala, May
2010.

50
[22] T Flaspöhler, "Design of the runner of a Kaplan turbine for small hydroelectric power
plants," Master’s thesis, Mechanical Engineering, Tampere University of Applied
Sciences, Tampere, Finland, 2007.

[23] V. S. Obretenov, "Modernization of a Pelton water turbine," ɉɪɨɛɥ


Ɇɚɲɢɧɨɫɬɪɨɟɧɢɹvol. 4, pp. 1-5, 2006.

[24] A. Austegard and O. Schumacher. (n.d. 24/04/2015). Kaplan turbine from remote
hydro light. Available: www.remotehydrolight.com

51
CHAPTER 3: DESIGN BASICS OF A SMALL HYDRO TURBINE
PLANT FOR CAPACITY BUILDING IN SUB-SAHARAN AFRICA

W. S. Ebhota and F. L. Inambao, "Design basics of a small hydro turbine plant for capacity
building in sub-Saharan Africa," African Journal of Science, Technology, Innovation and
Development, vol. 8, no. 1, pp. 111-120, 2016. DOI: 10.1080/20421338.2015.1128039.

52

 
       
 

  

 !" #$$%&' ( !" #$")&*  ( 


 
++,,,-
  - + +
./ !

/ 0
/ / 
/
 0 
 


0  /0




1
/-20 
34
0

  /
 
   
 
!
"

#$%"!%!#$ 
$ &"!'&"!($" !!'
)! #'**% '+,''-, +./00+ 1 +02

  5 /


 %,..3   . +./00+ 1 +02

4$
,2&%

$ #$!
5$

&!*6
,/7

86!


869

:

$)
9
"!!

$
!"$
%,..666 " ! .!.5$" ;5$9<5


 , 
0=>?8 @ )A-B&C>D>?&)&DE'=
 E 
($'&,,+
African Journal of Science, Technology, Innovation and Development, 2016
Vol. 8, No. 1, 111–120, http://dx.doi.org/10.1080/20421338.2015.1128039
© 2016 African Journal of Science, Technology, Innovation and Development

Design basics of a small hydro turbine plant for capacity building in sub-Saharan Africa

Williams S. Ebhota* and Freddie Inambao

Department of Mechanical Engineering, University of KwaZulu-Natal, Durban, South Africa


*Corresponding author email: [email protected]

This paper presents a simplified design considerations for a propeller hydro-turbine, including tabulated relevant
mathematical expressions of operating parameters. In the design calculation, a 2.5 m head and 0.183 m3/s flow rate
were used as river data for power of 2.61 kW. A four-blade propeller with an outer diameter of 0.226 m and a hub
diameter of 0.079 m was considered suitable for the low head application. Dimensionless performance parameters for
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

various power (2–10 kW) and flow rate (0.2–0.6 m3/s) were evaluated (using constant head and rotational speed), the
results were tabulated and graphs plotted. The static axial force on the blade and hub analysis was carried out and results
shown satisfactory performance of aluminum 6061-T6 alloy as the blade material. Popularisation of small hydro power
(SHP) design and production technology in sub-Saharan Africa through domestic capacity building will accelerate local
fabrication of SHP plants and components. The study recommends that the design process be based on available materials
and manufacturing facilities. The provision of SHP for rural areas, industrial estates and standalone electrification will
provoke commercial and industrial activities in sub-Saharan Africa. This will consequently raise the productivity and the
standard of living of the people.

Keywords: energy, hub, hydroelectricity, hydrology, hydro-turbine, Pico, propeller, runner


JEL classification: P28, Q43, Q42, N57

Introduction To boost power sustainability, the countries of


The third-world countries are faced with chronic electricity sub-Saharan Africa should increase the continent’s
problems, which are barriers hindering economic growth, PDQXIDFWXULQJ SUR¿OH 7KLV LV RQH ZD\ WR ¿[ WKH KXJH
notwithstanding the availability of vast natural resources power problems in the continent. To do this there is a
in these areas. The International Energy Agency (IEA) need to build SHP capacities for both human settlement
reported in 2014 that the population of sub-Saharan and infrastructure that supports domestic manufacturing.
Africa without access to electricity is about 620 million The drive to increase the continent’s local content in the
people, equivalent to two-thirds of the population (IEA manufacture of SHP equipment will ensure reduction
2014). Design, manufacturing, and material development in the cost of power projects from the present cost
capacities for Pico hydro system applications are necessary situation. Further, the ability to design and manufacture
in sub-Saharan Africa to increase access to energy SHP equipment will address operation, maintenance and
for human survival and advancement (Ebhota, Eloka- availability problems and jobs will be created.
Eboka, and Inambao 2014). On average, technologically
advanced countries produce and consume more energy Literature review
than developing and underdeveloped countries, while There are a lot of investigative studies of hydro turbine
about 620 million people of sub-Saharan Africa have no design, mainly centred on basic concepts, operating
access to electricity. It is imperative to provide adequate SDUDPHWHUVDQGRXWSXWHI¿FLHQF\ =DLQXGGLQHWDO
and affordable energy for citizens to improve livelihoods in Arriaga 2010, Weerapon and Sirivit 2009, Simpson
sub-Saharan Africa and elsewhere (Cordeiro 2014, Etiosa DQG :LOOLDPV   =DLQXGGLQ HW DO   GHVFULEHG
et al. 2009). Social, economic and environmental aspects of the process of energy storage during domestic water
the pico hydro turbine make it a viable alternative source of distribution to houses by kinetic energy conversion of
power. It also has the lowest generating and maintenance ZDWHUÀRZLQJLQWKHSLSHVLQWRHOHFWULFLW\7KHHQHUJ\FDQ
costs compared to other off-grid alternatives for remote be used for regular domestic activities like cooking, and
areas. The environmental impact advantages of Pico hydro- heating the water for bathing, and laundry. The study was
turbine systems are the absence of the large civil works, conducted to design and produce a Pico-hydro generation
massive ecosystem alterations and population displacement system from water supplied to residential houses. In
associated with large-scale hydro systems (Bryan 2011). FRQFOXVLRQ KHDG DQG ÀRZ UDWH ZHUH GHVFULEHG DV YLWDO
They thus provide a better economic option for Africa. parameters in developing a Pico hydro system and wrong
Adequate access to power will provoke commercial turbine selection and sizing as the main causes of failure
and industrial activities in the developing countries of sub- =DLQXGGLQHWDO 
Saharan Africa and consequently raise the productivity The concept of pumps as turbines was presented as a
of the people and their standard of living. This can be technically and economically viable additional alternative
achieved through popularisation of small hydro power to Pico-hydro development in the Lao PDR was reported by
(SHP) technology for the provision of power for rural Arriaga (2010). the report presents: feasibility study, design,
DUHDV LQGXVWULDO HVWDWHV DQG VWDQGDORQH HOHFWUL¿FDWLRQ and analysis of a 2 kW project in the Xiagnabouli province;
instead of relying on the national grid. estimation simulation of motor as generator to the needed

African Journal of Science, Technology, Innovation and Development is co-published by Taylor & Francis and NISC (Pty) Ltd
112 Ebhota and Inambao

value excitation capacitance and induction loads impact in Kum Dam drainage pipeline. The check was done under
the system behaviour were regarded as positive approach; WKHUHDOLVWLFVWDWHRILUUHJXODUDQGLQFRPSUHVVLEOHÀXLGÀRZ
hastening to completion rather than focusing providing Simulation was performed at varying guide vane angles of
a sustainable electrical service for the village is an error 60o, 65o and 70o to establish the angle with maximum and
and; enhancement of mechanical operational and electrical minimum pressure on blades. Fixed simulation conditions
prediction model simulation. were a 21 m head, a 25o blade twist angle and a 32o blade
A study was reported on feasibility analysis of a camber angle. The simulation results showed 213 kPa,
FRPSOHPHQWDU\SRZHUVXSSO\V\VWHPWRKRXVHVRI¿FHVDQG 217 kPa and 207 kPa as maximum pressures at the leading
industries using the combination of wind and pico-hydro pressure side for the angles 60o, 65o and 70o respectively,
turbines (Ehsan et al 2012). The hydro turbine was mounted ZKLOH í N3D í N3D DQG í N3D DV PLQLPXP
DORQJWKHSDWKRILQÀRZSLSHWRWKHVWRUDJHWDQNDQGERWK pressures at the leading suction side for the angles 60o, 65o
turbines located on a high rise building roof. Pump installed and 70o respectively. The study concluded that the guide
DWWKHJURXQGÀRRU¿OOVWDQNZLWKZDWHUDWDYHU\KLJKYHORFLW\ vane angle affects pressure distribution and hydro turbine
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

DQGWKLVSXVKHVWKHWXUELQHWRVSLQORFDWHGDORQJLWVÀRZLQJ HI¿FLHQF\ :HHUDSRQDQG6LULYLW 


path. Turbine rotation is transferred via shaft to the generator
that converts the kinetic energy to electrical energy that Methodology
is stored by means of battery. Wind turbine installed also In the literature accessed, only a handful of studies have
converts the kinetic energy in wind velocity into electrical been done on alternative materials for hydro turbine
energy and store in the same battery. The study pointed out blades, especially in the area that this study is focused
that this system eliminates cost of fuel and generates clean on. This study explored a simple design approach in SHP
power and eco-friendly environment as advantages. design and development processes in order to facilitate
Standard design procedure development for pico rapid and larger involvement of local resources in SHP
propeller turbines for local manufacture in developing schemes. The design process was based on local available
countries was undertaken by Simpson and Williams material and manufacturing facilities. Calculus forms of
(2006) in collaboration with Practical Action (ITDG). A equations were avoided and simple CAD drafting and
demonstration 5 kW testing turbine was built on a site simulation softwares were used.
in Peru and the turbine design overall performance data
ZHUHREWDLQHGZLWKFRPSXWDWLRQDOÀXLGG\QDPLFV &)'  Hydro turbine design procedures
7KHSUHOLPLQDU\&)'VWXG\UHVXOWVVKRZDORZHI¿FLHQF\ $VLPSOL¿HGPRGHORISURFHGXUHVFDQEHFDWHJRULVHGLQWR
URWRUGHVLJQDQGDPLVPDWFKEHWZHHQJHRPHWU\ÀRZDQG twelve sequential steps as presented in Figure 1.
VLWH FRQGLWLRQV$ VLPSOL¿HG PDQXIDFWXULQJ PHWKRG ZDV
used to produce a new rotor with acceptable performance. Hydrology: Flow duration curve
&RPSDULVRQ RI &)' VLPXODWLRQV DQG ¿HOG WHVW UHVXOWV There are a lot of considerations to make in the design
showed improvement of CFD modelling and measurement of a micro-turbine hydro-electrical plant. Fundamentally,
techniques used at the site. WKH ÀRZ UDWH RI WKH ZDWHU VRXUFH ULYHU RU VWUHDP  WKH
,QYHVWLJDWLRQRIÀXLGÀRZSUHVVXUHDQGYHORFLW\HIIHFWV speed, maximum head, turbine type and size must be
RQ EODGHV IRU HQKDQFHPHQW RI K\GUR WXUELQH HI¿FLHQF\ FRQVLGHUHG +RZHYHU WKH PD[LPXP KHDG DQG ÀRZ UDWH
were studied by Weerapon and Sirivit (2009). CFD are the determining factors for the others. A hydrological
VLPXODWLRQRISUHVVXUHDQGYHORFLW\GLVWULEXWLRQVRQ¿YH VWXG\SURYLGHVGDWDIRUDÀRZGXUDWLRQFXUYH )'& IURP
blades of hydro bulb turbine rotating at 980 rpm with ZKLFKDPHDQÀRZUDWHLVHVWDEOLVKHGWKDWVHUYHVDVWKH
Fluent Software was performed. The large eddy simulation PD[LPXPÀRZUDWHRIWKHULYHURUVWUHDP(VWLPDWLRQRI
/(6 PRGHORIWXUEXOHQFHÀRZZDVXVHGWRFKHFNLPSDFWV a river’s hydro potential is derived from its mean annual
of blade angles on a hydro turbine mounted on the Huai ÀRZUHFRUG (6+$VVRFLDWLRQ 

Figure 1: A production layout model of a pico hydro turbine system


African Journal of Science, Technology, Innovation and Development 113

Selection of turbine
The type of turbine to be used depends mostly on two
factors derived from hydrological studies of the river or
stream. They are the net head (H DQGWKHÀRZUDWH Q) of
the river as represented in Figure 2. In general, there are
turbines that are used for high pressure (50 m and above)
and low head (below 10 m) domains for micro-hydro. For
example, Pelton turbines are used for high heads while
FURVVÀRZWXUELQHDQG.DSODQWXUELQHZLWK¿[HGRUPRYDEOH
are used for low heads. The Francis types of turbine are
used for both high and low heads and have the largest range
of usage in terms of head. It can be used for as low as 10 m
heads for micro-hydro (ESH Association 2010).
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

Evaluation of characteristics of turbines and


operational conditions
There are four most relevant parameters in turbine design Figure 2: Flow rate and head for selection of small hydro
and these are net head (Hn ÀRZUDWH Q), rotational speed turbines (Paish 2002).
of the turbine (N DQGWKHHI¿FLHQF\RIWKHWXUELQH Ș). Two PHDVXUHPHQWXVHG,WLVDOVREHLQJGH¿QHGLQWHUPVRISRZHU
of these parameters (Hn and Q) are hydrological study and expressed as (Michele 2013, Cesar 1983):
GDWDRIWKHZDWHUVRXUFH2QFHWKHÀRZFKDUDFWHULVWLFVDUH __
known, the type of turbine, calculation of basic parts and N¥ P
_____
Nsƍ  __5 (4)
the height or elevation above the tailrace water surface that Hn 4
the turbine will be installed to prevent cavitation can then where N turbine speed (rpm); Hn net head (metres);
be carried out. Q ÀRZ UDWH P3/s); and P turbine power (kW). The
In a pico hydropower plant (PHPP) system, the power H[SUHVVLRQZLWKÀRZUDWHLVSUHIHUUHGIRUWKHFDOFXODWLRQ
generated depends on these variables: RIVSHFL¿FVSHHG
i. Flow rate (Q): This is the volume of water discharged Turbines with identical geometric proportions have a
per second. It is measured in m3/s (SI unit) VSHFL¿FVSHHG Ns), irrespective of their sizes (Celso 1998,
ii. Head (H): This is the vertical net distance between +RÀHUDQG*DOH 7KHIXQGDPHQWDOFRQFHSWRINs is
fore bay level and turbine level or tail water level and to ascertain the optimal working conditions for a particular
is measured in metres. turbine design. Other useful dimensionless parameters that
iii. Rotational speed of the turbine (N) measured in DUHRIWHQXVHGWRGHVFULEHWKHÀRZUDWHVSHHGRIURWDWLRQ
revolutions per minute (rpm) turbine size and hydraulic head are (Michele 2013):
LY (I¿FLHQF\ Ș): The pico hydropower plant (PHPP) has
KLJKHI¿FLHQF\± %+$  ___
D
v = N __ (5)
¥H
Q
_____
Power (P) q = 2 __ (6)
This is the energy generated at a given time and is D ¥H
measured in watts (W) is mathematically expressed as: The parameters are important to relate the performance
of geometrically similar turbines, and are related to the
P ȘîȡîJî4î+n (1) VSHFL¿FVSHHG
__

where: Ș HI¿FLHQF\ PLFUR ± VPDOO !  


__ ¥Q
___
v¥ q = N __3 = Ns (7)
ȡ density of water (1000 kg/m3) and; g = acceleration H4
__
due to gravity (9.81 m/s2) ¥Q
_____
N Ȧ __
3 (8)
( gH )4
For Ș HTXDWLRQ  EHFRPHV
7KHVSHFL¿FVSHHGLVDFULWHULRQWKDWGHWHUPLQHVWKHVHOHFWLRQ
P 6.87 × Q × Hn (kW) (2)
of turbine type and dimension. After determination of
turbine speed (N), the gear box ratio and the generator type
Specific speed
can be selected. Table 1 presents a summary of reference
7KH IRXU EDVLF PRVW VLJQL¿FDQW SDUDPHWHUV RI K\GUR
values of Ns for dissimilar hydraulic turbines.
turbine operation as listed above are summed up in by
a sole parameter. This parameter is often referred to
Then the turbine speed in rpm can be determined as:
DV GLPHQVLRQOHVV SDUDPHWHU FDOOHG VSHFL¿F VSHHG Ns)
(Michele 2013, Gummer 2011, Cesar 1983): ____
60Ȧ
__ N = ʌ (9);
N¥ Q
_____
N=s
__
3 (3) where Ȧ speed of the turbine in radians.
Hn 4
$OWKRXJKGH¿QHGDQGFDOOHGGLPHQVLRQOHVVE\PRVWDXWKRUV
the value really depends on the parameters and units of
114 Ebhota and Inambao

Recasting these expressions using units of radians: )ORZFRHI¿FLHQWRUGLVFKDUJHQXPEHUĭ:


__
Ȧ¥ Q
_____ Q
____
ȍs = __
3 (10) ĭ= (12)
( gH )4 NDt3
______
( Pmȡ) (QHUJ\FRHI¿FLHQWRUKHDGQXPEHU
ȍ =n
¥_______ (11)
sp
( gH )5/4 gH _____
_____ E
Ȍ: Ȍ = = (13)
N2Dt2 N2Dt2
where ȍs VSHFL¿FVSHHGȍsp SRZHUVSHFL¿FVSHHGDQG
Ȧ turbine speed with units radians/unit time. 3RZHUFRHI¿FLHQWȽ: (14)
7KHYDOXHVRIVSHFL¿FDQGSRZHUVSHFL¿FVSHHGVDUH ȥ ʌ DtE
0.25 0.5 0.25
____e ________
not dependent on turbine size but on turbine technology 6SHFL¿FGLDPHWHU‫ׇ‬e; ‫ׇ‬e = = 0.75 0.5 (15)
ij e
0.5
2 Q
type as shown in Figure 3 (Bryan 2012).
______
2T
Torque number IJ; IJe = = IJ = ijeȥeȘ (16)
ʌȡȦ2rt5 e
IJ__e
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

Global hydraulic numbers and turbine parameters


The characteristics of the turbine and operational (I¿FLHQF\Ș; Ș = (19)
Ȝe
FRQGLWLRQVDUHXVXDOO\GH¿QHGE\WKUHHNH\GLPHQVLRQOHVV
SDUDPHWHUV ÀRZ FRHI¿FLHQW RU GLVFKDUJH QXPEHU ĭ), Ȝe = ijeȥe (17)
HQHUJ\ FRHI¿FLHQW RU KHDG QXPEHU Ȍ) and power ij 0.5
____
e
FRHI¿FLHQW Ƚ) (Giosio 2015). 9HORFLW\FRHI¿FLHQWv; v = (18)
ȥe
0.75

For a given head HnÀRZUDWHQVSHFL¿FHQHUJ\E and


angular velocity Ȧ the following performance parameters where ȡ ÀXLG GHQVLW\ rt radius of the blade tip;
FDQEHGH¿QHG+RÀHUDQG*DOH*LRVLR$QWRQLR Dt diameter of the blade tip and; T blade torque.
et al. 2008:
Table 1: A summary of reference values of Ns for the types of hydraulic turbines (Michele 2013).

Type of turbine Ns Type of turbine Ns


Pelton 1 jet 5–10 Francis (“medium”) 33–55
Pelton 2 jets 7–14 Francis (“fast”) 55–80
3HOWRQ !MHWV  14–20 Francis (“ultrafast”) 80–120
Francis (“slow”) 15–33 Propeller, Kaplan 75–300

Figure 3: Specific speeds for different turbine technology (Dixon and Hall 2010)
African Journal of Science, Technology, Innovation and Development 115

The blade There is always head lost and this affects effective
7KHEODGHLVWKHSDUWWKDWFRQYHUWVWKHZDWHUÀRZYHORFLW\ head, usually less than the total head. This means that
into momentum that gives the torque that turns the equation (27) was over-estimated. Therefore, the effective
generator. The blade is made up of the following features: head will be taken as Ș+. The effective axial force assumed
blade angles, hub and tip diameter, curvature, twist and to be acting across becomes:
spacing. Dt2
___
7KH ÀRZ KDV ERWK D[LDO DQG WDQJHQWLDO YHORFLW\ Faxial = ȘȡJ+ʌ 4 (26)
FRPSRQHQWVDQGDQJOHRIÀRZUHODWLYHWRWKHEODGHFDOOHG
blade angle (ȕ) moving with tangential velocity (UȦ) Figure 1 is an adapted graph designed by Bohl (1991)
GH¿QHGE\ 6LPRQ  FHQWUHG RQ HI¿FLHQW .DSODQ WXUELQH FDQ EH XVHG WR
Vaxial determine hub-to-tip diameter ratio, Kug, the tip-to-head
________
WDQ௘ȕ = rȦíV (19); velocity ratio (Dh/Dt) and the number of blades (Bohl
WDQ௘
1991). The ratio of tip velocity and head velocity is an
Q __________
__ 4Q Q
________
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

Vaxial = A = 2 = (20) important parameter in sizing of a turbine. The ratio Kug:


ʌ( Dt íDh ) ʌ( rt írh2 )
2 2

rtȦ
_____
where A area; Q ÀRZUDWHDQGrt blade radius; rh - Kug = ____ (27)
hub radius; Dt blade diameter; and Dh hub diameter. ¥ 2gH
Equating power of turbine to change in momentum: where rt the blade tip radius; Ȧ the angular velocity of
the turbine runner (rad/s) and; Kug can be derived from the
ȘȡJ+4 = ȡ4ǻVtan (21) JUDSKLQ)LJXUHEDVHGRQWKHVSHFL¿FVSHHG 6LPSVRQDQG
Williams 2011).
assuming Vtan 0 at the tail edge i.e. zero outlet swirl/ Figure 5 is an adapted graph designed by Bohl
tangential velocity, then, leading edge, Vtan ǻVtan then  FHQWUHGRQHI¿FLHQW.DSODQWXUELQHFDQEHXVHGWR
equation (8) becomes; determine hub-to-tip diameter ratio, Kug, the tip-to-head
ȡJ+ velocity ratio (Dh/Dt) and the number of blades (Bohl
____
VWDQ௘ = UȦ (22) 1991).
rtȦ
_____ where Dh – hub diameter; Dt – turbine blade tip diameter
Kug = ____ (23) and; rt – blade tip diameter
¥ 2gH
Dt
___
Round, Cround: Cround = __ (24) rtȦ
_____
¥P Kug = ____ (28)
¥ 2gH ____
where rt radius of the blade tip and; Dt diameter of the Kug¥ 2gH
blade tip. ________
from equation (30): rt = Ȧ (29)

The force on the blade where ijr central angle shown in Figure 4(b).
The two velocity components on the turbine blade
FDXVHG E\ WKH ÀRZ WDQJHQWLDO DQG D[LDO YHORFLWLHV Calculation: Pico Kaplan/propeller turbine
produce corresponding force components on the blade, The four most significant parameters
i.e. tangential and axial forces. The tangential force is Hydrological data
responsible for the torque on the turbine shaft while the Head (Hn) 2.5 m
axial force makes the turbine shaft experience axial load Flow rate (Q) 0.183 m3/s
(Simon 1991). The estimated axial load on the hub and the
bodies is calculated using the expression of the total head Rotational speed (N) 1000 rpm
pressure difference acting on the turbine: (I¿FLHQF\ Ș) 
Dt2
___
Faxia1 = pA = ȡJ+ʌ 4 (25)
assuming it acts over the entire hub and blade area.

Figure 4: a) Configuration of the runner blade (Byeon and Kim 2013), b) View of the cylindrical blade sections
116 Ebhota and Inambao

Turbine selection turbine propeller. From Table 2, Ns 208 and using this in
Figures 2 and 5 were used in the selection of turbine type Figure 5 (refer to the green lines):
and number of turbines respectively. A propeller hydro Dh
___
turbine with four blades was considered suitable; the green Number of blade, z 4; D = 0.35 and; Kug 1.7
t
lines in the Figure 5 refer. Table 2 shows the parameters
UHTXLUHG WR GH¿QH WKH QRPLQDO FRQGLWLRQV RI D K\GUR
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

Figure 5: Number of blades functions chart (Michal 2013)

Table 2: Nominal conditions for the turbine design (Figure 5 refers)


S/N Step Relevant equations Input numerical value input Answer
P = 5.89 × 4î+ P = 5.89 × 5.89 × 2.5
1 Turbine capacity, P 2.69 kW
__ _____
N × ¥Q
_______ 1000 × ¥ 0.183
_____________
2 Specific speed, Ns Ns = Ns = 215
H0.75 2.50.75
____ ____________
3 Velocity, u u = Kug¥ 2gH u = 1.7 × ¥ 2 × 9.81 × 2.5 11.91 m/s
ʌN
____ îʌî
___________
4 The angular velocity of the turbine runner, Ȧ Ȧ = 60 Ȧ= 60____________ 105 rad/s
____
Kug¥ 2gH
________ 1.7 × ¥ 2 × 9.81 × 2.5
__________________
5 The blade tip radius, rt rt = Ȧ rt = 105 0.113 m

6 The blade tip diameter, Dt Dt = 2rt Dt = 2 × 0.113 0.227 m


Dh
___
7 The hub diameter, Dh Dt = 0.35 Dh = 0.35 × 0.226 0.080 m
ʌ
__ ʌ
__
8 Cross sectional area, A A = 4 ( Dt2íDh2 ) A = 4 × ( 0.2262í2 ) 0.035 m2
4Q
__________ _________________
4 × 0.183
9 Axial velocity, Vaxial Vaxial = Vaxial = 5.20 m/s
ʌ( Dt2íDh2 ) ʌî( 0.2262í2 )
Flow coefficient, ĭ Q
____ ____________
0.183
10 ĭ= ĭ= 0.0159
NDt3 1000 × 0.2263
______
P _________________
2.69
11 Power coefficient, Ƚ ī= 3 5 ī= 3 4.6×10-9
ȡN Dt 10 × 10003 × 0.2265
gH
_____ ____________
9.81 × 2.5
12 Energy coefficient, Ȍ Ȍ = 2 2 Ȍ = 4.8×10-4
N Dt 10002 × 0.2262
Dt2
___ 0.2272
______
13 Axial force on the blade, Faxial Faxial = ȡJ+nʌ 4 Faxial îîîʌî 4 996 N
African Journal of Science, Technology, Innovation and Development 117

Dimensionless performance parameters was considered, based on aluminum availability, cost and
Three dimensionless performance parameters, ÀRZ manufacturing facilities in sub-Saharan Africa. The properties
FRHI¿FLHQW ĭ  SRZHU FRHI¿FLHQW ɝ) and energy of aluminum alloy, 6010-T6 are given in Table 4.
FRHI¿FLHQW Ȍ) were computed in Table 3 to establish their A summary of the simulation mesh results is
relation with operating parameters. The computation was done contained in Table 5. The material selected for the blade
at constant head, H (3 m) and rotational speed, N (500 rpm). is Aluminum 6010-T6 alloy and this choice was based on
)LJXUHV  DQG  UHSUHVHQW GLPHQVLRQOHVV ÀRZ aluminum availability, cost and the level of manufacture
FRHI¿FLHQW DQG SRZHU FRHI¿FLHQW ERWK DW FRQVWDQW infrastructure in the region.
rotational speed, respectively.
Study results
Blade model and simulation: Static analysis – Effects The highest stress 5.037 e + 005 N/m2) was obtained at
of axial force nodal point number 11063, as shown in Figure 9 and Table
The computer-aided design software, AutoCAD, was used ZKLFKLVDSRLQWLQWKH¿OOHWEHWZHHQWKHEODGHDQGKXE.
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

for the drafting and dimensioning while Solidworks was Aluminum 6010-T6 has a yield strength of 2.75 e + 008
used for the simulation to determine a suitable thickness. N/m2, which exceeds the highest stress recorded. This
A 3 mm blade thickness gave satisfactory results and the validates the design as failure free.
propeller blade model is shown in Table 4 and Figure 8. The lowest factor of safety was noticed at nodal
number 11603, as shown Figure 10, which is the point
Material selection where the highest stress was measured.
As noted in the introduction, the level of manufacturing
systems in sub-Saharan Africa is still too low to support Conclusion
the fabrication of some complex parts in terms of shape, The study presents the use of a SHP scheme as a viable
FRPSRVLWLRQ DYDLODELOLW\ DQG WKH GLI¿FXOW\ LQ ZRUNLQJ RQ method to increase access to electricity in sub-Saharan
certain materials. Presently, the best blade manufacturing Africa and the sequential design steps of hydro turbine
process is fabrication or casting from stainless steel materials ZHUH GLVFXVVHG 6LPSOL¿HG PDWKHPDWLFDO H[SUHVVLRQV
such as SS(16Cr5Ni), SS(13Cr4Ni) and SS(13Cr1Ni) (IEC required for low head pico hydro turbine design were
1991, Priyabrata et al. 2013). The foundries in the region tabulated and used to calculate nominal operating
cannot provide these materials adequately, or are unable to parameters of a propeller turbine.
work on such materials and the costs are also an issue. The The study is of the view that:
quest for alternative materials is vital to increase electricity i. Small hydro power (SHP) technology should be
access in the region. The blades need to be designed for popularised for rural areas, industrial estates and
strength, toughness, hardness and corrosion, cavitation- VWDQGDORQH HOHFWUL¿FDWLRQ SURYLVLRQ UDWKHU WKDQ WKH
resistant and density. In this study, aluminum alloy, 6010-T6, national grid.
Table 3: Dimensionless performance parameters
P (kW) Q (m3/s) Ns Kug z rt (m) Dt (m) Dh (m) ĭ Ȍ Ƚ
2 0.2 98 0.012 7 0.090 0.18 0.0630 0.0686 3.60×10í 0.0423
4 0.3 120 0.011 6 0.083 0.166 0.0581 0.1336 4.30×10í 0.1269
6 0.4 139 0.010 6 0.075 0.150 0.0525 0.237 5.20×10í 0.3160
8 0.5 156 0.009 5 0.068 0.136 0.0476 0.4064 6.40×10í 0.6878
10 0.6 170 0.008 4 0.060 0.120 0.0420 0.4877 8.20×10í 1.6075

Figure 6: Plot of tip diameter against flow rate Figure 7: Plot of tip diameter against power
118 Ebhota and Inambao

ii. To boost power sustainability, countries of sub- The study found that a four-blade propeller with an
Saharan Africa need to build human and infrastructure outer diameter of 0.226 m and a hub diameter of 0.079 m
capacities that will support the local manufacturing of was appropriate for a low head hydro turbine of 2.61 kW.
SHP plants and components in the region. Simulation revealed that aluminum alloy 6010-6T
iii. Increase in local contents in the manufacture of SHP shows good performance in terms of strength and density.
equipment will reduce the cost of power projects as However, the studied observed that hardness needs to be
against the present cost situation. enhanced and suggests that reinforcement material should
LY 7KH DELOLW\ WR GHVLJQ DQG PDQXIDFWXUH ZLOO ¿[ be introduced to the alloy matrix to form a composite.
operation, maintenance and availability problems and
jobs will be created.

Table 4: Material properties


Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

Model reference Properties Volumetric properties


Name: 6061-T6 (SS) Mass: 1.12596 kg
Model type: Linear elastic isotropic Volume: 0.000417024 m3
Default failure criterion: Unknown Density: 2700 kg/m3
Yield strength: 2.75 ×108 N/m2 Weight: 11.0345 N
Tensile strength: 3.1 ×108 N/m2
Elastic modulus: 6.9 ×1010 N/m2
Poisson’s ratio: 0.33
Mass density: 2700 kg/m3
Shear modulus: 2.6 ×1010 N/m2
Thermal expansion coefficient: 2.4 ×10í /Kelvin

Figure 8: The blade model

Table 5: Mesh information


Mesh type Solid mesh Total nodes 17 339
Mesher used Standard mesh Total elements 10 141
Automatic transition Off Maximum aspect ratio 35.476
Include mesh auto loops Off RIHOHPHQWVZLWKDVSHFWUDWLR 78.5
Jacobian points 4 Points RIHOHPHQWVZLWKDVSHFWUDWLR! 2.04
Element size 7.47305 mm RIGLVWRUWHGHOHPHQWV -DFRELDQ 0
Tolerance 0.373652 mm Time to complete mesh (hh:mm:ss) 00:00:03
Mesh quality High

Table 6: Von Mises stress


Name Type Min Max
13 804.1 N/m2 4.941×107 N/m2
Stress VON: von Mises stress
Nodes: 12 293 Node: 1141
0 mm 0.00763475 mm
Displacement URES: Resultant displacement
Nodes: 107 Node: 687
2.28658×10í 3.37997×10í
Strain ESTRN: Equivalent strain
Elements: 4 201 Elements: 6 732
African Journal of Science, Technology, Innovation and Development 119

1.976 × 104 N/m2


5.037 × 105

1.010 × 105 N/m2

1.252 × 105 N/m2

4.260 × 105 N/m2

1.382 × 102

1.973 × 103 N/m2


Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

Figure 9: Von Mises nodal stress

5.972 × 106

1.451 × 104

1.638 × 103
7.790 × 103

6.453 × 104

1.786 × 103

6.691 × 105

Figure 10: Depiction of factors of safety

Acknowledgement Cordeiro, J. L. 2014. Energy 2020: A Vision of the Future.


The authors hereby acknowledge the Centre for Engineering Washington, DC: IEA and US Department of Energy.
Postgraduate Studies (CEPS)/HVDC/Smart grid Centre of the Da Cruz, A. G. B., A. L. A. Mesquita, and C. J. C. Blanco. 2008.
8QLYHUVLW\RI.ZD=XOX1DWDO “Minimum pressure coefficient criterion applied in axial-flow
hydraulic turbines.” Journal of the Brazilian Society of
References Mechanical Sciences and Engineering 3. doi:10.1590/
Arriaga, M. 2010. “Pump as turbine – A pico-hydro alternative in S1678-58782008000100005.
Lao People’s Democratic Republic.” Renewable Energy 35 Dixon, S. L., and C. A. Hall. 2010. Fluid mechanics and
(5): 1109–1115. doi:10.1016/j.renene.2009.08.022. thermodynamics of turbomachinery, 6th ed. Amsterdam:
BHA (British Hydropower Association) 2006. A guide to UK Butterworth-Heinemann.
mini hydro developments. London: BHA. Ebhota, W. S., A. C. Eloka-Eboka, and F. I. Inambao, “Energy
Bohl, W. 1991. Strömungsmaschinen 2: Berechnung und sustainability through domestication of energy technologies
kalkulation. Würzburg: Vogel Business Media. in third world countries in Africa.” Paper presented at the
Bryan, P. H.-Y. 2011. “Tesla turbine for pico hydro applications.” Industrial and Commercial Use of Energy (ICUE), 2014
Guelph Engineering Journal 4: 1–8. International Conference on the Energy efficiency in
Byeon, S.-S., and Y.-J. Kim. 2013. “Influence of blade number buildings, Cape Town, 2014. 10.1109/ICUE.2014.6904197.
on the flow characteristics in the vertical axis propeller hydro Ehsan, M. M., G. O. Enaiyat, F. S. Kazy, and S. M. Ferdous.
turbine.” International Journal of Fluid Machinery and 2012. “A novel approach of electrification of the high
Systems 6 (3): 144–51. doi:10.5293/IJFMS.2013.6.3.144. rise buildings at Dhaka City during load shedding hours.”
Celso, P. 1998. Layman’s guidebook on how to develop a International Journal of Renewable Energy Research 2:
small hydro site, 2nd ed. Belgium: The European Small 123–130.
Hydropower Association (ESHA). ESH Association. 2010. “Energy recovery in existing
Cesar, F., A. Javier, C. Nicholas, and S. G. John. 1983. infrastructures with small hydropower plants.” Paper
Hydromechanics of variable speed turbines. St. Anthony presented at the Sixth Framework Programme, Mhylab,
Falls Hydraulic Laboratory, University of Minnesota. Switzerland.
120 Ebhota and Inambao

Etiosa, U., A. Matthew, E. Agharese, O. G. Ogbemudia, P. U. Paish, O. 2002. “Small hydro power: Technology and current
Osazee, and G. O. Ose. 2009. Energy Efficiency Survey in status. Renewable and sustainable.” Energy Reviews
Nigeria – A Guide for Development Policy and Legislation. 6:537–56.
KWWSZZFUHGFHQWUHRUJ3XEOLFDWLRQV((6XUYH\ Priyabrata, A., K. R. Pankaj, and M. Asis. 2013. “Selection of
Nigeria.pdf hydro-turbine blade material: Application of fuzzy logic
Giosio, D. R., A. D. Henderson, J. M. Walker, P. A. Brandner, J. (MCDA).” International Journal of Engineering Research
E. Sargison, and P. Gautam. 2015. “Design and performance and Applications 3: 426–430.
evaluation of a pump-as-turbine micro-hydro test facility Simon, A. F. 1991. “A simplified low head propeller turbine for
with incorporated inlet flow control.” Renewable Energy micro hydroelectric power.” Master of Engineering thesis,
78:1–6. doi:10.1016/j.renene.2014.12.027. University of Canterbury.
Gummer, J. H. 2011. Hydraulic turbines. Thermopedia. Simpson, R., and A. Williams, 2006. “Application of
GRL$WR=KK\GUDXOLFBWXUELQHV computational fluid dynamics to the design of pico propeller
Höfler, E., J. Gale, and A. Bergant. 2011. “Hydraulic design and turbines.” In Proceedings of the International Conference on
analysis of the Saxo-type vertical axial turbine,” Transactions Renewable Energy for Developing Countries. Washington
of the Canadian Society for Mechanical Engineering 35 (1): DC: University of the District of Columbia.
2011. Simpson, R., and A. Williams. 2011. Design of propeller turbines
Downloaded by [UNIVERSITY OF KWAZULU-NATAL], [Williams Ebhota] at 02:08 01 June 2016

IEA. 2014. Factsheet: Energy in sub-Saharan Africa today. for pico hydro. Available: www.picohydro.org.uk
International Energy Agency. Paris, France: World Energy Weerapon, N., and T. Sirivit. 2009. “Flow simulations on blades
Outlook. of hydro turbine.” International Journal of Renewable
IEC (International Electrotechnical Commission). 1991. “Field Energy Research 4: 61–66.
acceptance tests to determine the hydraulic performance =DLQXGGLQ+06<DKD\D- 0/D]L0)0 %DVDUDQG
of hydraulic turbines, storage pumps and pump-turbines.” = ,EUDKLP  ³'HVLJQ DQG GHYHORSPHQW RI SLFRK\GUR
Geneva: IEC. generation system for energy storage using consuming
Michal, V., B. Tomas, and H. Peter. 2013. “Methodology of water distributed to houses.” World Academy of Science,
3D hydraulic design of impeller of axial turbo machine.” Engineering and Technology 35: 154–159.
Engineering Mechanics 20 (2): 107–118.
Michele, M. 2013. Hydraulic turbines and hydroelectric power
plants. Energy Systems course lecture notes. Department of
Industrial Engineering, University of Rome.
CHAPTER 4: PRINCIPLES AND BASELINE KNOWLEDGE OF
FUNCTIONALLY GRADED ALUMINIUM MATRIX MATERIALS
(FGAMMS): FABRICATION AND APPLICATIONS

W. S. Ebhota and F. L. Inambao, "Principles and baseline knowledge of functionally graded


aluminium matrix materials (FGAMMs): fabrication techniques and applications,"
International Journal of Engineering Research in Africa, 2016, Vol. 26, pp 47-67.
DOI:10.4028/www.scientific.net/JERA.26.47 (Published).

54
International Journal of Engineering Research in Africa Submitted: 2016-07-18
ISSN: 1663-4144, Vol. 26, pp 47-67 Revised: 2016-07-30
doi:10.4028/www.scientific.net/JERA.26.47 Accepted: 2016-08-02
© 2016 Trans Tech Publications, Switzerland Online: 2016-10-07

Principles and Baseline Knowledge of Functionally Graded Aluminium


Matrix Materials (FGAMMs): Fabrication Techniques and Applications
Ebhota Williams S.1, a, Akhil S. Karun2, b and Inambao, Freddie L3, c
1, 3
Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal, Durban,
South Africa.
2
Materials Science and Technology Division, CSIR-National Institute for Interdisciplinary
a
Email: [email protected], bEmail: [email protected],
c
Email: [email protected]

Keywords: FGMs, fabrication techniques, aluminium matrix and ceramics reinforcements,


squeeze casting, infiltration process, compocasting, centrifugal casting, stir casting, material
prototyping

Abstract. This paper discusses the main Functionally Graded Materials (FGMs) and their bulk
fabrication techniques, their development, principles and applications. The fabrication processes
considered include powder metallurgy (PM), sintering, squeeze casting, infiltration process,
compocasting, centrifugal casting, stir casting, material prototyping. The paper provides an
overview of the FGM processing parameters including reinforcement particles size and volume %,
temperature, pressure (for PM), and stirrer and mould rotational speeds (for stir and centrifugal
casting processes respectively). The paper notes that the FGMs are widely used in the following
sectors: automotive, medical, aerospace, aviation, nuclear energy, renewable energy, chemical,
engineering, optics electronics etc.

Introduction
This paper focuses on the concept of bulk functionally graded materials (FGMs) production
technologies of aluminium alloys and composites, their processing parameters and applications.
This study reviews the past and present status of major bulk FGMs production techniques. The aim
is to identify simple and cheap methods of production that can enhance the mechanical properties of
aluminium alloys for hydro turbine blade production. Aluminium deposits are vast in sub-Sahara
Africa and their alloys can be sourced locally. Hydropower technologies can help in tackling the
perennial power problems in the region.
Functionally Graded Material (FGM) is a group of composite materials that have exceptional
properties due to exploitation of the individual properties of the constituent materials. The materials
are characterised by gradual transitions in material composition and microstructure in a specific
direction [1, 2]. The possibility of manipulating the constituent materials of a FGM to meet
functional requirements, makes this group of materials unique [3]. However, this class of advanced
materials also occur in nature. Materials such as bone, teeth etc. are examples of FGMs that occur in
nature [1]. Fig. 1 shows the path of modern materials, starting from base natural materials to FGM.
The concept of FGM was modelled from nature in the quest to solving engineering problems [4].
Pure metals have little significance in engineering applications due to their deficiencies related to
functional requirements. Quite often the requirements are conflicting and this occurrence makes
most material in their natural form less valuable from an engineering point of view. For instance, a
part may require hardness and ductility to function properly in a given working environment. It is
more or less impossible to have such a material existing naturally. In this kind of situation, two
different materials may be combined with each having one of the required properties. The combined
materials could be metal and metal, metal and non-metal or non-metal and non-metal, and during
merging they may be in the same state or not. The properties of the parent material are the
summation of the properties of the different materials that are combined. Table 1 shows various
forms of material combination that can be made, and their limitations [5].

All rights reserved. No part of contents of this paper may be reproduced or transmitted in any form or by any means without the written permission of Trans
Tech Publications, www.ttp.net. (#70367132, University of Illinois, Urbana, USA-10/10/16,01:28:59)
48 International Journal of Engineering Research in Africa Vol. 26

Figure 1: Order of modern material pattern as regards to FGM


Table 1: Production of engineering materials by materials combination [5].
Method Combination Limitation
of Materials
Alloying Molten state Thermodynamic equilibrium limit (limit to which a
material can dissolve in another material)
Powder Powder Intricate shapes and features, porosity and strength,
metallurgy
Composite Solid Delamination (separation of fibres from the matrix at
extreme working condition). This can happen for
example, in high temperature application where two
metals with different coefficient of expansion are used

FGMs have properties that are functions of location in the material as represented by Fig. 2.
These properties include chemical composition, microstructure, and atomic arrangement.

Figure 2: Functionally Graded Materials.


This group (FGM) of engineering materials evolved from composite materials. Composite
materials belong to advanced engineering materials which are usually formed by two or more
different materials in solid forms. These different materials that form composite material have
individual chemical and physical properties. Composite materials offer better properties in
combined form than the materials in their individual state. However, composite materials fail in
certain harsh working conditions such as high temperature. These harsh conditions cause the fibres
International Journal of Engineering Research in Africa Vol. 26 49

to disintegrate from the matrix and this failure process is called delamination [4, 6]. Functionally
graded materials can be divided into two broad groups namely [2, 5]:
i. Thin FGM - Thin FGMs are relatively thin sections or thin surface coating, produced by
physical or chemical vapour deposition (PVD/CVD), plasma spraying, self-propagating high
temperature synthesis (SHS) etc.
ii. Bulk FGM - Bulk FGMs are produced using powder metallurgy technique, centrifugal
casting method, solid freeform technology etc.

Historical Background
Evolution of FGMs. The FGMs were initially introduced as a class of advanced composite
materials with a single continuous or discontinuous inclination in terms of microstructure and
composition as shown in Fig. 3 [7, 8]. The FGM chemical and physical properties change trend is
3-dimensional [9]. Although, several theoretical works were carried out and reported on FGMs in
the 1970s, the influence of these studies was not great due to inadequate and suitable manufacturing
techniques. The development of present day FGMs started in 1972 in relation to the study of
composites and polymeric materials when Bever and Duwez investigated the properties of global
material and re-examined the potential use of graded composites [10, 11].

Figure 3: Type of FGM structure: (a) continuous and (b) discontinuous [12].
Shen and Bever submitted that variation of the chemical pattern of monomers, supramolecular
structure or morphology and the molecular constitution of the polymers may influence the
graduation of polymeric material. In this study, the material properties of chemical, mechanical,
biomedical and transport and their applications were discussed. However, the study did not consider
design, production and appraisal of the gradient of the structure [10]. The evolution of modern day
FGMs started in the mid-1980s when Japanese engineers’ encountered difficulty is finding a
material for a particular barrier in a hypersonic space plane project. The thermal working condition
requirements for the barrier were 1000 K inside temperature and 2000 K outside temperature with a
thickness less than 10 mm. This material necessity pushed the engineers to come up with FGM
[13]. The first national symposium on FGMs was held in Sendai, Japan in 1990 [14].
FGM technology was a popular programme from 1987 to 1991 in Japan and numerous
production techniques were advanced for FGMs processing. These initial manufacturing processes
include chemical vapour deposition, self-propagating high temperature synthesis (SHS) self-
propagating, plasma spraying, powder metallurgy and self-propagating high temperature synthesis
(SHS) and galvanoforming. From 1991 to the present many new techniques have been developed
and used. FGMs fabrication methods have been categorised differently by authors. In 1999,
Miyamoto et al. classified the manufacturing processes into four main categories; melt, layer,
preform and bulk processes as shown in Fig. 4 [15]. The delamination problem that is associated
with composite materials was eliminated in FGMs. The sharp interfaces that are mainly responsible
for the failure in composites were substituted with gradient interfaces resulting in smooth transition
between the materials in contact [4, 16]. In 1985, the application of continuous texture control was
50 International Journal of Engineering Research in Africa Vol. 26

introduced. This was to enhance binding strength and reduce the thermal stress present in ceramic
coatings and joints being prepared for recycling in rocket engines [13].
The FGMs concept spread to Europe and it has become a popular manufacturing process in
Germany. A transregional Collaborative Research Centre (SFB Transregio) was established in
2006, funded and mandated to exploit the potentials of thermomechanically coupled manufactured
graded monomaterials such as aluminum, steel and polypropylene [17].

Figure 4: Classification of FGMs fabrication methods

Functional graded aluminium alloy matrix composites (FGAAMCs), Concepts and their
Fabrication Techniques
The combination of aluminium alloy and ceramic material processed by certain techniques such as
squeeze and centrifugal casting processes form functional graded aluminium alloy matrix
composites (FGAAMCs). The industrial application of FGMs is increasing rapidly in automotive,
aircraft and aerospace [18-20]. This interest is orchestrated by the possibility of determining the
chemical and physical properties through manoeuvring of microstructure. It is possible in the FGM
manufacturing process to have a material with high wear resistance at a high temperature. For
example, this can be achieved by reinforcing the matrix with adequate distribution of ceramic
material along the mass of the part with the required bulk toughness kept intact [21]. Many
investigative works have been performed on FGMs using aluminium matrix alloys and ceramic as
reinforced materials. Examples of metal matrix materials are aluminum, brace, bronze, titanium and
magnesium. Regarding reinforcements, the most common used are nitrides (BN, ZrN, TiN),
carbides (SiC, TiC, ZrC), borides (ZrB2, TiB2, SiB2), oxides (Al2O3, MgO, TiO2, ZrO2), silicides
(MoSi2) and fine particles of various intermetallics (Fe3Al., FeAl, NiAl, Ni3Al, Ti3Al., TiAl) [22].
FGMCs of Al/SiCp have shown a lot of potential as engineering materials and have attracted
material scientists and engineers. Since the Japanese engineers’ breakthrough in the hypersonic
space plane project in the 1980s till now, researchers have been investigating different aspects of
FGMs, from characterisation of FGMs to their production techniques and applications.
There are various methods of manufacturing FGMs and an overview is presented in Table 2.
These methods are physical and chemical in form. The method to be applied depends on the type of
the materials, available manufacturing equipment for FGMs and potential application [23]. The
methods of FGMs production have witnessed tremendous development in the past two decades.
This dynamism has led to the emergence of several attractive engineering materials with striking
properties that have been applied in different sectors such as automotive and aviation sectors. The
production methods are broadly categorised into as follows [9]:
Constructive process – this process involves total automation of the management of the
compositional gradient through piling of more than one set up material selectively until a stratum of
layer formation is created. This method allows for a large layer.
International Journal of Engineering Research in Africa Vol. 26 51

Transport based process – This process is suitable for cases were movement of materials is
based on natural occurrence to form microstructural and compositional gradients during
manufacturing of FGMs. The dynamism in FGMs manufacturing technologies is rapid and the
classification is presented in Table 2.
Table 2: FGM fabrication methods and their applications [24-27].
Method Type Group of
FGM
Vapour Chemical vapour deposition (CVD) and Thin surface
deposition physical vapour deposition (PVD) coating
technique
Powder Stepwise Compositional Control: powder Bulk
metallurgy (PM) stacking, sheet lamination and wet powder
spraying
Continuous Composition Control: Centrifugal
Powder forming (CPF), impeller dry blending,
centrifugal sedimentation, electrophoretic
deposition and pressure filtration / vacuum slip
casting
Melting Centrifugal casting, sedimentation casting Bulk
processes infiltration processing thermal spray processing
Material Laser based processes: laser cladding, melting, Bulk
prototyping/solid laser sintering, selective 3D-printing and
freeform (SFF) selective laser
Fabrication
Other methods plasma spraying, electrodeposition, Thin coating
electrophoretic, ion beam assisted deposition
(IBAD), self-propagating high-temperature
synthesis (SHS)
Powder Metallurgy (PM). Powder metallurgy (PM) is a metal manufacturing process that
makes semi-finished or finished components from mixed or alloyed powders. This process involves
the following steps: production of powder metal, metalloids, metal alloys or compounds; blending
and mixing of powders, compaction; sintering; and, in some cases, repeating the operation [9, 28,
29]. PM, therefore, is the production and exploitation of metal powders. Particles whose size is less
than 100 nm (1 mm) are referred to as powder [30]. Metal powders’ attributes depend on the
following parameters: particle shape and size, particle size distribution, compressibility, apparent
density, and flow rate. PM is known to be cost effective in the production of complex-shaped
components as it minimises the application of secondary operations such as machining.
Notwithstanding the exceptional qualities of PM processes, porosity, production of parts with
complex shape and features, and high strength are challenges [31]. There are pores in almost all of
the PM parts and this has both advantages and disadvantages. One of the advantages is being able to
produce self-lubricating bearings. The pores that are linked to the surface are impregnated with oil.
However, the presence of voids in a part has serious effects on the thermal, mechanical, magnetic,
physical, wear, and corrosion behaviour of that part [30]. The design engineer is always interested
in material’s elastic constants such as Young’s modulus (E), shear modulus (G), and Poisson’s ratio
(v). PM elastic constants are related by equation (1):
E 2G 1  v (1)
Beiss shows a relation between density (ρ) and Young’s modulus (E) in equation (2):
m
§ U ·
E Eo ¨ ¸ (2)
© Uo ¹
52 International Journal of Engineering Research in Africa Vol. 26

Where Eo is the pore-free material Young’s modulus, and ρo is the pore-free material density and
m is the exponent which is pore dependent, and ranges from 2.5 and 4.5.
Also, the PM materials mechanical properties are a function of the density [32, 33].
m
P § U ·
¨ ¸ (3)
Po © Uo ¹
Where, P is the interest property, Po is the pore-free material value, ρ is the material density, ρo is
the pore-free material density, and m is an exponent the value of which depends on a given
property.
PM is a technology that has a wide diversity in the manufacturing of automobile parts. In 2015
the Metal Powder Industries Federation (MPIF) PM received an award for excellence in design
[34]. Some of the outstanding works listed in the award are: carrier and one-way rocker clutch
assembly by GKN Sinter Metals; sector gear and fixed ring by Cloyes Gear & Products Inc.;
variable valve timing (VVT) rotor adaptor assembly by GKN Sinter Metals; helical gear and spur
pinion by Capstan Atlantic; powder metallurgy aluminum camshaft-bearing cap by Metal Powder
Products Co., etc. Powder metallurgy is one of the key methods in the fabrication of functionally
graded aluminium alloy and its composites, and several academic and industrial researches have
been performed on this methodology.
Cylindrical specimens of iron powder-based graded products made from Distaloy SE powder
having regions with varied carbon content, sintered by two methods, were investigated [35]. The
sintering methods used are pressureless sintering and pressure-aided sintering, called Spark Plasma
Sintering (SPS). Arising from this study, it was observed that:
i. Sintering by means of the SPS technique produced slightly lower shrinkage compared to
conventional sintering.
ii. Microstructural studies of the manufactured products showed similar morphology of pores,
with minor consequence of sintering techniques and parameters on pore size distribution.
iii. The SPS sintered products showed an increased number of large pores, compared to the
conventional method.
iv. The SPS method cooling rate influenced the formation of numerous areas with bainitic
structure causing an increase in outer layer hardness.
Investigative work was performed on the production of AlSi alloy with carbon nanotubes
(CNTs) reinforcement for the purpose of obtaining FGM for engine piston ring applications.[36]
Wear and fatigue have been cited as the major cause of piston ring failure. FGMs fabricated by the
PM process was seen as a solution to this problem, but existing manufacturing methods could only
build cylinder specimens with limited gradients [37, 38] as cited by [36]. To address these
limitations, new equipment was developed and then used to obtain an optimised AlSi-CNTs FGM
for this purpose. This equipment permits the formation of varied continuous powder distribution
along a given side of the sample. Various mechanical tests were carried out and discussed and
including ultimate tensile and yield strengths, fatigue limit performance, tensile strain, and wear
resistance tests. The results show that [36]: hot-pressing technique is good for the fabrication of
AlSi-CNT FGM; the piston rings show varied gradient, about 2 wt.% of CNTs on the inner surface,
0 wt.% of CNTs in middle and 2 wt.% of CNTs on the outer surface of piston ring; AlSi-CNT
FGMs provide better mechanical performance compared to AlSi unreinforced alloy; and,
considering cost effectiveness, CNTs 2 wt.% gradient outer surfaces was considered best for piston
ring material.
Sintering Process. Sintering is a PM consolidation process which is carried out alongside with
the compaction process of FGM using hot pressing. Examples of sintering methods are spark
plasma sintering (SPS), high frequency induction heating and electric furnace heating. The SPS
sintering method was used in the production of HAP/Ti FGM and it was useful in stress relaxation
of FGM [39]. Porosity is a measure of sintering effectiveness and sintering models have been
created and analysed. Other factors that influence the behaviour of FGM fabricated by sintering
methods are time, sintering atmosphere, temperature, and the isostatic condensation [40]. A study
International Journal of Engineering Research in Africa Vol. 26 53

on porosity using a sintered nickel/alumina (Ni/Al2O3) FGM revealed that porosity is directly
related to the rate of shrinkage. Further, the study shows that a porosity reduction model is used to:
check quality of particle-reinforced metal-ceramic FGM and predict changes in porosity reduction
in particle dispersion development of FGMs [41, 42].
PM methods are continuously undergoing appraisal and modification for cost effectiveness,
quality and suitability. According to Kieback et al. PM includes sedimentation, plasma spraying,
electrophoretic deposition, slip casting, powder stacking, etc. as current FGMs manufacturing
methods [37]. However, some of these methods produce sharp interfaces which lead to thermal
expansion mismatch and residual thermal stresses. An example of such a PM method is sequential
slip casting [43], but Po-Hua used sedimentation and vibration to scale up the production of
aluminum and high-density polyethylene (Al-HDPE) FGMs to avoid thermal expansion mismatch
and residual thermal stresses [44].
Squeeze Casting. Ghomashchi and Vikhrov in a review study categorised four basic steps in
squeeze casting fabrication of FGMs: pouring of a calculated molten metal into the mould; closing
the mould, pressure application; and, cast ejection [45]. However, there are other fundamental
processes that are essential for quality squeeze casting. Other steps in the squeeze casting process of
aluminium matrix FGM production include melting a specified metal, degassing, preheating of
mould, pouring, and pressing. Regarding ceramic-metal functionally graded composite fabrication,
further steps are particles preheating, addition of particles to the molten metal and stirring of the
mixture.
The squeeze casting method produces finished or nearly finished castings with minor post
production processes so as a result is considered to be a near net-shape manufacturing route. The
pressure on the metal is released after solidification is completed. The applied pressure in squeeze
casting enhances the bonding force between the matrix and the reinforcement, the wettability and
solidification rate [46, 47]. Applying Clausius-Capeyron’s expression in equation (4) to a
metallostatic pressure as high as 200 MPa increases the melting point of the metal [48]. Epanchistov
stated that the eutectic point in the A-Si structure changes to a higher silicon content.[49]
'T f
Tf l
V  Vs (4)
'P 'H f
Where Tf = equilibrium freezing temperature; Vl and Vs = specific volumes of the liquid and
solid, respectively; and ∆Hf = latent heat of fusion. A rough estimate of the effect of pressure can be
determined by considering the liquid metal as an ideal gas and replacing the thermodynamic volume
equation to have equation (5):
§ 'H f ·
P Po exp ¨
¨ RT ¸¸
(5)
© f ¹
Where Po, ∆Hf and R = constants.
Numerous research studies have been conducted in different parts of the world on aluminium
and magnesium related metal matrix composites (MMCs) fabricated by the squeeze casting method.
Over 700 journal articles published on MMCs research was reported in 2000 [45, 50]. The annual
growth of the application of squeeze casting in aerospace, automotive, sport and leisure was put at
12 + 15 % [51].
Infiltration Method. Infiltration is the process of metal matrix composites (MMCs) fabrication
by means of ejecting a molten metal at a high pressure into a porous preform. Infiltration involves
two stages: initiation of flow depicted by the dynamic wetting angle, and advancing the flow in the
capillaries of the preform. The infiltration pressure threshold, P0, according to capillary law is [52]:
§ Vp ·
P0 6OJ lv cos T ¨ ¸ (6)
¨ 1  Vp D ¸
© ¹
Where θ is the contact angle; λ is the geometry depended factor; γlv is the tension of liquid-
vapour surface; D is the mean diameter; and V, is the volume fraction of the particulates.
54 International Journal of Engineering Research in Africa Vol. 26

The combination of squeeze casting and infiltration involves preform. The fabrication of a
preform has these basic steps: liquid powder processing, pressing and shaping and sintering of the
preform. The principle behind preform is the blending of a ceramic powder slurry with a sacrificial
organic pore forming agent (PFA) that is pyrolysable. The mixture is then pressed and heat treated
to pyrolyse the PFA to form preform pores. Preform processing parameters include a pore forming
agent (PFA), green sintering temperature and green pressing pressure. Cellulose particles (PC) and
carbon fibres (PF) are examples of PFAs. Table 3 shows some PFAs and their sintering
temperature.
Table 3: Sintering temperatures for different preform formation [53, 54]
Ceramics Pore forming Sintering
additives temperature (oC)
AO PF 1500
AO PC 1600
Al2O3 Glassy frit binder (AG) 1000

The study of the behaviour of FGMs characterised by pure aluminium reinforced with Al2O3 (50
% volume) and B4C particles with an average diameter of 30 μm was conducted. The composites
were fabricated by pressure gas infiltration. The study observed that during monotonic loading, the
composite materials measured 25 % elongation to failure; the ultimate tensile strengths recorded
were 120 MPa and 200 MPa for Al-Al2O3 and Al-B4C composites respectively; the tensile failure of
Al-Al2O3 was due to particle fracture while matrix porosity was responsible for the failure in Al-
B4C. Degradation of Young modulus, and density decrease were used to measure the internal
damage propagation. In another experiment, ceramic preforms with the same porosity level were
produced by sintering of RA-207LS Al2O3 powder [55]. The preforms’ porosity were based on
polymer matrix cellular structure. Two types of pressure sources were used: pressure-vacuum
infiltration (T = 720 oC, p = 15 MPa, t = 15 min), and gas-pressure infiltration (GPI) in an autoclave
(T = 700 oC, p=4 MPa, t = 5 min). The study concluded that: ceramic-metal composites with
interpenetrating of phases resulted from the two infiltration methods; GPI provided a higher degree
of infiltration; and, better composites were obtained from preforms with the smallest pores. The
flow of metal within the preforms depends on capillary size; the pressure variation along the
capillary length; the metal liquid state preserving time within the capillary; and, the alloy viscosity
dynamic. The study added that the composites produced by the GPI method are characterised by
compressive strength, higher hardness, and an increase in Young’s modulus. Fig. 5 shows the GPI
set up.

Figure 5: Schematic of GPI set up


Centrifugal casting. The fabrication of FGMs by the centrifugal casting technique involves the
filling of a spinning mould and the cast is allow to solidify before rotation is stopped [20, 56]. The
rotation creates centrifugal force that pushes the molten metal against the wall of the mould to
produce the desired shape. This technique was first used by Dimitri Sensaud DeLavaud, a Brazilian
International Journal of Engineering Research in Africa Vol. 26 55

in 1918 [56]. The method is used in the casting of metal such as functionally graded materials
(FGMs), alloy steels, corrosion- and heat-resistant steels, aluminum alloys, copper alloys, etc. It
also used in the production of non-metal such as ceramics, plastics, glasses, and practically every
material that can be melted into liquid or slurries. In centrifugal casting of hypereutectic alloys such
as A390-5%Mg, the outer periphery will be a fibrous form of silicon. The large primary silicon and
large α-aluminum dendrites will migrate to the inner region since they have almost the same
density. In the case of particles and slurry, the particles will migrate to the outer region. For a
slurry-slurry system, the heavier slurry with the higher density will move towards the mould wall.
The magnitude of the segregation depends on the speed of rotation. The force generated equation
and other common basic expression in centrifugal casting process is as follows:
The angular velocity, ω;
v 2S N
Z (7)
r 60
Centrifugal force, Fc, acting on the particle of mass m at distance r;
4S 2 N 2
Fc mZ r m
2

3600 (8)
The ratio of centrifugal force to gravitational force, G, can be simplified as;
Fc rZ 2 r § 2S N ·
G ¨ ¸
Fg g g© 6 ¹
(9)
Thornton recommends 50 G to 100 G range of speed for metal mould and 25 G to 50 G range of
speed for sand cast mould. Speeds that are too high can cause hot tears to outside surfaces and
excessive stresses [57]. The magnitude of centrifugal force possessed by particles in a molten metal
depend on the density and size of the particles. The denser and larger particles migrate to the mould
wall. The Stokes equation is used to explain this process for spherical shaped particles as in
equation (10).
d 2 U p  Ul g
v= (10)
18P
Where v is the particle velocity; d is the diameter of the particle; ρp is the particle density; ρl is
the molten metal density; g is the gravitation force; and, μ is the viscosity of the molten metal.
The centrifugal method can be categorised in different ways: it can be based on mould
arrangement and mould angle inclination to either vertical or horizontal planes [56]; and, it can be
according to liquidus temperature of the matrix alloy. There are two types of centrifugal methods of
fabrication by liquidus [58]. The ex situ or solid-particle centrifugal method involves temperature
below the liquidus temperature of the matrix material and addition of pre-fabrication reinforcement
to the liquid matrix metal by infiltration, vortex or casting method; and the centrifugal in situ
method which involves temperature above liquidus temperature of the matrix and the reinforcement
is precipitated in the matrix melt during cooling and solidification. The in situ method advantages
compared to the ex situ technique, namely, good wettability, homogeneous distribution of
reinforcement and reinforcement materials, and thermodynamic stability in the matrix alloy [59,
60].
Although many metal-ceramics FGMs have been developed by the centrifugal method, it is still
in the development stage because of the inadequate knowledge of particle distribution and control
[61]. The significant processing parameters for gradient microstructure control are: mould
temperature; crucible temperature; pouring rate; thermal gradient through the mould; velocity of
mould rotation; solidification rate etc. Temperature circulation is difficult to estimate during
centrifugal casting due to the mould’s fast rotation during pour and solidification. A schematic of a
vertical centrifugal casting machine is shown in Fig. 6.
56 International Journal of Engineering Research in Africa Vol. 26

Figure 6: Schematic of a vertical centrifugal casting machine


Presently, the centrifugal casting method is one of the cheapest and simplest FGM fabrication
methods. Gravity or centrifugal casting is the most economical to run [61]. The properties of a
material depend greatly on its microstructure. Centrifugal process parameters are used to
manipulate microstructure formation. Centrifugal technique processing parameters include pouring
and mould temperatures, speed of mould rotation, and particle size. The application of this method
is vital in the fabrication of disc, ring, and pipe components and as result it has attracted several
academic and industrial research grants.
Gomes et al. carried out a comparative analysis between the wear behaviour of Al̢SiCp FGM
and homogeneous Al̢Si̢Mg-20%SiCp composite [62]. They were subjected to the slide the
nodular cast iron (NCI) and the Pin-on disc tests without lubrication using 5N as normal load. The
study revealed that Al̢SiCp FGM has lower wear coefficient than that of the homogeneous
composite. This was attributed to the effects of SiC particles which serve as load-bearing elements.
This shows that the presence of reinforcement particles in the matrix alloy enhances the wear
resistance. However, it was demonstrated in other studies that the ratio of the matrix to
reinforcement has a threshold that should not be exceeded. Exceeding the threshold can cause
severe failure in the FGM matrix/reinforcement interface [63, 64].
Ramadan and Omer in their study produced functionally graded aluminum matrix composite
(FGAMC) through the centrifugal casting method. In the FGAMC formation, Boron 1.2 % to
1.85 % by weight was dissolved in molten aluminum at 1400 oC through the addition of AlB2 flake
of 2.71 % to 4.20 % by weight. Centrifugal casting was carried out at 800 oC. It was reported in the
results that two dissimilar regions were observed without smooth gradient as shown in Fig. 7, a
zone (outer) with AlB2 surplus and a zone (inner) with AlB2 deficit. Further, the achievement of
64 % hardness and strength increase through the increase of reinforcement particles at the outer
zone was reported [65].

Figure 7: FGMMC Microstructure of AlB2/Al (a) internal area and (b) external area [65]
Three samples of functionally graded rings were produced from aluminum A390 as a metal
matrix alloy using centrifugal casting method by Rahvard et al. The three rings of A390 alloy had
different amounts of Magnesium (Mg) of 0 %, 6 % and 12 % of weight Mg respectively. The
effects of Mg volume variation on their mechanical and microstructural properties were investigated
International Journal of Engineering Research in Africa Vol. 26 57

in the samples of the metal matrix. This was used to know the particles distribution in the matrix
alloy. Also examined was wear resistance by the three ring samples and a comparison analysis was
made. It was observed in the work that [66]:
i. The characteristics of A390 ring reinforced without Mg has the Si particles distributed in
both inner and outer areas. This particle arrangement was attributed to the density of the
primary Si being lower than that of the metal matrix alloy. This density difference will cause
the particles to drift towards the inner region. However, the highest hardness was recorded
in the outer region.
ii. The second sample which is A390 alloy with 6%Mg displayed different particle distribution
performance. The density of Mg2Si is far lower than the aluminum alloy liquid density. The
difference in densities causes the Mg2Si particles to move to the inner region with a higher
velocity. Subsequently, a distinctive alteration between the zones is obtained. It was
reported that the inner region performed better in terms of hardness and wear resistance.
iii. The third sample was 12%Mg ring with Mg2Si as primary Mg2Si reinforcement. The
distribution was observed almost throughout the entire cross-section except for a narrow free
reinforcement zone of 2mm thickness. The external layer was reported to possess the best
performance for hardness and wear resistance.
The study of processing parameters like G number, caster and casting atmosphere influences on
the cooling rate and microstructure formation were examined by Hisashi, Yoshimi and Yuko [67].
Samples of Al-Al2Cu FGMs were produced through the centrifugal casting method at different
casting conditions. The process parameters used were reinforcement volume fraction, pouring and
mould temperatures, G number, mould diameter, degassing method, and cooling method. For
experimental control and comparative analysis of the vacuum centrifugal casting, gravity casting
was explored with the process parameters. Rod-shaped and pipe-shaped Al-Al2Cu FGMs were
produced by two kinds of vacuum centrifugal casters from Al-33mass%Cu eutectic alloy. Also, the
distribution of lamellar spacing in the FGMs was evaluated. The study revealed that:
i. The composition and microstructure in both rod-shaped and pipe-shaped FGMs samples
were position dependent in the samples which are defined by production parameters such as
cooling rate.
ii. The samples of FGMs produced under vacuum show a comparatively abrupt profile of
distribution of the Al2Cu volume fraction compared to samples produced under atmospheric
gas. This was attributed to cooling rate distribution.
iii. There was a homogeneous distribution of cooling rate in smaller samples of FGMs
compared to the larger samples. It was reported that G number and atmosphere influenced
the cooling rate distribution and size of sample.
iv. It was observed that lamellar spacing is a function of position.
Babu et al. developed analytical theory used for two-dimensional dynamics simulations to
engineer metal-ceramic FGM for a preferred composition gradient employing the centrifugal
casting technique.[61] This work modelled the movement of ceramic particles in molten metal under
centrifugal force and the combination of effects of solidification. The centrifugal method was used
to produce FGM rings from the mixture of aluminum and silicon carbide (SiC) particles.
Experimental results were to validate the simulation technique and then recommended for FGM
composition gradient.
Material Prototyping or Solid Freeform (SFF) Fabrication Method. The dynamics of
Material Prototyping or Solid Freeform (SFF) Fabrication Method method of material fabrication is
very fast and has taken the centre stage of FGM production. Its benefits include production of
complex shapes, fast production speed, material optimisation, not energy intensive, and fabrication
of parts directly from CAD STL file. Five stages are involved in this method: CAD model data
generation; CAD model data conversion to Standard Triangulation Language (STL) file; STL
slicing into two dimensional cross section profiles; layer by layer deposition of component; and,
removal and finishing operations [68, 69]. SFF technologies come in various types used in the
fabrication of functionally graded materials. Prototyping technologies are still evolving with poor
58 International Journal of Engineering Research in Africa Vol. 26

surface finish and dimension accuracy challenges and current research efforts are being directed to
these challenges.
Stir Casting. Stir casting simply means the blending of the melted matrix and particles before
pouring the mixture into the mould as depicted by Fig. 8a. This is an aspect of the casting process
that is vital for quality casting of FGAAMCs by melt casting. Stirring is employed to add and
disperse the particles into the molten metal and to suspend the particles in the slurry. The
introduction of particles into the matrix melt is an important step in FGMMCs fabrication and there
are different methods to do this. These methods include: the insertion of particles restrained by inert
gas carrier into the melt through injection gun; addition of the particles to the melt stream during
pouring; use of a reciprocating piston to push particles into the molten metal; spray of particles
along with atomised molten metal into a substrate; vortex method; distribution of particles in the
molten metal by centrifugal process, etc. A complete set up of a stir casting facility is shown in
Fig. 8b. The vortex method is known to be one of the best approaches to insert particles into the
matrix melt, to distribute and suspend the particles in the slurry before it is cast. The stirring is
introduced after the matrix has melted and the stirring is made vigorous in order to form a vortex at
the surface of the matrix melt. The particles are then added to the matrix through the vortex and
stirred for few minutes before the slurry mixture is cast. Stir casting is influence by certain
parameters such as pouring temperature, stirring time, stirrer blade angle, pouring rate, and gating
systems [70, 71].

Figure 8: (a) A schematic stir casting set up; (b) a complete stir casting facility [71].
Compocasting. A lot of methods have been proposed and used to improve wettability and some
of the methods are use of wettability fluxes and agents, preheating, ceramic coating, and oxidation
[72, 73]. However, some of these methods are expensive and add to the production cost. The
addition of reinforcement particles to a semi-solid matrix at lower casting temperature is termed
slurry casting or compocasting. This modified stir casting method is regarded as an economical
technique to enhance wettability [74].
There is always a quest to improve thermal, mechanical and chemical properties of materials to
form new materials to meet the present material demands. As a result, many of the production
technologies that have been or are in use are undergoing appraisal and new ideas are being added.
Compocasting is one the casting technologies that is undergoing review and its investigation and
application is expanding. Gladston et al. fabricated AA6061-RHAp (rice husk ash particle)
composite by compocasting technique. The study observed the formation of intergranular dispersion
of particles and the improvement of macro hardness and ultimate tensile strength of RHA particles
of FGMC [73]. The challenges of homogeneous distribution of SiCp particles and the non-uniform
dispersion of coarse Si fibres in Al-Si alloys cause poor mechanical properties. These setbacks were
eliminated by the use of an accumulative roll bonding (ARB) process which operates on the
principle of compocasting technique [75]. The ARB schematic is shown in Fig. 9. It was revealed
that this process produced a composite with evenly distributed Si and SiCp particles; finer and
spheroidal Si particles; no Si and SiC particles free zone; minimised porosity; and, better matrix-
particle bonding. The mechanical attributes of the composite were enhanced.
International Journal of Engineering Research in Africa Vol. 26 59

Figure 9: Schematic of ARB set-up [75]


Combination of Methods. Some of these methods are combined for effective production of
FGAAMCs. Sintering is a major step in PM and in some cases it is combined with centrifugal the
casting process. The stir casting process can also combine with other casting processes such as
centrifugal casting, gravity casting and ultrasonic casting. Kunimine et al. combined sintering and
centrifugal casting processes to fabricate copper/diamond FGMs for grinding wheels application
[76]. The study investigated the influence of fabrication parameters such as casting and sintering
temperatures, and the holding time on microstructure of a copper/diamond FGM. The novel FGM
production stages are as shown in Fig. 10.

Figure 10: Schematic depiction of centrifugal sintered-casting method [76].


Kunimine et al. study revealed that: preform thickness can be controlled by choosing
combinations of sintering holding time and temperature; copper/diamond FGMs were produced
under casting temperatures of 1393 K and 1373 K by centrifugal sintered-casting technique and
diamond abrasive grain fractions were controlled by processing parameters; the amount of pores in
copper/diamond FGMs structure serve as chip spaces and were appropriate for grinding wheels for
60 International Journal of Engineering Research in Africa Vol. 26

machining carbon fibre-reinforced plastic (CFRP) application and gyro-driving grinding wheel
systems provided with copper/diamond FGMs grinding wheel drilled on CFRP plate precisely
without burring and delamination.
Erdemir et al. combined two techniques, hot press and consolidation method, to fabricate a
number of layers of Al2024/SiC FGMs. The study investigated the impact of SiC volume fraction
on corrosion and wear resistance behaviour. The formation of FGMs of varied percentage of SiC
(30 % to 60%) were used [77]. The study observed that: two layered FGMs with 50 wt.% SiC on
outer layer composites showed excellent corrosion resistance in 3.5% NaCl solution; the
macrohardness of Al2024/SiC FGM with 40 wt.% SiC was 225 Hv while 30 wt.% SiC measured
170 Hv; increase in SiC content in Al2024/SiC decreases wear rate while increase in the applied
load increases wear loss. The study concludes that wear mechanism changes from adhesive wear to
abrasive wear due to an increase in SiC particles content.

Effects of wettability and porosity in FGMs


Wettability. The spreading of a liquid around a solid surface is defined as wettability and it
relates to the close contact between a solid and a liquid. The manner in which reinforcement
particles are wet by melt is a measure of success of particle insertion into the casting in composite
production. The addition of reactive elements, such as Zr, Ti, Mg, Ca, etc. to metal matrix
stimulates wettability of matrix on particles. Young Dupre’s equation describes the bonding force
relationship between the matrix and the particles in terms of contact angle (θ) as shown is Fig. 11 as
follows [78]: T  0o (Perfect wettability); T  180o (no wetting); 0  T  180o (partial wetting).

Figure 11: Schematic showing the contact angle between the solid phase and the liquid phase [70]
Where γsv is the solid–vapour; γsl is the solid–liquid interfacial energy; and γlv is the liquid–
vapour interfacial energy.
A series of investigation on the influence of stirring casting on microstructure and wettability
effects in FGAAMCs carried out by Hashim, Looney and Hashmi in which they carried out a series
of wettability tests in aluminium FGAAMCs fabricated by stirring of semi-liquid slurry. A359
alloy, SiCp and magnesium were used as matrix, reinforcement, and wetting agent respectively [70].
The study had stirring rotational speed, impeller size, holding temperature and stirrer location in the
melt as the relevant fabrication processing parameters. A variety of mechanical properties can be
achieved through this process by varying these processing parameters. This is because mechanical
properties of the FGAAMCs largely depend on the reinforcement type, size, and its distribution
pattern, the particles wet level by the matrix, and the quantity of porosity. The technique was
described as cost effective, however, this greatly depends on how the production technical
challenges are resolved.
The influence of processing parameters (temperature and holding time) on the dispersion of
particles in a matrix and the subsequent mechanical behaviours was studied [79]. The matrix and
reinforcement used were Al-11Si-Mg and SiCp (40 μm) respectively fabricated by stir casting at a
constant rotation speed of 450 rpm. The formation of dendrites was conspicuously observed and the
particles were evenly distributed in the specimens prepared at 700 oC, 750 oC, and 800 oC. Coupled
with no significant pore formation, particle clustering was not seen in the SEM image. However,
International Journal of Engineering Research in Africa Vol. 26 61

significant pores and particles clustering were found in the specimens prepared at 850 oC and 900
o
C. This condition was credited to the high viscosity which induces low shearing melt rate.
Abrasive wear property of Al6082-SiC-Gr hybrid composites produced by stir casting was
examined and compared with Al6082 alloy and Al6082–SiC composites [80]. The study reported
that: Al-SiC-Gr hybrid composites had a better wear resistance performance than Al6082 alloy and
Al6082-SiC composites; 16.4 % and 27 % wear enhancement was observed of 200 mm grit size of
Al-SiC-Gr composite, as-cast and T6 heat treated respectively when 15N load was applied; 100 mm
grit size of Al-SiC-Gr composite, as-cast and T6 heat treated respectively, were found to be 19.6 %
and 26.9 % wear resistance improved respectively.
Porosity. In most engineering materials, porosities are regarded as defects and as such material
are made dense to minimise porosity and to enhance mechanical properties in FGAAMCs. Porosity
formation is caused by air bubbles in a matrix melt, vapour from surfaces of reinforcing particles,
gas entrapment and hydrogen evolution, and shrinkage during solidification [81]. Research works
have shown that the porosity in a FGMMC is also a function of casting processing parameters. A
decrease in the amount of porosity in FGMMC means an increase in the Poisson ratio, damping
capacity, Young’s modulus of elasticity and tensile and compressive strength. However, there are
engineering and biomedical materials where porosity serves a useful purpose. Some of the
engineering materials where porosity is useful are filters, catalyst supports and furnace lining bricks
[82]. Applications of porous material includes solid oxide fuel cells porous electrodes, and isolating
bacteria membranes used in bioreactors [83]. a series of production techniques have been invented
and appraised to reduce porosity in cast FGMs and these include: vacuum casting, inert gas
bubbling past the liquid metal, casting under pressure, compressing, rolling of material after casting
to close the voids, and addition of hexachloroethane to melt.

Applications areas of FGMs


The FGM concept is described as a systematic process of bringing incompatible functions such
as thermal, wear and corrosion resistance, toughness and machinability into a single part. This has
expanded the application of FGMs in many sectors. Table 4 and Fig. 12 present FGMs application
areas.
Table 4: FGMs application areas
Sectors Applications
Engineering Cutting tools, machine parts, engine components, etc.
Medical Biomaterials: implants, artificial skin, drug delivery system
Energy Thermionic and thermoelectric converters, fuel cells and solar
batteries
Aerospace Space plane nose, combustion chamber protective layer, body
components etc.
Automotive Crown of piston, cylinder liners, exhaust valves and valve
seating
Nuclear First wall of fusion reaction, fuel pellets
Optics Optical fibre, lens
Chemical Heat exchanger, heat pipe, slurry pump, reaction vessel
plants
Electronics Graded band semiconductor, substrate, sensor

Two FGMs in commercial status are high performer cutting tools, namely, tungsten
carbide/cobalt and a razor blade of iron aluminum/stainless steel (FeAl/SS) FGM [15].
62 International Journal of Engineering Research in Africa Vol. 26

Figure 12: FGMs application areas

Conclusion
This paper presents an overview of the main FGMs bulk production techniques, their evolution,
principles and applications. The fabrication processes include PM, sintering, squeeze casting,
infiltration process, compocasting, centrifugal casting, stir casting, material prototyping. Despite the
rapid development observed in the all the techniques considered, challenges still abound in getting
the desirable material without certain material attributes being a trade-off. The use of some of these
techniques for mass production is challenging from cost of fabrication perspective. However, the
combination of methods is seen as the most promising method of evolving new quality FGMs.
Several FGAAMCs laboratory investigations have shown that the main processing parameters
depends on the type of fabrication method used. However, reinforcement particle size, and casting
temperature seem to be general while pressure, mould, and stirrer speed of rotational are for PM,
centrifugal and stir castings respectively.

Acknowledgment
The authors hereby acknowledge the Centre for Engineering Postgraduate Studies
(CEPS)/HVDC/Smart Grid Centre of the University of KwaZulu-Natal.
International Journal of Engineering Research in Africa Vol. 26 63

References
[1] K. B. Shailendra, S. Ritesh, and R. M. Prabhat, "Functionally Graded Materials: A Critical
Review," International Journal of Research (IJR) vol. 1, pp. 289-301, 2014.
[2] G.E. Knoppers, J.W. Gunnink, J. Van Den Hout, and W. P. V. Vliet, "The Rreality of
Functionally Graded Material Products " presented at the International Solid Freeform Fabrication
Symposium, University of Texas at Austin, Texas, 2004.
[3] P. Shanmugavel, G. B. Bhaskar, M. Chandrasekaran, P. S. Mani, and S. P. Srinivasan, "An
Overview of Fracture Analysis in Functionally Graded Materials," European Journal of Scientific
Research, vol. 68, pp. 412-439, 2012.
[4] S. S. Wang, "Fracture Mechanics for Delamination Problems in Composite Materials,"
Journal of Composite Materials, vol. 17, pp. 210-223, 1983.
[5] M. M. Rasheedat, T. A. Esther, S. Mukul, and P. Sisa, "Functionally Graded Material: An
Overview," in Proceedings of the World Congress on Engineering, WCE, London, U. K., 2012.
[6] S. S. Wang and I. Choi, "The Interface Crack Between Dissimilar Anisotropic Composite
Materials," Journal of Applied Mechanics, vol. 50, pp. 169-178, 1983.
[7] J. J. Lannutti, "Functionally Graded Materials: Properties, Potential and Design Guidelines,"
Compos. Eng. 4(1):81-94, vol. 4, pp. 18-94, 1994.
[8] A. Shukla, N. Jain, and R. Chona, "A Review Of Dynamic Fracture Studies In Functionally
Graded Materials," Strain vol. 42, pp. 76-95, 2007.
[9] N. S. J. Siti, M. Faizal, M. N. Dewan, and N. B. Shah, "A Review on the Fabrication
Techniques of Functionally Graded Ceramic-Metallic Materials in Advanced Composites,"
Scientific Research and Essays, vol. 8, pp. 828-840, 2013.
[10] M. Shen and M. B. Bever, "Gradient in Polymetric Materials," Material Science and
Engineering, vol. 7, pp. 741-746, 1972.
[11] M. B. Bever and P. F. Duwez, "Gradient in Composite Materials. ," Materials Science and
Engineering vol. 10, pp. 1-8, 1972.
[12] J. Saifulnizan, "Application of Functionally Graded Materials for Severe Plastic
Deformation and Smart Materials: Experimental Study and Finite Element Analysis," PhD,
Department of Engineering Physics, Electronics and Mechanics, Graduate School of Engineering,
Nagoya Institute of Technology, 2012.
[13] M. Niino, T. Hirai, and R. Watanabe, "The Functionally Gradient Materials," J Jap Soc
Compos Mat, vol. 13, pp. 257-264, 1987.
[14] B. M. Ankit and C. P. Khushbu, "A Review of Stress Analysis of Functionally Graded
Material Plate with Cut-out," International Journal of Engineering Research & Technology
(IJERT), vol. 3 2014.
[15] Y. Miyamoto, W. Kaysser, B. Rabin, A. Kawasaki, and R. Ford, Functionally Graded
Materials: Design, Processing and Applications.: Kluwer Academic Publishers, 1999.
[16] S. S. Wang, "Fracture Mechanics for Delamination Problems in Composite Materials,"
Journal of Composite Materials, vol. 17, pp. 210-223, 1983.
[17] T. SFB. (2006, 22/7/2016). Process-Integrated Manufacturing of Functionally Graded
Structures on the Basis of Thermo-Mechanically Coupled Phenomena (Research for the Sustainable
Products of Tomorrow ed.). Available:
http://web.archive.org/web/20150319184523/http://www.transregio-30.com/index.php?id=4&L=1
64 International Journal of Engineering Research in Africa Vol. 26

[18] A. C. Vieira, L. A. Rocha, and J. R. Gomes, "Influence of Sic Particles Incorporation on the
Microstructure and Tribological Behaviour of Functional Graded Al/SiCp Composites," in
Proceedings of the IV Iberian Congress on Tribology, Ibertrib, Bilbao, Spain, , 2007.
[19] F. Erdemir, A. Canakci, and T. Varol, "Microstructural Characterization and Mechanical
Properties of Functionally Graded Al2024/Sic Composites Prepared by Powder Metallurgy
Techniques," Transaction Nonferrous Metallargy Society China vol. 25, p. 3569−3577, 2015.
[20] A. C. Vieira, P. D. Sequeira, J. R. Gomes, and L. A. Rocha, "Dry Sliding Wear of Al
Alloy/SiCp Functionally Graded Composites: Influence of Processing Conditions," Wear vol. 267
pp. 585–592., 2009.
[21] Y. Watanabe, A. Kawamoto, and K. Matsuda, "Particle Size Distributions in Functionally
Graded Materials Fabricated by Centrifugal Solid-Particle Method," Composites Science and
Technology vol. 62, pp. 881–888, 2002.
[22] A. Ibrahim, F. Mohamed, and E. Lavernia, " Particulate Reinforced Metal-Matrix
Composites - A Review," Journal of Materials Science vol. 26, pp. 1137-1156, 1997.
[23] M. Schwartz, "Encyclopedia of smart materials: Smart Materials," Wiley-Interscience, vol.
2, p. 1176, 2002.
[24] R. Knoppers, J. W. Gunnink, d. H. J. Van, and V. W. Vliet, "The Rreality of Functionally
Graded Material Products," TNO Science and Industry, Netherlands.
[25] J. F. Groves and H. N. G. Wadley, "Functionally Graded Materials Synthesis via Low
Vacuum Directed Vapor Deposition," in Composites Part B: Engineering vol. 28, ed, 1997.
[26] D. W. Hutmacher, M. Sittinger, and M. V. Risbud, "Scaffoldbased Tissue Engineering:
Rationale for Computer-Aided Design and Solid Freeform Fabrication Systems," Trends
Biotechnol, vol. 22, pp. 354-62, 2004.
[27] K. A. Mumtaz and N. Hopkinson, "Laser Melting Functionally Graded Composition of
Waspaloy and Zirconia Powders," Journal of Materials Science and Engineering, vol. 42, pp. 7647-
7656, 2007.
[28] S. Kateřina, K. Miroslav, and S. Ivo, Powder Metallurgy. Ostrava: University Textbook,
Technical University of Ostrava, 2014.
[29] N. R. Ganesh. (n. d., 04/07/2016). Powder Metallurgy: Basics and Applications. Available:
http://www.iitg.ernet.in/engfac/ganu/public_html/Powdermetallurgy.pdf
[30] B. J. W., "Powder Metallurgy Methods and Applications," in ASM Handbook, Powder
Metallurgy. vol. 7, P. Samal and J. Newkirk, Eds., ed: ASM International, 2015.
[31] R. K. Rajput, Manufacturing Technology: Manufacturing Processes. New Delhi, DELHI,
India: Laxmi Publications, 2008.
[32] P. Beiss, "Principles of Metal Powder Compaction," presented at the European Powder
Metallurgy Association Training Course,, Aachen, Germany, 2005.
[33] P. Beiss, "Structural Mass Production Parts, Landolt-Bornstein: Numerical Data and
Functional Relationships in Science and Technology," V. Group VIII Advanced Materials and
Technologies, Materials, Sub-volume A, Powder Metallurgy Data, Ed., ed. Heidelberg, Germany:
Springer.
[34] MPIF. (2015, 04/07/2016). Distinguished Service to Powder Metallurgy Award Recipients.
Available: http://www.mpif.org/AboutMPIF/PDFs/Distinguished-Service-Recipients.pdf
International Journal of Engineering Research in Africa Vol. 26 65

[35] Z. Krzysztof and P. Piotr, "Iron Powder-Based Graded Products Sintered by Conventional
Method and by SPS," Advanced Powder Technology vol. 26, pp. 401-408, 2015.
[36] O. Carvalho, M. Buciumeanu, S. Madeira, D. Soares, F. S. Silva, and M. G., "Optimization
of AlSi–CNTs Functionally Graded Material Composites for Engine Piston Rings," Materials and
Design vol. 80, pp. 163-173, 2015.
[37] B. Kieback, A. Neubrand, and H. Riedel, "Processing Techniques for Functionally Graded
Materials " Materials Science and Engineering: A 362 (1-2), pp. 81-106, 2003.
[38] J. Gandra, P. Vigarinho, D. Pereira, R. M. Miranda, A. Velhinho, and P. Vilaca, "Wear
Characterization of Functionally Graded Al–SiC Composite Coatings Produced by Friction
Surfacing," Mater. Design, vol. 52, pp. 373-383, 2013.
[39] F. Watari, H. Kondo, S. Matsuo, R. Miyao, A. Yokoyama, M. Omori, et al., "Development
of Functionally Graded Implant and Dental Post for Bio-Medical Application," Mater. Sci. Forum,
pp. 423-425:321-326, 2003.
[40] L. A. Dobrzanski, B. Dolzanska, K. Golombek, and G. Matula, "Characteristics of Structure
and Properties of a Sintered Graded Tool Materials with Cobalt Matrix," Arch. Mater. Sci. Eng. ,
vol. 47, pp. 69-76, 2011.
[41] M. Pines and H. Bruck, "Pressure-Less Sintering of Particle-Reinforced Metal-Ceramic
Composites for Functionally Graded Materials: Part II Sintering Model," Acta Mater, vol. 54, pp.
1467-1474, 2006.
[42] N. B. Dhokey, V. A. Athavale, N. Narkhede, and M. Kamble, "Effect of Processing
Conditions on Transient Liquid Phase Sintering of Premixed Aluminium Alloy Powders," Adv,
Mat. Lett. , vol. 4, pp. 235-240, 2013.
[43] J. S. Moya, A. J. Sanchezherencia, J. Requena, and R. Moreno, Sep. , "Functionally
Gradient Ceramics by Sequential Slip Casting," Materials Letters, vol. 14, pp. 333-335, 1992.
[44] L. Po-Hua, "Fabrication, Characterization and Modeling of Functionally Graded Materials,"
Doctor of Philosophy, Graduate School of Arts and Sciences, Columbia University, 2013.
[45] M. R. Ghomashchi and A. Vikhrov, "Squeeze Casting: An Overview " Journal of Materials
Processing Technology, vol. 101 pp. 1-9, 2000.
[46] R. S. M. Seyed, "Processing of Squeeze Cast Al6061–30 vol% SiC Composites and their
Characterisation," Materials and Design, vol. 27, pp. 216-222, 2006.
[47] D. M. and K. V. S. Senthil, "Squeeze Casting of Aluminium Metal Matrix Composites- An
Overview," presented at the 12th Global Congress on Manufacturing and Management, GCMM
2014, 2014.
[48] S. Chatterjee and A. A. Daas, "Effects of Pressure on Solidification of some Commercial
Aluminium-Base Casting Alloys," The British Foundryman, vol. 11, pp. 420-427, 1972.
[49] O. G. Epanchistov, "Structure and Properties of Metals Solidified under High Pressure " 34-
37, vol. 6, p. Russian Casting Production, 1972.
[50] I. G. Crouch, "Aluminium Squeeze Casting Technology: European Researches Viewpoint "
presented at the Australian Conference on Materials for Industrial Development, Christchurch, New
Zealand, 1987
[51] R. Di, E. and G. Piatti, "Metal matrix composites: state of the art,," Alum. Mag. , vol. 1,
1994.
66 International Journal of Engineering Research in Africa Vol. 26

[52] J. Bear, Dynamics of Fluids in Porous Media. New York: American Elsevier Publishing.
Co, 1972.
[53] D. Staudenecker, "Development of Porous Ceramic Preforms and Manufacture of Metal-
Ceramic Composites," Diploma FH Aalen, FH Aalen Germany, 2001.
[54] A. H. Bernd, "Pressure Infiltration Behaviour and Properties of Aluminium Alloy - Oxide
Ceramic Preform Composites," Doctor of Philosophy, School of Metallurgy and Materials, The
University of Birmingham, 2009.
[55] A. Boczkowska, P. Chabera, A. J. Dolata, M. Dyzia, and A. Oziębło, "Porous Ceramic -
Metal Composites Obtained by Infiltration Methods," Metalurgija vol. 52, pp. 345-348, 2013.
[56] W. Sufei and L. Steve, "ASM Handbook: Centrifugal Casting," ASM International, vol. 15,
pp. 667-673, 2008.
[57] M. J. Amit. (n.d, 06/07/2016). Aluminium Foundry Practice. Available:
http://www.metalwebnews.com/howto/casting/casting.pdf
[58] Y. WATANABE, H. SATO, and Y. FUKUI, "Wear Properties of Intermetallic Compound
Reinforced Functionally Graded Materials Fabricated by Centrifugal Solid-particle and In-Situ
Methods," Journal of Solid Mechanics and Materials Engineering, vol. 2, pp. 842-853, 2008.
[59] B. S. S. Daniel, V. S. R. Murthy, and G. S. Murty, "Metal-Ceramic Composites Via In-Situ
Methods," J Mater Process Technol, vol. 68, pp. 132–155, 1997.
[60] M. Hoseini and M. Meratian, "Tensile Properties of In-Situ Aluminium–Alumina
Composites," Mater Lett vol. 59, pp. 3414–3418, 2005.
[61] E. J. Babu, T. P. D. Rajan, S. Savithri, U. T. S. Pillai, and B. C. Pai, "Theoretical Analysis
and Computer Simulation of the Particle Gradient Distribution in a Centrifugally Cast Functionally
Gradient Material," presented at the International Symposium of Research Students on Materials
Science and Engineering, Chennai, India, 2004.
[62] J. R. Gomes, L. A. Rocha, S. J. Crnkovic, R. F. Silva, and A. S. Miranda, "Friction and
Wear Properties of Functionally Graded Aluminum Matrix Composites. ," Mateirals Science Forum
vol. 91, pp. 423–425, 2003.
[63] J. R. Gomes, A. S. Miranda, L. A. Rocha, and R. F. Silva, "Effect of Functionally Graded
Properties on the Tribological Behaviour of Aluminium Matrix Composites," Key Engineering
Materials 2002.
[64] R. Pippan and P. Weinert, "The Effective Threshold of Fatigue Crack Propagation in
Aluminium Alloys: The influence of Particle Reinforcement," Philosophical Magazine A, vol. 77,
pp. 875-886 1998.
[65] K. Ramazan and S. Omer, "Fabrication and Properties of Functionally Graded Al/AlB2
Composites," Journal of Composite Materials, vol. 0, pp. 1-9, 2014.
[66] M. R. Masoud, T. Morteza, M. A. B. Seyed, and G. S. Sajad, "Characterization of the
Graded Distribution of Primary Particles and Wear Behaviour in the A390 Alloy Ring with Various
Mg Contents Fabricated by Centrifugal Casting," Materials and Design vol. 65, pp. 105–114, 2014.
[67] Y. Watanabe, Y. Hattori, and H. Sato, "Distribution of Microstructure and Cooling Rate in
Al-Al2Cu Functionally Graded Materials Fabricated by a Centrifugal Method," Journal of Materials
Processing Technology, vol. 221, pp. 197-204, 2015.
[68] X. Lin and T. M. Yue, "Phase Formation and Microstructure Evolution in Laser Rapid
Forming of Graded SS316L/Rene88DT Alloy," Mater Sci Engng, vol. A402, pp. 294-306, 2005.
International Journal of Engineering Research in Africa Vol. 26 67

[69] M. A. Boboulos. (2015, 25/08/2015). CAD-CAM & Rapid Prototyping Application


Evaluation. Available: www.bookBoom.com.
[70] J. Hashim, L. Looney, and M. S. J. Hashmi, "Metal Matrix Composites: Production by the
Stir Casting Method," Journal of Materials Processing Technology, vol. 92-93, pp. 1-7, 1999.
[71] M. J. Jebeen, I. Dinaharan, and S. S. Joseph, "Prediction of Influence of Process Parameters
on Tensile Strength of AA6061/TiC Aluminum Matrix Composites Produced using Stir Casting,"
Transaction Nonferrous Metallurgy Society China, vol. 26, p. 1498−1511, 2016.
[72] K. B. Ashok and N. Murugan, "Metallurgical and Mechanical Characterization of Stir Cast
AA6061-T6–AlNp Composite," Materials and Design, vol. 40, p. 52−58, 2012.
[73] K. G. J. Allwyn, S. N. Mohamed, I. Dinaharan, and R. S. J. David, "Production and
Characterization of Rich Husk Ash Particulate Reinforced AA6061 Aluminum Alloy Composites
by Compocasting," Transaction Nonferrous Metallurgy Society China, vol. 25, p. 683−691, 2015.
[74] L. Ceschini, G. Minak, and A. Morri, "Tensile and Fatigue Properties of the AA6061/20
vol.% Al2O3p and AA7005/10 vol.% Al2O3p Composites," Composites Science and Technology,
vol. 66, p. 333−342, 2006.
[75] S. Amirkhanlou, J. Roohollah, N. Behzad, and R. T. Mohammad, "Using ARB Process as a
Solution for Dilemma of Si and SiCp Distribution in Cast Al–Si/SiCp Composites," Materials
Process Technology, vol. 211, pp. 1159-1165, 2011.
[76] K. Takahiro, S. Masafumi, S. Hisashi, and W. Yoshimi, "Fabrication of Copper/Diamond
Functionally Graded Materials Forgrinding Wheels By Centrifugal Sintered-Casting," Journal of
Materials Processing Technology vol. 217, pp. 294-301, 2015.
[77] E. Fatih, C. Aykut, V. Temel, and O. Serdar, "Corrosion and Wear Behavior of Functionally
Graded Al2024/Sic Composites Produced by Hot Pressing and Consolidation," Journal of Alloys
and Compounds vol. 644, pp. 589-596, 2015.
[78] J. Narciso, A. AIonso, A. Pamies, C. Garcia-Cordovilla, and E. Louis, "Wettability of
Binary and Ternary Alloys of the System Al-Si-Mg with SiC Particulates," Scripta Metallurgy, vol.
31, pp. 1495-1500, 1994.
[79] G. G. Sozhamannan, P. S. Balasivanandha, and V. S. K. Venkatagalapathy, "Effect of
Processing Paramters on Metal Matrix Composites: Stir Casting Process," Journal of Surface
Engineered Materials and Advanced Technology, vol. 2, pp. 11-15, 2012.
[80] N. C. Kaushik and R. N. Rao, "Effect of Grit Size on Two Body Abrasive Wear of Al6082
Hybrid Composites Produced by Stir Casting Method " Tribology International vol. 102, pp. 52-60,
2016.
[81] S. N. Aqida, M. I. Ghazali, and J. Hashim, "Effects Of Porosity On Mechanical Properties
Of Metal Matrix Composite: An Overview " Jurnal Teknologi, vol. 40, pp. 17-32, 2004.
[82] M. Xigeng and S. Dan, "Graded/Gradient Porous Biomaterials," Materials vol. 3, pp. 26-47,
2010.
[83] L. H. Larry, "Bioceramics," Journal of the American Ceramic Society, vol. 81, pp. 1705-
1728, 1998.
CHAPTER 5: CENTRIFUGAL CASTING TECHNIQUE BASELINE
KNOWLEDGE, APPLICATIONS, AND PROCESSING
PARAMETERS: OVERVIEW

W. S. Ebhota and F. L. Inambao, "Centrifugal casting technique baseline knowledge,


applications, and processing parameters: overview," International Journal of Materials
Research, 2016. DOI: 10.3139/146.111423 (Published).

55
R
International Journal of
MATERIALS RESEARCH

Zeitschrift für METALLKUNDE

Review
W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

Williams S. Ebhotaa , Akhil S. Karunb , Freddie L. Inambaoc


a Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal, Durban, South Africa
b Materials Science and Technology Division, CSIR-National Institute for Interdisciplinary Science and Technology,
Thiruvananthapuram, India
c Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal, Durban, South Africa

Centrifugal casting technique baseline


knowledge, applications, and processing
For personal use only.

parameters: overview

wear resistance, machinability and toughness. Several pro-


The increasing need for materials with light weight, high re- duction techniques have been employed in the production
sistance to corrosion and wear, toughness and strength, ma- of functionally graded aluminium matrix composites
chinability, high thermal capacity etc. for various applica- (FGAMCs) with exceptional properties and this has spurred
tions is unending. This demand has continued to stretch their applications. Table 1 presents FGMs fabrication meth-
the exploitation and manipulation of various functionally ods and their applications. Presently, FGAMCs are widely
graded materials (FGMs) and their production methods. used in automotive, aerospace, sports, medicine, nuclear
This study explores one of the FGM production processes energy, renewable energy, chemical, optics, electronics,
called the centrifugal casting technique (CCT). The centri- and general engineering industries [1 – 5]. The increase in
fugal casting process has several potential advantages over the application of FGM aluminium composites is due to
traditional casting methods. This study provides informa- the following properties that they possess: high specific
tion regarding the basic functionally graded production strength, low density, good wear and corrosion resistance,
methods and their applications and also discusses cate- Young’s modulus and high thermal capacity materials
gories of CCT, evolution and process parameters. [6, 7]. Aluminium matrix composites have been reinforced
with a variety of particles including: nitrides (BN, ZrN,
Keywords: Functionally graded materials; Centrifugal
TiN); carbides (SiC, TiC, ZrC); borides (ZrB2, TiB2,
casting technique; Process parameters; Aluminium metal
SiB2); oxides (Al2O3, MgO, TiO2, ZrO2); silicides (MoSi2);
matrix; Reinforcement particles
and fine particles of various intermetallics (Fe3Al, FeAl,
NiAl, Ni3Al, Ti3Al, TiAl) [8 – 11].
This study focuses on the centrifugal casting technique
(CCT) which has several potential advantages over tradi-
1. Introduction tional casting methods. Empirically, alloy castibility can
be improved by mould rotation, as the magnitude of centri-
Functionally graded materials (FGMs) production methods fugal force far exceeds that of gravity. This technique
are engineering materials and production processes which drives the molten metal into thin trailing edges and forces
combine various functional attributes in one part. For in- trapped air to escape [12 – 14]. However, low superheat is
stance, these attributes could be thermal, corrosion and required as casting materials are sometimes very reactive,

960 Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

coupled with high turbulent flow and gas trapping asso- tubes and pipes such as water supply lines, gas pipes, sew-
ciated with high molten metal velocity [15 – 17]. age pipes, rings, bushings, engine cylinder liners, pistons,
streetlamp posts, brake drums etc.
1.1. Principle of CCT Centrifugal forces play a significant role during the pour-
ing and solidification phase in determining the properties of
The principle behind CCT is the use of forces generated the cast. The force increases towards the outer region of the
from the centripetal acceleration of a rotating mould to dis- cast, away from the axis of rotation. This leads to a higher
tribute the metal matrix and particles into the mould. At the density at the outer surface than the nearest region to the
early stage of the history of this casting process, most axis, as represented in Fig. 1. The centrifugal force is a
moulds were cylindrical and mainly made from iron, gra- function of density and radius and is tangential to the circu-
phite and steel. Sand or refractory lining materials were lar path of rotation. This pushes the melt or particle to the
used to make cores. Objects with polynomial cross-sec- periphery where it is retained by the wall of the mould. For
tions, such as square and other shapes, can be produced by a matrix and reinforcement particle, the component with
CCT, but such objects will have round inner surfaces. This higher density possesses greater centrifugal force and
technique was predominantly used for the manufacture of moves farther away from the centre of rotation.
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

Table 1. FGMs fabrication techniques and their applications.

Method Type Group of FGM

Vapour deposition techniques Chemical vapour deposition (CVD) and physical vapour deposition (PVD) Thin surface
coating
Powder metallurgy (PM) Stepwise Compositional Control: powder stacking, sheet lamination and Bulk
wet powder spraying
Continuous Composition Control: Centrifugal powder forming (CPF),
impeller dry blending, centrifugal sedimentation, electrophoretic deposition
and pressure filtration/vacuum slip casting
For personal use only.

Melting processes Centrifugal casting, sedimentation casting infiltration processing thermal Bulk
spray processing
Material prototyping/solid freeform Laser-based processes: laser cladding, melting, laser sintering, selective Bulk
(SFF) fabrication D-printing and selective laser
Compocasting The liquid state process in which the addition of reinforcement to an Bulk
agitated solidifying melt is carried out
Other methods plasma spraying, electrodeposition, electrophoretic, ion beam assisted Thin coating
deposition (IBAD), self-propagating high-temperature synthesis (SHS)

Fig. 1. A schematic of a true centrifugal cast-


ing system.

Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10 961


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

1.2. Advantages of CCT 1.3. FGMs by CCT

1. Time-saving because it does not need gating system ele- The CCT is a manufacturing process that involves pouring
ments to direct the metal flow. of molten metal into a rotating mould and the cast is al-
2. Quality castings in terms of accurate dimensions, good lowed to solidify before rotation is stopped [18, 19]. Main
surface finish and porosity as gas porosity is limited in components of a centrifugal cast machine are shown in
the region of the cast surface. Fig. 2. In the FGAMC context, CCT involves uniformly
3. Solidification is faster with a high of quality metallurgi- mixing particles with molten metal and pouring the mixture
cal properties. into a spinning mould forming a compositional gradient and
4. The force generated is about 150 times the force of grav- it then being allowed to solidify [20]. CCT has been de-
ity. scribed as an exciting method due to the possibility of gra-
5. Simple and light machining operations are required. dient control using process parameters. The rotation creates
a centrifugal force that pushes the molten metal and the par-
ticles against the wall of the mould. This process ensures
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016
For personal use only.

Fig. 2. Schematic of (a) vertical centrifugal


casting machine, and (b) horizontal centrifu-
gal casting machine.

962 Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

the production of the desired shape, microstructural and solid-particle centrifugal method and the in-situ centrifugal
compositional gradient. The method is used in the casting method [24 – 26]. The ex-situ solid-particle centrifugal meth-
of metals such as steel alloys, magnesium alloys, alumi- od involves a temperature below the liquidus temperature of
nium alloys, copper alloys, etc.; non-metals such as cera- the matrix material and addition of prefabricated reinforce-
mics, plastics, glass, and FGMs such as aluminium alloy ce- ment to the metal matrix by infiltration, vortex or casting
ramic composites, copper alloy–ceramic composites etc. methods. The in-situ centrifugal method involves a tempera-
Practically, the method can be used for every material that ture exceeding matrix liquidus temperature and reinforce-
can be melted into liquid or slurries. Several functionally ment precipitation in the matrix melt during cooling and soli-
attractive metal–ceramic based FGMs have been developed dification. This method is advantageous compared to the ex-
through this technique for a range of engineering applica- situ technique in terms of good wettability, uniform distribu-
tions such as an automobile, aircraft and aerospace, general tion of reinforcement and reinforcement material thermody-
engineering industries, etc. namic stability in the matrix alloy [27, 28].
The current methods of bulk and mass production of
FGMs in large quantities or for large parts are not yet reli- 2. Evolution
able and are expensive. Amongst the known fabrication
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

techniques, CCT is the most attractive and economical to The use of CCT is as old as the 16th century involving Ben-
execute [21 – 23]. Several FGMs of pure metal–ceramics, venuto Cellini and others who founded the art. Eckhardt ob-
metal alloy–ceramics and metal–intermetallic compounds tained the first recorded patent on CCT in 1809 in England
have been developed by CCT and experimental and numer- while in the USA Baltimore made the first industrial appli-
ical studies performed. cation of the process in 1848 [29]. A Brazilian, Dimitri Sen-
saud DeLavaud, invented a new CCT machine in 1918
1.4. Classification of CCT which was characterised by the absence of cores [19].
Non-professional craftsmen got access to centrifugal cast-
Centrifugal casting methods are classified into two groups. ing methods after its adoption in 1940 for jewellery manu-
The first group is based on centrifugal machine arrangement facturing. Experimentation regarding the combination of
and the second group is based on temperature. The first centrifugal and vacuum castings was conducted in 1935,
group includes two main types, namely, horizontal centrifu- and patents were issued in 1940 – 42. The first successful
For personal use only.

gal casting and vertical centrifugal casting, as shown in vacuum centrifugal casting was achieved by A.L. Engle-
Fig. 2. However, this group can be further categorised into hardt in 1948. The technique was initially (before the mid-
horizontal true centrifugal casting process, inclined true cen- 1980s) used solely for the fabrication of symmetrical com-
trifugal casting process, vertical true centrifugal casting pro- ponents such as shafts, bushings, cylinders, pipes, rolls for
cess, and semi-vertical centrifugal casting process. Sche- steel mills and other shapes. The method has evolved tre-
matic diagrams in Fig. 3 show a wider centrifugal casting mendously through research and development and has been
machine classification [19]. The second group is based on described by several authors as the simplest and cheapest
the temperature of the matrix alloy and includes the ex-situ technique in FGM fabrication [30].

Fig. 3. Classification of centrifugal casting methods based on mould rotation [19].

Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10 963


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

Presently, all the known FGM manufacturing techniques with particle average size of 37.8 lm. The speeds of
are expensive to execute for mass production of large parts 1 500 rpm and 2 000 rpm were used as rotational speeds for
and some are complex to perform. These methods include two different moulds, to produce cast rings. The authors ob-
powder metallurgy, chemical vapour deposition, solidifica- served that the centrifugal casting process:
tion processing, spray atomisation and co-deposition and 1. Aided microstructure gradient and hardness in the cen-
centrifugal. The centrifugal casting process is regarded as trifuged alloy without reinforcement and the material
an economical casting technique [22] and has these advan- was characterised by serious wear of adhesive wear
tages: fast solidification with quality metallurgical proper- type.
ties; limited gas porosity in the cast inner surface; force 2. The gradient of FGM at 2 000 rpm was sharper than the
generated is about 150 times the force of gravity; risers one cast with 1 500 rpm.
and core are not needed; and simple and light machining 3. An increase in the volume of the SiC particles to 5 % in
operation is required. the mixture reduces the rate of FGM wear, but severe
wear was reported in the volume of SiC particles below
2.1. FGMs manufacturing by means of CCT 2 %.
4. The mechanisms of wear found in the FGMAC consid-
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

The CCT in FGM manufacturing involves the uniform mix- ered are two-body abrasion wear, delamination, adhe-
ing of particles with molten metal and pouring the resultant sion and oxidative wear.
mixture into a spinning mould forming a compositional gra- The gradient of FGMs fabricated by the centrifugal techni-
dient and allowing it to solidify. The centrifugal casting que is a function of the following: speed of rotation, process
method is exciting due to the possibility of gradient control duration, and dispersive fluid and particle contents. The
using process parameters. The centrifugal casting process is centrifugal casting of Fe–TiC FGM requires a self-generat-
developing rapidly and has the potential to dominate the ing high-temperature production reaction as an additional
field of FGM production. However, it is still in the develop- step. It was observed in the Fe–TiC FGM specimen that
ment stage due to inadequate knowledge of particle distri- the hardness increased inwardly and the inner part per-
bution and control [22]. formed better than the outer surface in wear tests [33].
The manufacture of FGMs by centrifugation is charac- Watanabe et al. [34] have produced an Al–Al2Cu FGM
terised by the discontinuous distribution of reinforcing par- ring from Al-3 %Cu using the centrifugal in-situ method.
ticles in a radially graded pattern. The metal matrix and re- In this study, it was reported that: the a-Al particles drifted
For personal use only.

inforcing particle density difference causes segregation in towards the outer surface after the centrifugal process as
which the higher density particles migrate to the outer per- the density of a-Al crystal is higher than the molten alumi-
iphery and lower density particles migrate to the inner sur- nium alloy, the concentration of Cu in the ring was massive
face. The grading determines the functionality and can be towards the inner part, the hardness of the Al–Al2Cu FGM
regulated and enhanced by certain processing parameters ring fabricated increases down the inner region, and the
such as particle size and volume, centrifugal rotation speed, hardness of the specimen appreciated tremendously due to
mould temperature, molten metal alloying temperature, and heat treatment.
cast geometry [31]. The size and concentration of the ce- A review of wear properties of two types of aluminium
ramic particle in a matrix has a correlation with hardness matrix FGMs, Al–Al3Ti FGM and Al–Al3Ni FGM, was
and wear. conducted by Watanabe et al. [24]. Two fabrication meth-
Experimental works have proved that centrifugal casting ods were used to produce FGM rings: the centrifugal solid
can separate phases of dissimilar densities. Many function- particle method and the centrifugal in-situ method. The
ally graded aluminium composites (FGACs) have been fabri- authors reported that size, shape, volume fraction, and ori-
cated successfully through one or other of the types of centri- entation of the reinforcements are parameters defining
fugal casting techniques. Investigations have revealed that properties of the FGMs. In summary, the findings were
Al/SiC, Al/Shirasu and Al/Al3Ti can be manufactured via [24]:
centrifugal solid-particle methods while Al/Al3Ni and Al/ 1. The wear property was found to be anisotropic and de-
Al2Cu can be fabricated using the in-situ method [25]. The pended on the direction of the wear test relative to the
fabrication of Al/(Al3Ti+Al3Ni) hybrid FGMs needs the com- Al3Ti particle alignment. Figure 4 depicts the align-
bination of solid-particle and in-situ production methods. ments of the Al3Ti.
Ferreira et al. [32] have used the centrifugal method to 2. Larger alignment parameters resulted in greater aniso-
manufacture Al/Al3Ti and Al/Al3Zr FGMs from the follow- tropic wear resistance.
ing compositions: Al-5 mass% Ti and Al-5 mass% Zr, re- 3. A wear resistance gradient of Al–Al3Ni FGMs was no-
spectively. The magnitudes of centrifugal force used are ticed along the thickness of the ring proportional to the
30 G, 60 G and 120 G where G is the ratio of the centrifugal volume fraction and particle size reduction.
force to gravity force. The results of the characterisation 4. Mechanical properties of the FGM fabricated by the
show that an increase in the volume of particles and centri- centrifugal in-situ technique depend on the particle size
fugal force will affect both gradient and particle concentra- gradient.
tion at the outer surface, and that better tribocorrosion per- 5. FGMs wear resistance can be enhanced by particle size,
formance was found in the sample with the highest volume volume fraction and the alignment dispersal of the rein-
of particles. forcements in the FGMs.
Vieira et al. [18] have studied the factors in CCT that af- FGMs fabricated by centrifugation of different reinforce-
fect the wear of FGM (Al alloy/SiCp). The matrix material ment particles of B4C, SiC, SiC primary silicon, graphite
was aluminium alloy with chemical composition of Al- hybrid, Mg2Si and Al3Ni on aluminium matrix were inves-
10Si-4.5Cu-2Mg and the reinforcement particles of SiCp tigated by Rajan and Pai [35]. The study reported that rein-

964 Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

forcement sizes and densities are relevant factors that affect bits better surface properties of FGMs manufactured by this
the gradient formation of the microstructure. High-density method [37].
SiC and Al3Ni particles were found near the outer surface Radhika and Raghu [38] investigated the production of
while low-density particles of graphite, primary silicon Al–Al3Ti/Ti3Al FGM by means of the RCMPM. They re-
and Mg2Si were arranged near the inner surface. B4C parti- ported that the particles move more slowly in distribution
cles with the closest density to aluminium spread more than at a greater temperature and the FGMs produced with
others. RCMPM change significantly in both intermetallic and
morphology with processing temperature. The Ti3Al inter-
metallic compound, fine granular Al3Ti particles, and un-
2.2. Centrifugal mixed-powder method (CMPM) reacted Ti phase were found at relatively low temperatures
(1 150 8C to 1 250 8C). At 1 350 8C casting temperature,
To fix the centrifugal limitation, the centrifugal mixed pow- granular Al3Ti particles were not observed but coarse Al3Ti
der method (CMPM) was introduced in the production of platelet particles were found. Further increase in the casting
FGMs with nano size reinforcement. A CMPM schematic temperature (145 K) resulted in obtaining more coarse
is shown in Fig. 5 [36]. CMPM has advanced to the reactive Al3Ti platelet particles. It was observed in the fabricated
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

centrifugal mixed powder method (RCMPM) which exhi- FGMs that hardness is a function of particle type and size,
and their processing temperature.
The centrifugal mixed powder method has been de-
scribed as a novel method for the fabrication of a nano-par-
ticle distributed FGM and the steps are depicted in Fig. 5.
Stages of CMPM are as follows [36]:
1. Mixing of powder functional nanoparticles and metal
matrix particles in a spinning mould (see Fig. 5a).
2. Melting of metal matrix ingot and pouring the molten
metal into the rotating mould that contains the powder
mixture (see Fig. 5b).
3. The molten metal matrix is forced into the spaces be-
tween the particles of the powder mixture by centrifugal
For personal use only.

force (see Fig. 5c). The heat in the molten metal matrix
melts the matrix powder and forms a composite with
the nano-particles (see Fig. 5d). The functional nanopar-
Fig. 4. Schematic alignments of the Al3Ti particles in an Al–Al3Ti ticles migrate to the outer region of the fabricated FGM
FGM ring. ring (see Fig. 5e).

Fig. 5. The schematic description of a CMPM process [36].

Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10 965


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

Cu–SiC and Al–TiO2 FGMs were produced with CMPM 2. FGM ring sample SiC particle concentration was higher
and characterised [39]. Results showed that: at the outer periphery (about 45 % of the volume of SiC)
1. Nanoparticles were dispersed only on the surface of the than the inner region, as shown in Fig. 9.
fabricated FGMs ring. Micrographs of the microstructure of Al356–SiC composite
2. Nano-particle dispersion in the FGM is not density dif- are presented in Fig. 9 and show the particle distribution
ference dependent between the matrix and the particle.
3. Fabricated FGM surface hardness was enhanced by
CMPM.
4. CMPM is effective for fabrication of FGMs which have
nano-particles.

3. CCT significant process parameters

While many metal–ceramic FGMs have been developed by


International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

means of the centrifugal casting method, this method is still


in development because of inadequate knowledge of parti-
cle distribution and control [22]. The significant processing
parameters for gradient microstructure control are mould
temperature, pouring temperature, pouring rate, thermal
gradient through the mould, velocity of mould rotation, so-
lidification rate, etc. Temperature circulation is difficult to
estimate during centrifugal casting due to the high speed
of mould rotation during pour and solidification. The inves-
tigation of centrifugal casting process parameters shows
(a)
that [40 – 43]:
1. If Dq = qp – qm is positive, the concentration of ceramic
particles will be higher at the outer region, where qp
and qm are particle and metal matrix densities.
For personal use only.

2. Increasing the particle volume fraction increases the


packed and gradient regions, but decreases the particle-
free zone, as shown in Fig. 6a.
3. Higher rotational speed migrates more particles to the
outer region, causing a thicker zone without ceramic
particles called the free region. Rotation of 1 500 rpm
results in three distinct regions as shown in Fig. 6b:
packed region, gradient region, and particle-free zone.
4. Larger particles possess bigger centrifugal accelera-
tion and form a packed bed more easily, as shown in
Fig. 6c.
The microstructure, particle distribution and hardness of
FGMs cylindrical parts fabricated by horizontal centrifugal
casting at 1 100 rpm were studied by Rajan et al. [44]. Two
metal matrix composites (MMCs) were formed from alumi-
nium alloys and SiC reinforcement particles of size 23 lm, (b)
namely, A356 (Al-7.5Si-0.35Mg); A2124 (Al-4.5Cu-
1.6Mg-0.25Zn-0.2Si). Both formations had 15 % of reinfor-
cement particle concentration. A356 alloy was subjected to
solution heat treatment at 535 8C for 10 h with warm
quenching and artificial ageing at 165 8C for 8 h. A2124 al-
loy was subjected to solution heat treatment at 495 8C for
4 h with warm quenching and artificial ageing at 190 8C
for 5 h. Microstructures of SiC particle distribution in
A356-SiC are shown in Fig. 9.
The study reported that:
1. The hardness of the non-heated FGMC ring sample was
highest at the edge, 98 BHN and lowest in the inner
region, 58 – 60 BHN. A hardness of 155 BHN and
145 BHN were observed at the outer periphery of
Al356-SiC and Al212-SiC composites respectively after
heat treatment. Figures 7 and 8 show the trends of SiC (c)
particle distribution and hardness in the FGM cast ring Fig. 6. (a) particle volume fraction, (b) rotational speed effects on par-
starting from the outer edge. ticles distribution, and (c) effects on particle sizes [36, 42].

966 Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

and composite gradient. The gradient of the FGM in Fig. 9 tectic Al-18Si alloy was carried out by Chirita et al. [45].
has three distinct regions due to the centrifuge: outer region Three different casting techniques, namely, gravity, gravity
(Fig. 9a and b), mid region (Fig. 9d and e) and inner region with vibration and centrifugal casting were used to produce
(Fig. 9f). The SiC particles have higher density than the ma- the specimens. All the castings were made from commer-
trix and as a result the SiC particles migrate to the outer re- cially available Al-18Si alloy and a vacuum induction fur-
gion. The mid region is predominantly the matrix with large nace was used for the melting and pouring. The melt was
a-Al dendrites, iron intermetallic and eutectic silicon while automatically poured into the mould. A frequency of 8 Hz
the inner region has a lot of large voids. It was reported that and an amplitude of 0.5 mm in one direction were recorded
the A2124–SiC composite has the same pattern of the mi- in the centrifugal casting equipment. Tests to ascertain the
crostructure. The trend of the mechanical properties re- effects of their individual production process on the proper-
flected this gradient and increase down the outer periphery ties of the specimens were carried out. This study con-
as indicated by the direction of the arrow. The hardness in- cluded that:
creases towards the edge for both non-heat treated and heat 1. The mechanical properties of the castings were en-
treated. Maximum hardness of 155 BHN and 145 BHN hanced tremendously by CCT.
were recorded at the outer periphery of Al356–SiC and 2. No significant influence was observed on casting prop-
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

A2124–SiC FGMs respectively. erties with centrifugal pressure.


An investigative study on the influence of vertical CCT 3. The innate vibration and faster cooling rate of the verti-
on mechanical and metallurgical behaviour of a hypereu- cal CCT are the main factors responsible for the sub-
stantial effect on casting mechanical attributes.
In a study, the effect of the vertical CCT and gravity casting
technique on the different Al–Si alloys (hypoeutectic, eu-
tectic and hypereutectic alloy) on the mechanical properties
of the specimens was compared [46]. Three casting speci-
mens, A (7 % Si), B (12 % Si), and C (18 % Si), were made
from commercially available Al–Si alloys. A vacuum in-
duction furnace was used for the melting at 100 8C above
their liquidus temperature and pouring into a permanent
mould preheated at 130 8C and rotating at 450 rpm. The
For personal use only.

melt was automatically poured into the mould. The same


melting conditions for the CCT were used for gravity cast-
ing but manually poured into the mould. The study reported
that:
1. The centrifuge influence was observed to be most sensi-
tive in specimen C (18 % Si).
2. The force generated during centrifugation refines the
morphology of the alloy.
3. Better mechanical properties are obtainable in the outer
surface of the casting.
Fig. 7. Graph of SiC particle distribution in the functionally graded
Al(356)–SiC cast ring starting from the outer edge [44].
4. Conclusion

The centrifugal casting process has evolved for several


years and much investigative work has been carried out on
various aspects including processing facility and parame-
ters. However, from the works considered, the processing
parameters are similar. In conclusion, this overview showed
that:
1. The possibility of systematic incorporation of incompa-
tible functions such as thermal capacity, toughness, ma-
chinability, wear and corrosion resistance into a single
part can be achieved by application of CCT.
2. Main processing parameters are size of reinforcement
particles, pre-heating and pouring temperatures, and ro-
tational speed.
3. The centrifugal casting method is simple and cost effec-
tive to execute.
4. The literature generally sees CCT as a casting process
that has several advantages over the traditional gravity
casting method.
Fig. 8. The graph of hardness trend in non-heat treated and heat treated 5. There are challenges in its application in relation to cer-
Al(356)–SiC functionally graded composites starting from the outer tain shapes (only effective for cylindrical parts) and
edge [44]. mass production.

Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10 967


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016
For personal use only.

Fig. 9. Microstructures showing SiC particle distribution in Al(356)–SiC FGMs cast ring. Sequence starting from the outer to inner periphery in
mm: (a) 1.5 mm; (b) 3.5 mm; (c) 5.5 mm; (d) 6.5 mm; (e) 12 mm; (f) 15 mm [44].

The authors acknowledge the Centre for Engineering Postgraduate [8] S. Naher, D. Brabazon, L. Looney: J. Mater. Process. Technol.
Studies (CEPS)/HVDC/Smart grid Centre of the University of KwaZu- 143 – 144 (2003) 567. DOI:10.1016/S0924-0136(03)00368-6
lu-Natal. [9] A. Onat, H. Akbulut, F. Yilmaz: J. Alloys Compd. 436 (2007)
375. DOI:10.1016/j.jallcom.2006.07.057
[10] A. Ibrahim, F. Mohamed, E. Lavernia: J. Mater. Sci. 26 (1997)
References 1137. DOI:10.1007/BF00544448
[11] G. Mohsen, N. Behzad, P. Masoud: Met Mater. Int. 18 (2012) 149.
[1] A. Ayyar, K.K. Chawla: Compos. Sci. Technol. 66 (2006) 1980. DOI:10.1007/s12540-012-0018-x
DOI:10.1016/j.compscitech.2006.01.007 [12] R.A. Harding, M. Wickins, Y.G. Li, in: Progress Towards the Pro-
[2] A. Kelly: Mater. Sci. 41 (2006) 905. duction of High Quality c-TiAl Castings, Structural Intermetal-
DOI:10.1007/s10853-013-7719-5 lics, 3rd Int. Symp. Structural Intermetallics, Jackson Hole, WY,
[3] P.M. Ashraf, S.M.A. Shibli: J. Alloys Compd. 484 (2009) 47. USA (2001) 181 – 189.
DOI:10.1016/j.jallcom.2009.04.134 [13] G. Chirita, D. Soares, F.S. Silva: Mater. Des. 29 (2008) 20.
[4] I. Bharti, N. Gupta, K.M. Gupta: Int. J. Mater. Mech. Manuf. DOI:10.1016/j.matdes.2006.12.011
1 (2013) 221. DOI:10.7763/IJMMM.2013.V1.47 [14] N.J. Humphreys, D. McBride, D.M. Shevchenko, T.N. Croft,
[5] S.S. Wang: J. Compos. Mater. 17 (1983) 210 – 223. P. Withey, N.R. Green, M. Cross: Appl. Math. Modell. 37 (2013)
DOI:10.1177/002199838301700302 7633. DOI:10.1016/j.apm.2013.03.030
[6] X. Lin, C. Liu, H. Xiao: Composites Part B 45 (2012) 8. [15] Z.J. Zhang, J.X. Zhou, M.Y. Zhang, S.Y. Pang, D.M. Liao, Y.J.
DOI:10.1016/j.compositesb.2012.09.001 Yin, X. Shen: Adv. Mater. Res. 314 – 316 (2011) 364.
[7] Y. Miyamoto, W. Kaysser, B. Rabin, A. Kawasaki, R. Ford DOI:10.4028/www.scientific.net/AMR.314-316.364
(Eds.): Functionally Graded Materials: Design, Processing and [16] X. Wu: Intermetallics 14 (2006) 1114.
Applications, Kluwer Academic Publishers, Dordrecht, The Ne- DOI:10.1016/j.intermet.2005.10.019
derlands (1999). DOI:10.1007/978-1-4615-5301-4 [17] J. Campbell: Castings, Butterworth-Heinemann, Oxford, UK (2003).

968 Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10


W. S. Ebhota et al.: Centrifugal casting technique baseline knowledge, applications, and processing parameters

[18] A.C. Vieira, P.D. Sequeira, J.R. Gomes, L.A. Rocha: Wear 267 [40] C.G. Kang, P.K. Rohatgi: Met. Mater. Trans. B 27 (1996) 277.
(2009) 585. DOI:10.1016/j.wear.2009.01.041 DOI:10.1007/BF02915054
[19] S. Wei, S. Lampman: ASM Handbook, Vol. 15, Casting (2008) [41] Q. Liu, Y. Jiao, Z. Hu: Met. Mater. Trans. B 27 (1996) 1025.
667. DOI:10.1361/asmhba0005257 DOI:10.1007/s11663-996-0017-8
[20] T.P.D. Rajan, B.C. Pai: Acta Metall. Sin. (Engl. Lett.) 27 (2014) [42] J.W. Gao, C.Y. Wang: Mater. Sci. Eng. 292 (2000) 207.
825. DOI:10.1007/s40195-014-0142-3 DOI:10.1016/S0921-5093(00)01014-5
[21] J.W. Gao, C.Y. Wang: J. Heat Transfer 123 (2000) 368. [43] F. Bonollo, A. Moret, S. Gallo, C. Mus, in: 6th Int. Seminar on
DOI:10.1115/1.1339976 Experimental Techniques and Design in Composite Materials,
[22] E.J. Babu, T.P.D. Rajan, S. Savithri, U.T.S. Pillai, B.C. Pai: Int. Vicenza, Italy (2003).
Symp. of Research Students on Mater. Sci. Eng., Chennai, India [44] T.P.D. Rajan, R.M. Pillai, B.C. Pai: Mater. Charact. 61 (2010)
(2004). DOI:10.1557/PROC-845-AA9.10 923. DOI:10.1016/j.matchar.2010.06.002
[23] A. Saiyathibrahim, N.S.S. Mohamed, P. Dhanapal in: Int. Conf. [45] G. Chirita, I. Stefanescu, J. Barbosa, H. Puga, D. Soares, F.S. Sil-
on Systems, Science, Control, Communication, Engineering and va: Int. J. Cast Met. Res. 22 (2009) 382.
Technology, Karpagam Institutions, Coimbatore, India (2015). DOI:10.1179/174313309X380422
[24] Y. Watanabe, H. Sato, Y. Fukui: J. Solid Mech. Mater. Eng. 2 [46] G. Chirita, I. Stefanescu, D. Cruz, D. Soares, F.S. Silva: Mater.
(2008) 842. DOI:10.1299/jmmp.2.842 Des. 31 (2010) 2867. DOI:10.1016/j.matdes.2009.12.045
[25] Y. Watanabe, I.S. Kim, Y. Fukui: Met. Mater. Int. 11 (2005) 391.
DOI:10.1007/BF03027510 (Received February 9, 2016; accepted July 1, 2016; colour
International Journal of Materials Research downloaded from www.hanser-elibrary.com by Hanser - Library on October 19, 2016

[26] Y. Watanabe, S. Oike: Acta Mater. 53 (2005) 1631. online only; online since August 4, 2016)
DOI:10.1016/j.actamat.2004.12.013
[27] B.S.S. Daniel, V.S.R. Murthy, G.S. Murty: J. Mater. Process.
Technol. 68 (1997) 132.
DOI:10.1016/S0924-0136(96)00020-9 Correspondence address
[28] S. Jayalakshmi, M. Gupta: Springer Briefs in Materials (2015) 7 –
58. DOI:10.1007/978-3-319-15016-1_2 Mr. Williams S. Ebhota, M.Eng.
[29] A. Royer, S. Vasseur: ASM Handbook, Vol. 15, Castings, ASM Discipline of Mechanical Engineering
International, Ohio, UAS (1988). University of KwaZulu-Natal
[30] A. Royer, S. Vasseur: ASM Hand book – Castings, ASM Interna- 9 Mountain Rise Road
tional, Ohio, 15 (1988) 296. Glenmore, Durban 4001
[31] E. Panda, S.P. Mehrotra, D. Mazumdar: Metall. Mater. Trans. South Africa
A 37 (2006) 1675 – 1687. DOI:10.1007/s11661-006-0109-8 Tel.: +27 633840252
[32] S.C. Ferreira, P.D. Sequeira, W. Yoshimi, E. Arizaa, L.A. Rocha: E-mail: [email protected]
Wear 270 (2011) 806. DOI:10.1016/j.wear.2011.02.007
[33] L. Jaworska, M. Rozmus, B. Królicka, A. Twardowska: J. Achive.
For personal use only.

Mater. Manuf. Eng. 17 (2006) 73.


[34] Y. Watanabe, H. Sato.T. Ogawa, I.S. Kim: Mater. Trans., JIM 48
(2007) 2945. DOI:10.2320/matertrans.MB200710
[35] T.P.D. Rajan, B.C. Pai: Trans. Indian Inst. Met. 62 (2009) 383.
DOI:10.1007/s12666-009-0067-0
[36] Y. Watanabe, Y. Inaguma, H. Sato, E. Miura-Fujiwara: Materials
2 (2009) 2510. DOI:10.3390/ma2042510 Bibliography
[37] S. El-Hadad, H. Sato, E. Miura-Fujiwara, Y. Watanabe: Materials DOI 10.3139/146.111423
3 (2010) 4639. DOI:10.3390/ma3094639 Int. J. Mater. Res. (formerly Z. Metallkd.)
[38] N. Radhika, R. Raghu: Trans. Nonferrous Met. Soc. China 26
(2016) 905 – 916. DOI:10.1016/S1003-6326(16)64185-7 107 (2016) 10; page 960 – 969
[39] H. Sato, Y. Inaguma, Y. Watanabe: Mater. Sci. Forum 638 – 642 # Carl Hanser Verlag GmbH & Co. KG
(2010) 2160. ISSN 1862-5282
DOI:10.4028/www.scientific.net/MSF.638-642.2160

Int. J. Mater. Res. (formerly Z. Metallkd.) 107 (2016) 10 969


CHAPTER 6: FUNCTIONALLY GRADED METAL MATRIX
COMPOSITE BY CENTRIFUGAL CASTING TECHNIQUE
MATHEMATICAL CORRELATION

W. S. Ebhota and F. L. Inambao, "Functionally graded metal matrix composite by centrifugal


casting technique mathematical correlation," African Journal of Science, Technology,
Innovation and Development, 2016. (Submitted)

57
Functionally Graded Metal Matrix Composite by Centrifugal Casting Technique
Mathematical Correlation

Williams S. Ebhotaa and Freddie L. Inambaob


a, b
Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal,
Durban, South Africa.

*Correspondence email: [email protected]

Abstract௅The functionally graded materials (FGMs) solidification process has complicated


movement phenomena of fluid, solute and heat. These phenomena control the segregation of
particles in a molten matrix, interactions of particles with a solidification front and the
integration of particles in the solidifying matrix. The desired particle distribution in a
solidified component can be achieved by manipulating the time of solidification and this
makes the study of particle motion during solidification important. This study involves the
analysis of particle/matrix configuration, solid/liquid interface shape within the vicinity of the
particle, thermal conductivity and the pushing/engulfment transition. An overview of the
mathematical models of centrifugal casting of FGMs is presented and these include forces
acting on the particle; melt particle and solid/liquid interface forces; composite thermal
conductivity; heat-transfer coefficient composites; volume fraction resolution; and, particle
matrix field temperature configuration.

Keywords: Functionally graded materials; Centrifugal casting process; Composite


solidification and segregation; Molten matrix and reinforcement particles; Modelling of
centrifugal casting.

6.1 Introduction

Mathematical models of centrifugal casting of functionally graded materials (FGMs) that


describe the relationship between metal matrix and reinforcement particles, have been
provided by several authors [1, 2]. The solidification process of FGMs has complex transport
phenomena of fluid, heat and solute. This process governs the segregation of particles in a
molten matrix, interactions of particles with the solidification front and the integration of
particles in the solidifying matrix. Solidification time manipulation helps in achieving the
desired particle distribution in a solidified component. Thus, the study of particle motion in
solidification process is pertinent.

58
The growing solidification of melts containing reinforcement particles rejects the suspended
particles at the solid/liquid interface which is known as the pushing phenomenon [3]. On a
microscopic scale the non-uniform distribution of particles in a fully solidified part is caused
by the pushing phenomenon. The distribution of particles in the solidified material is
improved by growing solid/liquid interfaces resulting from particle entrapping by the
solidification front. Segregation in the interdendritic zones is avoided by entrapping particles
uniting with the matrix to form a composite resulting in improved properties of the composite.
Study of the interaction between solid/liquid interfaces and particles is important to the
particle distribution in the matrix which defines composite properties.

In the 1980’s and 1990’s several theoretical, experimental and review studies were carried out
on solid/liquid interfaces and particle relationships using different systems [4, 5]. The studies
described particle pushing based on:
i. Thermodynamic variations in total energy when a particle is entrapped by a
progressing solidification front. Thermodynamic free energy change is affected by the
properties of the solid/particle interface during entrapping of the particle by the
solidification front involving small velocities.
ii. Plane thermal conductivity and thermal diffusivity ratio between the particle and the
liquid [6].
iii. Kinetic importance and critical interface velocities above which the particles are
entrapped irrespective of the thermodynamic criterion. Several models linked the
particle pushing phenomenon to the threshold velocity of the interface above which
particle entrapment occurs.

Thermal parameter differences of solid, liquid, and particle influence the planar interface,
which changes shape as it approaches the particle. The heat of the fusion of melt, temperature
gradient, undercooling, comparative heat capacities of solid, liquid and particle affect the
shape of interface following the particle. The study of interface shape and curvature facilitates
the understanding of the interaction between the particle and the interface [3].

Shangguan, Ahuja and Stefanescu stated that melt thermal conductivity is less than particle
thermal conductivity and that the shape following the particle is concave [7]. Pang,
Stefanescu and Dhindaw study have a contrary view of the succinonitrile-polystyrene particle
system in relation to Shangguan, Ahuja and Stefanescu’s prediction on melt thermal
conductivity [8]. Their view is that the interaction area between particle and interface affects

59
the forces acting on the particle and this depends on interface shape and curvature behind the
particle.

Various studies have revealed that temperature gradient variation affects the critical velocity
of the interface (Vc) proportionally [9, 10]. Cissé and Bolling showed that in an ice-water
system with copper particles, as melt temperature gradient decreases, Vc increases [11]. The
authors further stated that the indistinctiveness of critical interface velocity on the temperature
gradient function may signal the presence of the following: the specific temperature
inclination that the temperate gradient relies on for critical interface velocity tends to reverse;
and, the function of melt and particle relative thermal properties depend on the thermal
gradient effect [11].

A study by Kim and Rohatgi expressed solid/liquid interface shape and curvature in terms of
the ratio between particle thermal conductivity and melt thermal conductivity; melt viscosity;
solid/liquid interface surface tension; melt heat of fusion; and, imposed solid/liquid interface
temperature gradient. The study calculated the critical interface velocity exploiting attractive
and repulsive forces acting force balance [3].

Hanumanth and Irons investigated both numerical and experimental solidification of FGMs,
aluminium alloy-SiC composites and developed a one-dimensional enthalpy model [12]. This
study used the Richardson-Zaki hindered settling correlation to estimate particle velocity.
This can cause significant phase velocity overestimation of particles by a factor of 1/1-İp
because the methodology means liquid counter-current displacement flow resulting from
particle sedimentation which is unaccounted for, wKHUHİSLVWKHSDUWLFOHSKDVHYHORFLW\7KH
study includes the investigation of thermal conductivity effects and the cooling rate of SiC
particles. The Scheil equation was used to explain mushy zone evolution. For an accurate
depiction of cooling rates and particle settling, SiC particle thermal conductivity on the order
of a single crystal was planned. However, the recommended cooling condition resulted in
very little settling.

A multiphase model for alloy solidification of metal matrix particle composites with
convection was developed by Feller and Beckermann [13]. The Happel hindered settling
function model was applied to several one- and two-dimensional Al-7wt%Si/SiC systems
applications. Simulation and experimental sedimentation results of A356 systems with
clustering and non-clustering SiC particles showed good conformity [14]. Initial studies had

60
negligible information on time evolution of the coupled solidification and sedimentation
activities and their main focus was on final particle distribution.

This study resulted in undefinable solidifying matrix particle segregation mechanisms, which
are required for FGM design. In the past, detailed data on the time evolution of particle
concentration distribution of solidifying matrix was insufficient due to limited experimental
work. Experimental data availability is necessary to accurately authenticate complex FGM
solidification models (Gao and Wang 2001). To bridge this gap, Gao and Wang studied the
solidification relationship between particle transport and freezing front dynamics [15]. In their
study, the gravity casting solidification process of FGMs was numerically and experimentally
investigated. A fixed-grid, the finite-volume method, was used to solve numerically one-
dimensional multiphase solidification model equations developed by the study. Experimental
results were used to validate the model which was applied in Al-SiC FGM efficient
computational prototyping. The experimental setup is shown in Figure 6.1.

Figure 6.1: Schematic of Gao and Wang experimental setup [15]

Distilled water and succinonitrile (SCN) were used as matrix liquids and glass beads as
particles in a rectangular ingot transparent model experiment. Important processing
parameters effects were studied and the solidified ingot showed a graded particle distribution
zone towards the bottom and a particle free zone in the top portion. The study observed that:
i. Higher superheat causes slower solidification which results in a thicker particle-free
zone and higher particle concentration towards the bottom.
ii. A thinner particle-free region resulting from higher initial particle volume fraction.
iii. Particle settling was suppressed by lower cooling temperatures.

61
iv. The desired gradient attribute of the solidified component can be manipulated with
optimisation of processing parameters such as particle size, particle volume fraction,
cooling rate and superheat. This was obtained from simulations results of Al/SiC
FGMs.

Investigation of suspended ceramic particles in aluminium melts was performed during the
fabrication of FGM (Al-SiC) by means of the vertical centrifugal casting method [16]. Forces
acting on the particle, force balance and motion of the particle in the melt during vertical
centrifugal casting were modelled mathematically and simulated using Matlab. Process
parameters such as solidification rate, mould rotational speed, mould temperature, particle
size and particle fraction of segregation were examined. The results show that with the
particle at an initial position of 0.005, the process at 800 rpm gave the particle a radial
distance of 21 mm while 400 rpm reduces the penetration by 62 %. 1200 rpm increased the
penetration by 57 %.

Balout and Litwin conducted experiments on aluminium alloy A356 reinforced by 10 %


YROXPHRIǐP6L&IDEULFDWHGZLWK&&7IRUSDUWLFOHGLVWULEXWLRQPRGHOOLQJ>@7KHVWXG\
revealed that particle distribution in the outer surface varies according to viscosity. Different
pouring temperatures (650 oC, 680 oC, and 700 oC) and mould temperatures (30 oC, 100 oC,
350 oC, and 400 oC) were used. The study defined and modelled the following parameters:
particle velocity; deceleration; displacement; and, segregation during the cooling process. The
study concluded that:
i. Behaviour of particles varies with time, position and viscosity.
ii. Melt viscosity and centrifugal radius variations during centrifugation change on
particle segregation process.
iii. Particle segregation is heightened by increasing mould and pouring temperatures and
this favours higher particle volume fractions in the periphery of the casting.

A study by Emila, Dipak, and Mehrotra developed a prediction model for centrifugally cast
FGM particle segregation patterns and one-dimensional transient heat-transfer coupled with
casting and mould temperatures distribution and solidification time [18]. The force balance
equation containing centrifugal, drag and repulsive (force possessed by a particle in the
solid/liquid interface neighbourhood) forces was discussed. The pure implicit finite volume
method was applied to find model equation solutions using time-step technique transformed
variables. The study noted that the particle-rich region thickness in FGM decreases with
increase in rotational speed; particle size; initial pouring and mould temperatures; and,
62
particles and molten matrix density difference. Other observations made by the study are: heat
transfer coefficient reduction at the casting/mould interface increases solidification time and
solid-particles segregation formation; solidification time and particle-rich region thickness
increases with reinforcing particles volume fraction increase; initial volume fraction of
particles in the outer layers of Al-Al2O3 and Al-SiC FGMs remains the same or less using
finer particles, lower rotational speeds, and an enhanced heat transfer coefficient at the
casting/mould interface; heat-transfer coefficients reduction and increase in rotational speed
and particles size results in intense segregation at the outer region of FGMs, although intense
segregation at the innermost layers was predicted for the Al-Gr system.

6.2 Mathematical expressions

In this section of the study, analysis of the particle/matrix configuration, solid/liquid interface
shape within the vicinity of the particle, thermal conductivity and pushing/engulfment
transition critical condition will be carried out.

Several authors based their model formation on the following assumptions [17-21]:
i. One-dimensional heat flow perpendicular to the mould wall.
ii. Homogeneously distributed solid particles and metal matrix instantaneously fill the
mould.
iii. Solid particles and metal matrix thermal properties at invariant temperature.
iv. Solidification is accelerated by casting/graphite mould interface caused by casting
contraction.
v. Buoyancy causes natural convection and movement of particles is neglected.
vi. Solid and liquid regions interface considered planar.
vii. Thermal resistance between particles and molten metal is zero.
viii. Shape of reinforcement particles is considered as spherical.
ix. Liquidus front stops particle motion.
x. The volume fraction of large solid particles in the molten metal retards particle
movement. The apparent viscosity, vc: vc v ª¬1  2.5v f t  10.05 v f 2 t º¼ .

xi. Maximum volume fraction for segregation of particles occurrence is 52 %.

6.2.1 Particle and solid/liquid interface

The analysis of particle and solid/liquid interface encompasses a discussion on Stokes'


flotation velocity, Vf = particle matrix field temperature configuration; evaluation of

63
solid/liquid interface shape on the vicinity of the particle; evaluation of forces on the particle;
and, defining a critical condition for pushing/engulfment transition.

6.2.1.1 The discussion on Stokes’ flotation velocity

For acceleration = 0, the spherical particle velocity according to Stoke’s law is:

4 R 2 'UZ 2 r
Vf ________________ (6.1)
18P

:KHUH 5  UDGLXV RI WKH SDUWLFOH Ȧ  DQJXODU YHORFLW\ U  SDUWLFOH SRVLWLRQ —  PHOW
YLVFRVLW\ ǻȡ  ȡP – ȡm = density difference; and, ȡP DQG ȡm particle and molten metal
densities respectively.

The solid/liquid front moves against gravity in a solid/liquid system with a steady state
velocity, V. As a result, it experiences force of gravity and Stokes’ flotation velocity, Vf:

The following conditions may occur in a system:

Vf > V (particle float away); V > Vf < 0 (particle approach interface; sedimentation); V > Vf
only when particle approaches and interaction is occurring. Vf is therefore referred to as the
threshold velocity.

6.2.1.2 Evaluation of solid/liquid interface shape in particle vicinity

Figure 6.2 describes the relationship between the spherical particle and the solid/liquid
interface as the particle approaches the interface. The particle presence affects the velocity of
the interface and this velocity is categorised in two ways: not affected by the particle, V1; and,
affected by the particle, V2.

Figure 6.2: Representation of a particle near solid/liquid interface and the forces acting on the particle [7]

64
Considering Figure 6.2, the distance between the particle and interface at Z = 0 is d. This
means:

Tm ª¬ X 0, Z  R  d º¼ Tmelt _________ (6.2)

For isothermal,

§ a·
R  d ¨1  ¸
© b¹ cos T __________ (6.3)
ª §R· º
3

r «1  a ¨ ¸ »
«¬ © r ¹ »¼

1D d
Where a _____ (6.4) b 1 ______ (6.5)
2 D R

Figures 6.3 and 6.4 depict solid/liquid interface shapes at a constant d and varied thermal
conductivity ratioĮGHULYHGIURPHTXDWLRQ  

$WĮWKHEXPSLVFUHDWHG SXVKLQJLVPDGHHDVLHU  DWĮ WKHSODQDUVXUIDFHLVIRUPHG


DWĮ!WKHWURXJKLVFUHDWHG FRQGXFLYHIRUHQJXOIPHQW 

Figure 6.3: Depiction of solid/liquid interface shapes evolution, a) Į < E Į = DQGF Į > 1

Figure 6.4: Depiction of solid/liquid interface shapes for various conditions


Conditions: At constant d and varied thermal conductivity ratio D Į E Į = F Į DQGG Į 
0.06

Interface radius of curvature at X = 0, is given by:

2a  b
RI R  d _____ (6.6)
3a

When d < R,

§ 2a  b · § D ·
RI ¨ ¸R ¨ ¸R _____ (6.7)
© 3a ¹ © D 1 ¹

65
RI
f D _______ (6.8)
RI  R

6.2.2 Forces acting on particle in a melt

A particle suspended in molten metal during vertical centrifugal casting is subjected to four
different forces as represented in Figure 6.5: gravitational force, FG; centrifugal force caused
by mould rotation, FC; drag force due to viscosity effect, FD; and, repulsive force or van der
Waal forces caused by solid-liquid interface movement, FL. Force of gravity is often neglected
because it is very small compared to centrifugal force [17, 18, 22, 23].

Figure 6.5: Representation of forces acting on a particle moving in molten metal

The three forces are defined as follows:

6.2.2.1 Gravitational force

Gravitational force, FG and its direction are functions of the density difference between the
particle and the melt. FG is mathematically expressed as:

4
FG S R 3'U g _________ (6.9)
3

Where R = particle radius; g = gravitational acceleration; μ = melt viscosity; ǻȡ ȡp – ȡm =


GHQVLW\GLIIHUHQFHDQGȡp and ȡm particle and molten metal densities respectively.

6.2.2.2 Drag force

Drag force, FD, is given by Stokes’ law:

FD 6SKVR _______ (6.10)

66
When d < R for planar surface:

R2
FD 6SKV ________ (6.11)
d

When d < R for non-planer surface

R 2 § RI ·
FD 6SKV ¨ ¸ ______ (6.12)
d © RI  R ¹

R2 2
6SKV D ____________ (6.13)
d

If Rl !DVIRUĮ!FRQFDYHLQWHUIDFHZLOOEHIRUPHGZLWKJUHDWHU)D while lesser FD and


convex are formed by Rl DQGĮ

6.2.2.3 Repulsive/Van der Waals force

7KLV IRUFH LV GXH WR WKH LQWHUIDFH HQHUJ\ EHWZHHQ WKH OLTXLG DQG VROLG SKDVHV ısl; between
liquid phase and particle, ılp; and between solid phase and particleısp;

This energy is defined as

FI 2S R'V ____________ (6.14)

§ a ·
'V 'V 0 ¨ 0 ¸ _________ (6.15)
© a0  d ¹

When a0 = rp + r = sum of radii of atoms at the surface layer of the particle and the solid, n is
2 to 7

'V 0 V sp  V lp  V sl _______ (6.16)

So that,
n
§ a ·
FI 2S R'V 0 ¨ 0 ¸ _______ (6.17)
© a0  d ¹

Potschke and Rogge assumed van der Waals force for two particles with radii R + Ri:
2
§ a · RI
FI 2S R'V 0 ¨ 0 ¸ ________ (6.18)
© a0  d ¹ RI  R

67
For the plane surface Rl o f , equation (18) becomes equivalent to equation (17). Combining
equations (17) and (8) including all the interactions:
n
§ a ·
FI 2S R'V 0 ¨ 0 ¸ D __________ (6.19)
© a0  d ¹

Į !  UHVXOWV LQ D FRQFDYH LQWHUIDFH DQG LQFUHDVH LQ )L while otherwise leads to a convex
interface and a decrease in FL.

¾ Repulsive force relevance in the force balances equation

Factors responsible for the interaction of particles near the solidification front are interfacial
energy between the particle, liquid, and solid; alteration of the temperature field due to
varying thermal properties; and, particle concentration alteration of the field caused by
particle movement prevention by the front. Particles are pushed ahead of the interface by
forces linked to interfacial energy (macroscopic method) or interatomic interaction
(microscopic method, emanating from van der Waals forces). Viscous drag force is the
primary force that inhibits the particle from being pushed by the front [24, 25].

The particles move along with front push until viscous drag on the particle overcomes the
repulsive force. Many interfacial forces concepts derived by interfacial energy or van der
Waals forces deterring the particle away from the growth front have been proposed. Further,
the entry of liquid into the gap between the growing solid and the particle is facilitated [26,
27]. The degree of these forces lies in the space between particle and front and the front
morphology. Solidification of a liquid with dispersed particles exerts a repulsive force on the
particles within its influence zone and pushes them along with it. This occurrence is regarded
as a steady-state phenomenon where the solidification front and particles move with the same
velocity and gap width is kept constant. In the case where repulsive force is the predominant
force acting on particles, particle concentration increases in the liquid which solidifies last.
However, particle movement is influenced by the net resultant force where centrifugal,
viscous force and repulsive force act on the particles.

¾ The correlation between repulsive force expression and particles in solidifying


liquid

Investigation of the relation between Sannomiya and Matuda’s (2006) mathematical model on
repulsive force expression and particles dispersed in the solidifying liquid was carried out by
Emila, Dipak and Mehrotra [18]. The mathematical model describes the repulsive force

68
exerted on a fish as it approaches the water tank wall. Several factors define fish behaviour in
a water tank and these include swimming ability; velocity relative to the ambient water;
interaction among the individuals; swimming speed uniformity; the direction of movements
within the school; and, repulsion and attraction near the wall. The psychological phenomenon
of a fish as a living entity comes into play by averting the possibility of it striking the wall as
it gets close. Dispersed particles in solidifying liquid do not possess such psychological
phenomena so cannot avert the possibility of striking the wall and are not rejected by the
solidification front. Their velocities reduce at the influence zone and are finally trapped and
absorbed by the solidification zone. The investigation was based on repulsive force not
independent of the tank shape and size in parameters estimation according to Sannomiya
and Matuda [7].

6.2.2.4 Force balance equation, Fnet

The force balance equation, Fnet is taken as:

Fnet = FC – FD – FL ______________________ (6.20)

The repulsive force is associated particles within a solid wall or solid-liquid interface. The
dynamic force balance that is not induced by solid wall/interface is:

Fnet FC – FG ________________ (6.21)

The force balance equation with the assumption that the fluid flow is laminar (Re ” LV

4 3 S R 3 U P d 2 r dt 4 3 S R 2 U P  U m Z 2 r  6 S R P dr dt ____ (6.22)

The solution of net force without repulsive force of a particle at a given position moving at
constant velocity at any given time, t, is:

ª 4Z 2 U P  U m R 2t º
r t r0 exp « » _____________ (6.23)
¬ 18 P ¼

Where r0 = position of the particle at time t = 0.

6.2.3 Significant conditions for pushing/engulfment transition

The three forces (FG, FD and FL) acting on the particle play separate roles in
pushing/engulfment transition. Upward growth condition:

FG = conducive to pushing when ¨ȡ!

69
FL FRQGXFLYHWRSXVKLQJZKHQı0 > 0
FD = conducive to engulfment when
For FG and FL the condition is vice versa while FD is always engulfment.
FD is a function of V and d while FL is a function of d. At equilibrium velocity, Ve:

FG  FL  FD ________ (6.24)

That is:
n
4 § a · R2
S R 3'U g  2S R'V 0 ¨ 0 ¸ D  6SKVe D 2 0 ________ (6.25)
3 © a0  d ¹ d

So that,

d ª 'V 0 § a0 · 2 R'U g º
n

Ve « ¨ ¸  » _______ (6.26)
3KD « R © a0  d ¹ 3D »
¬ ¼

ª3'V 0D º
If R > > R* « » , FG is neglected because is very small compared to FD and
¬ 8 'U
g ¼

FL, equation (30) becomes:

'V 0 d ª§ a0 · º
n

Ve «¨ ¸ » ________ (6.27)
3KD R «© a0  d ¹ »
¬ ¼

From equation (27), critical distance can be expressed, dc:

a0
dc _________ (6.28)
n 1

Critical velocity then becomes, Vc:

'V 0 § n  1 ·
n
a0
Vc ¨ ¸ _______ (6.29)
3KD n  1 R © n ¹

When n = 2 and dc = a0;

a0 'V 0
Vc ______ (6.30)
12KD R

70
6.2.4 Volume fraction resolution

Discretisation of cast thickness into n numbers of equal sizes is used in determining liquid
metal matrix fraction variation and segment nodal points are considered at the extreme
positions. The segment volume fraction of particles is defined as:

Vs 1
V fs ________________ (6.31)
Vs  Vl Um
1 s l
Ul ms

Where Vfs = volume fraction of the particle; Vs = volume of reinforced particles and; Vl =
volume of the metal matrix in each segment.

Solid particles and matrix melt volumes and masses are defined from the correlations:

Vs V fsV Vl V  Vs ________________ (6. 32)

ms Vs U s ms Vs U s ________________ (6.33)

Where V = total volume of each segment; ms = mass of solid in each segment, and ml = total
mass of liquid in each segment.

Initial time t = 0 particle positions are considered at the nodal points for easiness. New
positions t + ¨t are defined by equation (23) or (25). Particle velocities at different nodal
points vary due to particle motion dependence on location in the liquid melt. The particle’s
new position could be in the node or segment and both the number of particles in a segment
and volume can be calculated. Segment volume is constant at all times while the new volume
fraction of particles at t = 1 per unit length can be estimated. Calculated new positions
become initial locations for particles in the next time.

6.2.5 Particle matrix field temperature configuration 153

In the temperature configuration analysis, the following assumptions were made [7]:
conduction heat transfer was considered while convection and viscous heat dissipation were
neglected; solid/liquid interface latent heat release was ignored; solid and liquid phases have
the same thermal conductivity; material parameters are not depending on temperature matrix
which is considered as an isotropic medium; and Azimuthal symmetry, the heat conduction
equation in spherical coordinates.

Considering Figure 1, the heat by Fourier’s law is defined as:

71
1 w § r 2 wT · 1 w § wT ·
¨ ¸ 2 ¨ sin T ¸ 0 _________ (6.34)
r 2 wr © wr ¹ r sin T wT © wT ¹

6.2.6 Boundary conditions

In Z-direction far away from the particle at constant temperature gradient:

§ wT ·
¨ ¸ G _______ (6.35)
© wr ¹r of

Particle/matrix temperature continuity across the interface:

Tm r R T
p r R ______ (6.36)

Reference temperature T0:

Tm z of T0 _______ (6.37)

Applying the boundary conditions to equation (12) defines temperature distribution in the
matrix, Tm as well as in the particle, Tp:

§ 3 · ª § 1  D · § R ·3 º
Tp T0  ¨ ¸ Gr cos T ____ (16) Tm T0  «1  ¨ ¸ ¨ ¸ » Gr cos T ____ (6.38)
©D  2¹ ¬« © 2  D ¹ © r ¹ ¼»

Where T0 = reference temperature; G = imposed thermal gradient on solid/liquid interface


away from the particle; R = particle radius; r = R + d; d = distance between particle surface
Kp
and solid/liquid interface; and D , ratio of particle thermal conductivity (Kp) to melt
Km
thermal conductivity (Km). The ratio Į = 1 if conductivities are equal.

The value of Į affects the heat flow flux as follows (see Figure 6.6) (Shangguan, Ahuja, and
Stefanescu 1992):
i. When Į = 1, global heat flows in Z-direction and isothermals are parallel and at a 900
angle to the heat flux line.
ii. When Į LVRWKHUPDOis deflected, (Figure 6.2a).
iii. When Į < 1, heat flux diverges from the particle (Figure 6.2b).
iv. When Į > 1, heat flux converges toward the particle (Figure 6.2c).

72
Figure 6.6: Effects of thermal conductivity ratio, Į on heat flux: a) Į < 1; b) Į = 1; c) Į > 1

6.2.7 Heat conduction expression

The schematic in Figure 6.7, represents the centrifugal casting system of MMCs which have
been used by several authors in mathematical model formulation [4, 18]. During casting,
solidification starts by heat conduction from the molten region to the surrounding area
through the solidified composite region, graphite mould and steel mould respectively. Further,
some of the heat is radiated from the cast inner surface. The direction of heat flow in a
centrifugal casting process is shown in Figure 6.7.

Figure 6.7: Direction of heat flows in a centrifugal casting system

6.2.8 Governing expression

The heat transfer of casting and the mould is controlled by the unsteady-state heat one-
dimensional conduction equation in cylindrical coordinate forms:

§ wTi · 1 w § wTi ·
Ui ci ¨ ¸ ¨ rk i ¸
© wt ¹ r wr © wr ¹ __________________ (6.39)

Where i = lc, sc, and g depict regions; molten composite, solid composite graphite, and steel
mould respectively.

6.2.9 Composites thermophysical properties

Rule of mixtures defines densities, thermal conductivities, and specific heats of composites in
solid or liquid regions as a function of the volume fraction of particles, Vf(t) at any time t:

Pc 1  v t P
f m  v f t Pp ____________ (6.40)

Where Pc = property of the composite being considered; Pm and Pp = properties of matrix and
particles, respectively.
73
6.2.10 Centrifugal casting system initial conditions

Considering a centrifugal casting system as depicted in Figure 6.8, the mould is preheated to a
temperature (TM) which is a step to avoid thermal shock. Temperature distribution before
pouring at t = 0 is given as:

Tlc Tp

Tg Tm TM

Where Tp = molten metal before pouring

Figure 6.8: Schematic depiction of centrifugal cast system of metal matrix composites

6.2.11 Boundary conditions

The regions’ boundary conditions in casting and mould are as follows.

i. Casting inner surface, at r = Ric

wTlc
 kk h2 Tci  TE _________ (6.41)
wr

ii. Graphite mould outer surface, at r = Rog

wTsc
ksc h1 Tco  Tgi __________ (6.42)
wr

74
iii. Casting outer surface, at r = Roc

wTg
k g h1 Tco  Tgi _________ (6.43)
wr
iv. Graphite mould inner surface, at r = Rig

wTg
k g h4 Tgo  Tmi ___________ (6.44)
wr
v. Steel mould inner surface of the, at r = Rim

wTm
 km h4 Tgo  Tmi __________ (6.45)
wr
vi. Steel mould outer surface of the, at r = Rom

wTm
km h3 Tmo  TD _________ (6.46)
wr

vii. Solid-liquid interface, at r = Rs(t)

Tsc Tlc Tf

viii. The sum of the rate of heat provided to liquid-phase and heat released during
solidification at the interface is equal to the rate of solid phase heat removal. This defines
the energy balance at the interface at r = Rs(t)

wTsc wTlc ws t
ksc klc  U sc H ________ (6.47)
wr wr wt

6.2.12 Formulation of heat-transfer coefficient

The rate of liquid composite solidification is affected substantially by the casting-graphite


mould interface created by contraction of the casting; thermal expansion of the mould during
solidification; and, the graphite-steel air gap formed by imperfect contact. The casting and
graphite mould heat transfer coefficient varies due to air gap and is assumed as [28]:

s t
§ hf · ri
h1 hi ¨ ¸ ___________ (6.48)
© hi ¹

Where hi = initial heat-transfer coefficient; hf = final heat-transfer coefficient; s(t) = solidified


thickness, and; ri = total casting thickness.

75
6.2.13 Composite thermal conductivity, K

Calculation of thermal conductivity, K, of the composite according to the effective middle


theory (EMT) [29]:

K Km
1  V
p

1  0.5V ______________ (6.49)


p

Where Km = matrix thermal conductivity (W/m K); and Vp = particle volume fraction.

Calculation of particle concentration:

m pAi
C |
Ai A
p i 0 x100%
mTAi ______________ (6.50)

C pAi |iA 0 m pAi


Where = concentration of the particles in an area Ai; = mass of the particles in an
Ai
area Ai; and mT = total mass of the whole microstructure in an area Ai.

6.3 Conclusion

A FGM component is useful in a place where the part is needed to function in an environment
under various working conditions. For instance, a piston receives both high pressure and high
temperature on its top surface. It is, therefore, desirable to have particular particles at the
surface for better wear and thermal resistance. On the other hand, uniform particle distribution
may be required for part functionality. There are factors in macro and micro forms that
control the pattern of particle distribution in metal matrix composites (MMCs). For macro
forms, uniform distribution of particles is achieved by application of mechanical or magnetic
stirring. Uniform particle distribution is achieved microscopically by rapid cooling to
accelerate particle engulfment. Wettability between the particle and melt is another factor that
determines particle distribution pattern. Particle distribution prediction modelling helps in
designing MMCs as desired by functionality need.

76
Bibliography

[1] S. V. Gawali and V. B. Tungikar. "Improvement in tribological properties by


improving geometry of reinforcement particles." International Journal of Engineering
Science and Technology (IJEST), vol. 3, pp. 8289-8297, 2011.

[2] R. Zagórski and J. Sleziona, "Pouring mould during centrifugal casting process,"
Archives of Materials Science and Engineering, vol. 28, pp. 441-444, 2007.

[3] J. K. Kim and P. K. Rohatgi, "An analytical solution of the critical interface velocity
for the encapturing of insoluble particles by a moving solid/liquid interface,"
Metallurgical and Materials Transactions A, vol. 29A, pp. 351-358, 1998.

[4] P. K. Rohatgi, R. Asthana and F. Yarandi, "Formation of solidification microstructures


in cast metal matrix particle composites." In: Solidification of Metal Matrix
Composites, Proceedings of the Conference, Indianapolis, Indiana, USA, Oct. 1-5,
1989 (A91-54879 23-24). Minerals, Metals, and Materials Society, Warrendale,
Pennsylvania, pp. 51-57, 1990.

[5] D. M. Stefanescu and B. K. Dhindaw, Metals Handbook, vol. 15. Metals Park, OH:
ASM International, 1988.

[6] B. V. Derjaguin, Theory of Stability of Colloids and Thin Films. New York, NY:
Consultants Bureau, 1989.

[7] D. Shangguan, S. Ahuja and D. M. Stefanescu, "An analytical model for the
interaction between an insoluble particle and an advancing solid/liquid interface,"
Metallurgical Transactions A, vol. 23A, pp. 669-680, 1992.

[8] H. Pang, D. M. Stefanescu and B. K. Dhindaw, "Influence of interface morphology on


the pushing/engulfment transition of polystyrene particles in succinonitrile + water
matrices," In Proceedings of the 2nd International Conference on Cast Metal Matrix
Composites, Tuscaloosa, Alabama, pp 57-69, October, 1993.

[9] A. A. Chernov, D. E. Temkin and A. M. Melnikova, "Theory of the capture of solid


inclusions during the growth of crystals from the melt." Soviet Physics
Crystallography, vol. 21, pp. 369-374, 1976.

[10] R. P. Smith, D. Li, D. W. Francis, J. Chappuis and A. W. Newmann, "Experimental


study of the relationship between the free energy of adhesion and the repulsive force

77
between a particle and a solidification front." Journal of Colloid and Interface
Science, vol. 157, pp. 478-484, 1993.

[11] J. Cissé and G. F. Bolling, "The steady-state rejection of insoluble particles by salol
grown from the melt," Journal of Crystal Growth, vol. 11, pp. 25-28, 1971.

[12] G. S. Hanumanth and G. A. Irons, "Solidification of particle-reinforced metal-matrix


composites," Metallurgical and Materials Transactions B, vol. 27B, pp. 663-671,
1996.

[13] R. J. Feller and C. Beckermann, "Modeling of solidification of metal-matrix


particulate composites with convection," Metallurgical and Materials Transactions B,
vol. 28B, pp. 1165-1183, 1996.

[14] J. Happel, "Viscous flow in multiparticle systems: slow motion of fluids relative to
beds of spherical particles," AIChE Journal, vol. 4, pp. 197-201, 1958.

[15] J. W. Gao and C. Y. Wang, "Transport phenomena during solidification processing of


functionally graded composites by sedimentation." Journal of Heat Transfer, vol. 123,
pp. 1-8, 2001.

[16] S. P. A. Abdul, K. Sandeep and P. R. Shalij, "Mathematical modeling and computer


simulation of particle gradient distribution in a vertical centrifugally cast functionally
gradient composite," International Journal of Innovative Research in Science,
Engineering and Technology, vol. 3 pp. 14441-14447, 2014.

[17] B. Balout and J. Litwin, "Mathematical modeling of particle segregation during


centrifugal casting of metal matrix composites," Journal of Materials Engineering and
Performance, vol. 21, pp. 450–462, 2012.

[18] P. Emila, M. Dipak, and S. P. Mehrotra, "Mathematical modeling of particle


segregation during centrifugal casting of metal matrix composites," Metallurgical and
Materials Transactions vol. 37A, pp. 1675-1687, 2006.

[19] J. Szekely, Fluid Flow Phenomena in Metal Processing. New York, NY: Academic
Press, 1979.

[20] E. J. Babu, T. P. D. Rajan, S. Savithri, U. T. S. Pillai and B. C. Pai, "Theoretical


analysis and computer simulation of the particle gradient distribution in a centrifugally
cast functionally gradient material," presented at the International Symposium of

78
Research Students on Materials Science and Engineering, Chennai, India, 20-22
December, 2004.

[21] F. Bonollo, A. Moret, S. Gallo and C. Mus, "Cylinder liners in aluminium matrix
composite by centrifugal casting," presented at the 6th International Seminar on
Experimental Techniques and Design in Composite Materials, Vicenza, Italy, 18-20
June, 2003.

[22] J. S. Jerzy and D. Ludmil, "Metallic functionally graded materials: a specific class of
advanced composites," Journal of Material Science Technology, vol. 29, pp. 297-316,
2013.

[23] A. W. Rempel and M. G. Worster, "Particle trapping at an advancing solidification


front with interfacial-curvature effects," Journal of Crystal Growth, vol. 223, pp. 420-
432, 2001.

[24] R. J. Dashwood, Y. M. Youssef and P. D. Lee, "Effect of clustering on particle


pushing and solidification behaviour in Tib reinforced aluminium Pmmcs."
Composites A, vol. 36, pp. 747-763, 2005.

[25] A. W. Rempel and M. G. Worster, "The interaction between a particle and an


advancing solidification front," Journal of Crystal Growth, vol. 205, pp. 427-440,
1999.

[26] R. Sasikumar and T. R. Ramamohan, "Distortion of the temperature and solute


concentration fields due to the presence of particles at the solidification front—effects
on particle pushing," Acta Metallurgica et Materialia, vol. 39 pp. 517-522, 1991.

[27] G. F. Bolling and J. Cissé, "A theory for the interaction of particles with a solidifying
front," Journal of Crystal Growth, vol. 10, pp. 56-66, 1971.

[28] L. Lajoye and M. Suery, "Modelling of particle segregation during centrifugal casting
of Al-Matrix composites," In Cast Reinforced Metal Composites. Proceedings of the
World Materials Congress, 24-28 September Chicago, S. G. Fishman and A. K.
Dhingra, Eds, Materials Park,OH: ASM International, 1988.

[29] A. Grabowski, M. Nowak and J. Sleziona, "Optical and conductive properties of AlSi-
Alloy/SiC composites: application in modelling CO2 laser processing of composites,"
Optical Lasers Engineering, vol. 43, pp. 233-246, 2005.

79
CHAPTER 7: SMART DESIGN AND DEVELOPMENT OF A SMALL
HYDROPOWER SYSTEM AND EXPLOITATION OF LOCALLY
SOURCED MATERIAL FOR PELTON TURBINE BUCKET
PRODUCTION

W. S. Ebhota and F. L. Inambao, "Smart design and development of small hydropower


system and exploiting of locally sourced material for Pelton turbine bucket production,"
Iranian Journal of Science and Technology, Transactions of Mechanical Engineering, 2016.
(Under review.)

80
Smart Design and Development of a Small Hydropower System and Exploitation
of Locally Sourced Material for Pelton Turbine Bucket Production

Williams S. Ebhotaa and Freddie L. Inambaob


a, b
Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal,
Durban, South Africa.
Correspondence email: [email protected]

Abstract–Small hydropower (SHP) systems are known to be an environmentally friendly,


cost effective and simple form of renewable energy production, appropriate for rural
electrification in sub-Saharan Africa (SSA). Greater access to power in SSA can be facilitated
through domestic design and development of SHP components and systems. Domestic
participation in the design, manufacturing of SHP components and application of SHP
systems can be promoted through SHP capacity building and use of locally sourced materials.
This study, therefore, involves the design of both civil and mechanical aspects of SHP, and
the use of locally sourced materials and manufacturing processes, in the design and
production of Pelton turbine buckets. The study succeeded in the coding of a SHP system
design and development of design charts using Matlab. A390 and A390-5Mg cast aluminium
alloys were selected and investigated as Pelton bucket materials using Solidworks modelling
and simulation software. The materials performances measured by von Mises, displacement
and strain results were outstanding.

7.1 Introduction

Energy is an indispensable component of human survival, national economic growth, and


promotion of health, manufacturing, security, research and development and transportation
systems. Adequate access to reliable, quality and affordable energy is a prerequisite and
critical to national security, employment, and an acceptable standard of living. Small
hydropower (SHP) has been identified as a non-polluting, cost effective and environmentally
benign renewable energy source suitable for rural electrification [1-3]. To boost energy
accessibility and sustainability sufficiently in sub-Saharan Africa (SSA) requires the region's
active participation in the manufacture of SHP equipment, as this will ensure a reduction in
the cost of power projects execution compared to the present cost situation. Further, the
ability to design and manufacture will solve operational, maintenance and parts availability
problems and jobs will be created. Adequate access to power in the region will stimulate
commercial and industrial activities and, consequently, raise the productivity and standard of

81
living of the people [4, 5]. This can be achieved through the popularisation of SHP off grid
technology for rural areas, industrial estates and standalone electrification independent of
national grids [6].

Literature shows that a lot of theoretical design, research and practical works have been
carried out in SHP system development. Some are tied to existing projects but are not
necessarily designed for capacity building [7, 8]. Very little is seen in terms of blade materials
research and development of locally sourced materials. The discussion on how to domesticate
SHP technologies in SSA, a region that has abundant untapped SHP potentials yet is
bedevilled with frequent blackouts, is virtually non-existent. This study is, therefore, designed
to bridge these limitations and further simplify SHP design for greater participation,
especially for SSA. This study is divided into the following components: theoretical
framework and design considerations (civil work and design of a Pelton turbine bucket);
selection of Pelton bucket materials and possible manufacturing processes; and results of
execution of the SHP design parameters chart developed with Matlab.

7.2 Review

In a study, micro Pelton turbine operating and other necessary parameters were calculated
based on a maximum efficiency of 97 % [9]. These parameters include turbine power, runner
diameter, turbine torque, bucket dimensions, number of buckets, runner length, runner speed,
specific speed and nozzle dimension. The paper obtained values of head and flow rate at an
efficiency of 97 %. Alnakhlani et al. studied the highest obtainable efficiency at Energy
Conversion Laboratory of Sebelas Maret University. In the study, different Pelton turbines
were modified using key parameters such as bucket volume nozzle needle seat ring, bucket
angle attack, and nozzle needle tip [1]. A theoretical and experimental study was carried out
on Pelton wheel bucket design and analysis using the standard thumb rules and bucket
modelling using CATIA V5 software [8]. Gudukeya and Madanhire investigated the effects
of material, surface texture and fabrication methods on the efficiency of a hydropower plant
project within an acceptable cost range. The study concluded that manufacturing of more
efficient financially viable Pelton turbines for micro hydropower system (MHS) are possible.
In their project, more electricity was produced at a reduced cost per unit kW improving its
viability [10]. A theoretical micro-hydroelectric plant design for off-grid applications was
carried out to produce green power for remote farms or cottages. A prototype of the system
was built to test the design [11].

82
A study on the modelling and validation of results empirically, using locally available
materials in Kenya, was carried out [12]. In the study, stress reduction of 14.2 % was
achieved by modifying the profile of the Pelton bucket. Recycled A356 aluminium alloy was
found to withstand the stress of 150 Mpa, produced by the generated 5 kW power [12]. A pico
Pelton turbine was designed and manufactured using chopped glass fibres reinforced epoxy
matrix composite as the bucket material [13]. A 50,000 litres capacity storage tank in a 10
storied tower was used as a water source to operate the turbine. In the study, 1.5 kW was
generated out the 2.793 kW that it was theoretically designed for. In the design study of Nava
and Siva, CATIA V5 design and modelling software was used to design and optimise a Pelton
turbine considering three materials in the analysis [14]. Efficiency and stress in relation to the
number of buckets were studied in the work. In the three bucket materials selected (steel, cast
iron and fibreglass reinforced plastic matrix), the study concluded that fibreglass reinforced
plastic matrix shows exceptional performance compared to cast iron.

7.3 Theoretical framework and design considerations

7.3.1 SHP system and principle of operation

Small- or micro-hydropower systems are required to convert the hydraulic energy of flowing
water into mechanical or electrical power depending on the energy needed. In a typical SHP
system arrangement, water is diverted from the source by a weir via the intake into an open
channel called the headrace. The water then flows past a settling basin for silt and other
particles removal and into a storage tank called the forebay. The water then passes through the
penstock to the turbine in the powerhouse. The water via the guide vane or nozzle hits the
turbine blade that is fixed to a shaft. This mechanism converts the hydraulic energy of the
moving water into a rotational motion (mechanical energy). The shaft is linked to a
mechanical machine that needs a rotary motion to operate an alternator to generate electricity.
Figure 7.1 shows a schematic of a hydropower system and the direction of water flow.

83
Figure 7.1: Schematic of a hydropower system and the direction of flow

7.3.2 Designing and development of key components of a SHP system

The design and development of a SHP system involves many considerations which can be
divided into three stages, as illustrated in Figure 7.2. The stages are hydrological
study/survey, design system and manufacturing process. The entire process starts with the
evaluation of hydro potentials of a water source such as stream, river, etc. [15]. The design
starting parameters are derived from the Flow Duration Curve (FDC) which is prepared from
the mean annual flow record of the hydro potentials such as a river or stream. The
fundamental hydro potentials needed to kick start the SHP design process are flow rate,
velocity, and gross head [16]. The design system can be grouped into civil work design,
mechanical design and electrical design.

Figure 7.2: SHP development stages

The design and development processes can further be broken down into components, as
shown in the schematic in Figure 7.3 [5].

84
Figure 7.3: SHP design and development layout

7.3.3 Civil design

The SHP system can be divided into subsystems as follows: water source; water diversion and
storage system (weir, silt settling basin, forebay or tank and spillway); water conduction
system (headrace canal, tunnel or Penstock, and tailrace); powerhouse; generation; and,
control system.

7.3.3.1 Weir and intake

The river flow benchmark for micro turbine application is about 4 m3/s. In the case of a flow
less than this benchmark, it may be possible to build a weir i.e. a low wall or dam across it to
be gauged with a notch through which all the water may be channelled, as shown in Figure
7.4. There are different types of notch that could be used and commonest ones are rectangular,
Vee and trapezoidal [17, 18], as presented in Table 7.1. In designing a weir, the width, b, is
chosen and the depth, h, is taken as 2b. The notch material may be metal plate or hardwood
with sharp edges.

Figure 7.4: Schematic of a weir

85
Table 7.1: Common types of weir and intake flow rate [18, 19]

Weir Schematic Mathematical expression Value of C


Rectangular notch Q C (b  0.2h)h1.5 1.84

V-notch 1.5 0.570 &1`0.611


§8· §h·
Q C ¨ ¸ 2 g tan T ¨ ¸ C(H,Q)
© 15 ¹ ©2¹

Cipolleti notch Q Cbh1.5 I.86

Broad notch Qd Cbh11.5 ௅

Intake

Q CAor 2 g hr  h f
Intake orifice flow,
Q (m3/s)

Where Aor = area of the orifice; C = discharge coefficient (0.6 and 0.8 for a sharp and smooth edges
respectively); g = gravity acceleration; hr = upstream orifice water level; and hh = downstream orifice water
level.

The intake design discharge Qdin = 1.15Qd where Qd is the set design discharge and 1.15
accounts for the seepage losses between the intake and the forebay. A velocity value between
1.0 m/s to 1.5 m/s and more than 3.0 m/s should be set for stone masonry and concrete intakes
respectively [20, 21]. The mathematical equation for intake orifice is in Table 7.1. Figure 7.5
is a submerged intake schematic.

Figure 7.5: Schematic of a submerged intake

7.3.3.2 Headrace canal/open channel

The common types of headrace canal cross sections are shown in Figure 7.6.

Figure 7.6: Common channel cross sections a) trapezoidal channel b) parabolic c) rectangular

86
It is recommended that the headrace should be slightly elevated to avoid erosion of the
channel surface caused by the flowing water. Headrace design expressions are presented in
Table 7.2. In an open channel foundation two requirements must be satisfied [22]:
i. The channel most be a rigid structure and not permit deformations to guarantee
stability.
ii. The channel should allow uniform flow and this is achieved when:
a. The water depth, area and velocity in every cross-section of the channel are
constant.
b. The energy gradient line, surface line and bottom channel line are parallel to
each other.

Table 7.2: Headrace canal/channel design equations

Parameter Equation Parameter Equation


From the continuity Q AchVch Critical velocity, for § Ach g ·
equation, discharge, Q effective water flow, Vc ¨¨ ¸¸
(m3/s) Vch < 0.8Vc © T ¹
Manning the § 1 · 12 channel bottom line 2
mathematical slope (hydraulic § ·
Q sf ¨ ¸ sch ¨ Q u n ch ¸
expression, Q (m3/s) © nch ¹ gradient), Sch Sch
¨ 2 ¸
¨ A uR 3 ¸
© ch ch ¹
Wetted perimeter, Pw Pw bch  2hch Chezy’s C, Cc 1
Cc Rch 0.1667
np

2 1  N 2  2 N
Hydraulic radius of the Ach Shape optimisation
section area, Rch Rch coefficient, x x
Pw
Normal open channel Q Depth of the water in
Vch Ach
velocity, Vch (m/s) the canal, hch (m) hch
Ach xN
From Chezy equation, Vchc C Rch Sch Canal bed width, bch bch hch  x
the open channel (m/s)
velocity, Vchc (m/s)
Hazen-Williams velocity Vchw kCRch 0.64 Sch 0.54 Canal top width, T hch  2hch N
equation, Vchw (m/s) T (m/s)

Darcy-Weisbach Head Loss, Hloss


8g H loss Lch Sch
velocity equation, Vchd Vchd Rch Sch
(m/s) f
From Manning’s 2 1 Largest particle that d ch 11Rch Sch
equation, Vchm 3 2 can move through the
Rch Sch
Vch canal, dch
nch

Where nch = roughness coefficient (nch  ௅ IRU FRQFUHWH FKDQQHOV  Sch = % slope of sides; Cc =
Chezy’s C; Ach = open channel cross-sectional area (it could be rectangular, trapezoid or circular); f = Darcy-
Weisbach friction factor; and k = 0.85 for SI units or 1.32 for U.S. units.

87
The Chézy equation is frequently used in sanitary sewer channel design and analysis. The Hazen-Williams
equation is commonly used in the design and analysis of pressure pipe systems. The Darcy-Weisbach equation
which is a theoretically based is usually used in the analysis of pressure pipe systems.

The recommended headrace canal/channel velocity (Vch) is between 1 m/s to 1.5 m/s, as
shown Table 7.3.

Table 7.3: Recommended headrace canal/channel velocity (Vch) and roughness coefficient (C)

Material Slope (h/v) Recommended canal velocity (Vch)


> 0.3 m depth > 1 m depth
Stone masonry with mud ௅ 1 1
mortar
Stone masonry with cement ௅ 1.5 1.5
Roughness coefficient, (C)
Masonry canals Brickwork 0.015
masonry with cement mortar 0.017
Coarse rubble masonry 0.02

7.3.3.3 Spillway and settling basin

Figure 7.7 shows a schematic of the cross section and longitudinal section of a spillway.

Figure 7.7: Normal spillway in a SHP system

The minimum size of particle to be considered to settle in the basin is 0.2 mm. The width of
WKHEDVLQZKLFKLVDERXW௅WLPHVWKHZLGWKRIWKHDSSURDFKFDQDOLVIL[HGDQGIROORZHGE\
VHWWLQJ RI WKH VDIHW\ IDFWRU ௅  ZKLFK WDNHV FDUH RI WKH WXUEXOHQFH LQ the flow. Figure 7.8
shows the different views (side and top views) of a settling basin. The mathematical relations
for designing a settling basin are presented in Table 7.4.

88
(a)

(b)
Figure 7.8: (a) Side view and (b) Top view of a settling basin

Table 7.4: Calculation for design of a settling basin

Parameter Equation Parameter Equation


The length of the
spillway, Lsp (m) Lsp
Q  Q
fld ch
Silt load Sload (kg), Sload QchTsilt C

C h
1.5 Volume of the silt in basin, Sload
w overtop Vlsilt Vlsilt
U silt Pfactor
hovertop h fld  hsp
The length of the 2Qch The average settling basin Vlsilt
settling basin (Lset) Lset depth (Dcol) Dcol
WVvert LsetW

Where Qfld = flood flow through the intake (m3/s); Qch = designed flow rate in the channel (headrace canal)
(m3/s); Cw = spillway profile coefficient (Cw = 0.6 for sharp edge profile) and hfld = flood level height in the
canal (m); hsp = of the spillway crest height from canal bed (m); W = suitable basin width (m); (Vvert = fall
velocity (velocity fall of 0.03 m/s is used for settling particles of 0.3 mm diameter); Tsilt = silt emptying
frequency in seconds (12 hours or 43,200 seconds is used in SHP project); Csilt = silt concentration of incoming
flow (kg/m3), and the value can be 0.5 kg/m3, ȡsilt = density of silt (2.600 kg/m3 is commonly used); Pfactor =
sediments submerged in water packing factor (50 % is normally used).

7.3.3.4 Trash rack design

Horizontal slanting bars inclined at about 60o to 80o at certain spacing are placed at the
entrance of flow to prevent the trash getting in. These bars are called trash rack bars and the
number depends on the turbine type and manufacturer. However, conventional values are 20
mm to 30 mm for Pelton turbines, 40 mm to 50 mm for Francis turbines and 80 mm to 100
mm for Kaplan turbines [22, 23]. Also at the entrance is a grill or screen that prevents the

89
debris from entering. The passage of the water through the rack leads to loss of head. The
trash rack has a coefficient (Ktr) that depends on the shape of the bar and ranges from 0.8–2.4.

7.3.3.5 Forebay and penstock design

Choose the width, bf, and set the length equal to 2 to 2.5 times the bf. The clearance of the
penstock from the forebay bed commonly ranges from 0.30 m to 0.50 m. In the forebay
design, an equivalent of 15 seconds volume buffer is supplied as an auxiliary for the turbine
to be able to cope with flow variations during standard operating conditions. The design of the
forebay and the settling basin are similar but the forebay is connected to the penstock. Figure
7.9 shows the normal forebay features in a SHP system. The calculation of the submergence
head should be done with care to avoid being undersized as this could lead to flow variation
in the penstock as well as an explosion in the penstock pipe.

Figure 7.9: Schematic showing normal forebay in SHP system

The pipes that connect the forebay to the turbine are called penstocks. The connection could
be surface or underground depending on the topography of the ground, the material the
penstock is made of, the ambient temperature and other environmental requirements as the
case may be [22]. In real fluid flows, friction head losses exist and these losses are classified
into major losses (energy loss per length of pipe) and minor losses (bends, fittings, valves,
etc.). The losses are due to the friction imposed by the pipe walls and fittings on the flowing
fluid. For optimisation, the velocity of flow in the penstock should be considered, as
represented in Table 7.5.

Table 7.5: Penstock flow velocity

Head (m) Low Head Medium Head High Head


Hg < 50 ”Hg ” Hg > 250
Velocity (m/s) ௅ ௅ ௅

90
The penstock diameter has an effect on head loss: a smaller diameter gives greater continuous
head loss. However, the head loss should be within 5 % to 10 % of the gross head. Mild steel
of ultimate tensile strength of 3.5 N/m2 x 108 N/m2 is commonly considered for penstock
material. The penstock thickness should be large enough to withstand both the static and
dynamic hydraulic pressure of the water and the safety factor, SF, should not be less than 3.5.
Corrosion allowance of 1 mm is set for the penstock [21]. Figure 7.10 shows the penstock
assembly in a SHP system.

Figure 7.10: Components of the penstock assembly [24]

Sizing of the penstock is mainly controlled by the estimated flow rate, length of pipe and
gross head as shown in the following expression below. The wall thickness of the penstock
depends on the materials of pipe, its strength (tensile), pipe diameter and the operating
pressure. The pipe should be rigid enough to be handled without danger of deformation in the
field. The penstock is provided with air vents to conduct out the air resulting from rapid
closure of the valve, thereby preventing the air going into the penstock. Table 7.6 presents
mathematical expressions for forebay penstock design. To accurately calculate the head loss
in the penstock, the following parameters are set:
x Penstock material roughness factor, k (for steel k = 1.5x10-4 m).
x Trash rack bars thickness tb, typically at 1 cm to 2 cm, but this largely depends on the
selected turbine – 2 cm or 3 cm can be considered for preliminary design. The smaller
the space between the bars, the more the turbine is protected, but this causes head loss
due to clogging therefore requires regular cleaning.
x The trash rack angle, Į is set at 72o to the horizontal plane and this is equivalent to a
slope of 1:3 (H:V).
x Cross-sectional area factor, ȕ is set according to the bar shape.
91
x The entrance factor, ke; due to the shape of the transition between the forebay and the
penstock. 0.05 can be considered for ke for this kind of transition.
x Bend factor, ȟ according to the angle of bend, ș and this is obtained from a reference
table.

Table 7.6: Expressions for forebay and penstock design

Parameter Mathematical relation Parameter Mathematical relation


Submergence head, Hs 1.5V p 2 2 g Head lost for n hl n hl n
Hs penstocks, hln (m)
Internal penstock 0.1875 Penstock wall pD
diameter, Dp (m) § Lp · thickness tp, (m) tp
Dp 2.69 ¨ n p 2 u QP 2 u ¸¸ 2V
¨ Hg
© ¹

Minimum wall D p  508 Penstock wall thickness pD p


thickness, tp (m) tp  1.2 tp + allowance, textr (m) t pt  textr
400 2V
The total head net, Hn H g  'hl n Penstock tp
Hn, (m) arrangement wall tpn
thickness tpn, (m) n
Single penstock 2 fL p § Q p 2 · The diameter of n Dp
installation head hl ¨ ¸ penstock, Dpn, (m) Dp n
loss due to friction, 2 gS ¨© D p 5 ¸¹ 5
n2
hl (m)
2 fLp n penstocks flow Vp
a1 0.26 fLp velocity, Vpn, (m3/s) Vp n
2 gS 5
n
§ Qp 2 · Air vent diameter, ª F § D 3
º
·
hl 0.26 fL p ¨ 5 ¸
¨D ¸
dvent (m)
d vent Qp 0.5
«§¨ ·¸ ¨ p ¸¸ »
© p ¹ «© E ¹ ¨© tef f ¹ »
¬ ¼
Minor head loss Vp 2
hl min K ent  Kben  K cont  K val
2g

Where Vp = penstock velocity; Qp = water flow rate (m3/s); Lp = penstock length in (m) and; Hg = gross head in
(m) (surge tank is needed if Hg/Lp>5); Dp = penstock diameter in (mm) and; tp = minimum penstock thickness in
(mm); ¨hl = total loss and it should not be more than 5–10 % of Hg and the value can be checked by penstock
diameter variations; p = internal pressure (kg/m2); E = Young’s modulus for the penstock (N/m2); tef = effective
penstock wall thickness at upper end (mm); F = safety factor (for buried penstock pipe F is 5 and for exposed
pipe F is10); ı 7HQVLOHVWUHVV; and f = dimensionless friction factor for pipe material which can be obtained
from Moody Chart (f = 0.0014); np = Manning's coefficient (see Table 9.7 for Manning's coefficient); p = the
desired pressure (1.5 Hg); textr = extra thickness for corrosion (1-3 mm) [25]; Kent = Loss of head through
entrance; Kben = Loss of head through bend; Kcon = Loss of head through contraction; Kval = Loss of head through
valves.

Table 7.7: Manning's roughness coefficients, np, for common channel materials [26]

Surface Mild steel pipe Concrete Concrete - Concrete - Copper PVC


Material (Cement) - wooden centrifugally
finished forms spun
np ௅ 0.012 0.015 0.013 0.011 0.009-0.011

92
Empirical calculation of the internal diameter (Dp) of a penstock

There are various relations that have been proposed by researchers for calculating the internal
diameter of a penstock as shown in Table 7.8. These relations, which are based on either flow
rate (Q), capacity (Pt), or gross head (Hg) – or their combination – are products of empirical
and field statistical data analysis [27]. Figure 11 shows the penstock and powerhouse
arrangement and the relation between gross head and loss head.

Table 7.8: Relations to calculate the internal diameter (Dp) of a penstock

Relation Proposed by Dp = F(Q, Pt, Hg) Limitation

Dp 0.72Q 0.5 Warnick et al. [28] Dp = F(Q) Optimum Dp for SHP

§ P · Bier [27] Dp = F(Pt, Hg) Optimum Dp for large


Dp 0.176 ¨ t ¸¸ 0.466 hydroelectric
¨H
© g ¹
0.71Pt 0.43 Sarkaria [29] Dp = F(Pt, Hg) Optimum Dp for large
Dp hydroelectric
H g 0.65

0.72 Pt 0.43 Warnick et al. [28] Dp = F(Pt, Hg) Optimum Dp for large
Dp hydroelectric
H g 0.63

0.52 Pt 0.43 Moffat et al. Dp = F(Pt, Hg) Optimum Dp for large


Dp hydroelectric
H g 0.6

1.517Q 0.5 USBR [30] Dp = F(Q, Hg) Q > 0.56 m3/s


Dp
H g 0.25

1.127Q 0.45 Fahlbusch [31] Dp = F(Q, Hg) Q > 0.56 m3/s


Dp
H g 0.12

§ SMheQ 3 Pwf · ASCE [32] Dp = F(Q, Pt, Hg) Q > 0.56 m3/s
Dp 0.05 ¨ ¸¸
¨ WCH
© r ¹
Ludin–Bundschu [33] Dp = F(Q, Hg) Hg < 100m
Dp 7
0.05Q 3
Ludin–Bundschu Dp = F(Q, Hg) Hg > 100m
5.2Q 3
Dp 7
Hg

93
Figure 7.11: Penstock and powerhouse arrangement

7.3.4 Hydro Pelton turbine mechanical design

A Pelton turbine system is made of a weir, forebay, headrace, penstock, nozzle, runner and
generator. The runner is a subassembly of the system that consists of several buckets fixed
around the circumference of a circular disc, bearing, seal and a shaft. The shaft connects the
wheel either vertically or horizontally to the alternator or generator. This idealised Pelton
turbine system is schematised in Figure 7.12. The water pressure is converted into kinetic
energy (KE) by the nozzle before it strikes the bucket. The jet, with KE, is impinged on the
splitter of the bucket through a nozzle at a right angle. The KE of the streaming jet is totally
converted by the bucket into mechanical energy in the generator, which subsequently converts
the mechanical energy into electrical energy [10, 11, 34]. The splitter prevents a central area
of the bucket from acting as a dead spot and this makes it more efficient in deflecting the
water jet away [35]. Details of the design are presented in Table 7.3.

Figure 7.12: Streaming jet impinges on splitter of a bucket

94
7.3.4.1 Main categories of turbine and their applications

The schematic diagram in Figure 7.13 shows the different types of the turbine while Table 7.9
presents their applications.

Figure 7.13: The different types of turbine

Table 7.9: Types of hydro turbine and their applications [36].

Turbine Head Classification


High (> 50 m) Medium (10 m to 50 m) Low (< 10 m)
Impulse Pelton, Turgo, Crossflow, Crossflow
Multi-jet Pelton Pelton, Turgo,
Multi-jet Pelton
Reaction Francis (spiral case) Francis (open-flume),
Propeller, Kaplan, Darius

Turbine design governing equations were developed from Euler general turbine equations,
using the Pelton wheel velocities triangle schematic diagram in Figure 7.14 [37].

Figure 7.14: The Pelton wheel velocities triangle, showing the relative and absolute velocities of the flow

7.3.4.2 Euler equation

'W U1Cw1  U 2Cw 2 _______ (7.1)

But for Pelton, Cw2 is always negative, so that equation 4 becomes:

95
'W U1Cw1  U 2Cw 2 _________ (7.2)

Where ¨W = work done; U1 = bucket speed; U2 = bucket speed vector; Cw1 = input velocity
of the whirl; and, Cw2 = exit velocity of the whirl.

7.3.4.3 For Pelton turbine

U1 U 2 U Vtr ________ (7.3) C1 Cw1 V j U  w1 ______ (7.4)

Cw 2 U  w2 cos E 2 ____ (7.5) Where ȕ< 0

Using equations (2௅5) in equation (1), it becomes:

'W U ª¬U  w1  U  w2 cos E 2 º¼ U w1  w2 cos E 2 _______ (7.6)

Where C1 = jet velocity; U1 = bucket speed; w1 = relative velocity at the inlet; w2 = relative
velocity at the exit; ȕ2 = angle inclined to the horizontal plane by the jet; C2 = the absolute
velocity at the exit and; U2 = speed vector at the exit.

For 100 % hydraulic efficiency, ȕ2 will be 1800. But in practice, the jet is deflected by buckets
through an angle, ȕ2, of about 1600 to 1650 in the same plane of the jet. The Pelton wheel
casing is a non-hydraulic function part but serves as a guide for protecting water splashing
and for runner accidents [38].

Considering impact of loss due to friction, the loss factor, k is incorporated, see Figure 7.15:

w2
k _________ (7.7)
w1

Figure 7.15: Theoretical variation of runner efficiency for a Pelton wheel with blade speed to jet speed
ratio for several values of friction factor k

96
From equation (7):

w2 kw1

Where k < 1, so that (6) becomes:

'W Uw1 1  k cos E 2 U C1  U 1  k cos E 2 ______ (7.8)

2'W U ª Uº
Kt 2 «1  » 1  k cos E 2 _________ (7.9)
C12 C1 ¬ C1 ¼

7.3.4.4 The real Pelton runner

7KHUH DUH DOZD\V ORVVHV LQ WKH 3HOWRQ UXQQHU WKHUHIRUH Șt < 1 [37]. The schematic of the
runner is shown in Figures 7.16 and 7.17. The design calculation details of a turbine id
presented in Table 7.10:

Figure 7.16: The arrangement of a runner a) the bucket and nozzle relation; b) 6-Nozzle Pelton runner
[39]

Figure 7.17: Assembly of buckets on a runner

97
Table 7.10: The calculation details of a turbine design [11, 40-42]

Parameters Relevant Equations Parameters Relevant Equations


The input power to the U g K t H n Q Bucket depth, Bd (m) Bd 1.2D j
turbine, Pti (kW) Pti
1000
Specific speed (Ns)
N Pti Cavity Length, h1 (m) h1 0.35 D j
Ns 5
4
Hn
Jet velocity, Vj (m/s) Vj Cn 2 g H n Length to Impact Point,
h2 (m)
h2 1.5 D j

Jet/nozzle diameter, Dj
4 Q Offset of Bucket, k (m) k 0.17 D j
Dj
S nz V j
Tangential velocity of the
runner, Vtr
Vtr x V j Cavity Width, a (m) a 1.2 D j
Runner diameter, Dr, (m) 60 Vtr Number of buckets nz Dr
Dr nz 15 
S N 2D j
nozzle cross-sectional S Dj2 Length of bucket Lab 0.195 Dr
area, Aj Aj moment arm, Lab (m)
4
Nozzle flow rate, Qn V j Aj Absolute reaction F 2 U Q V j  Vtr
Qn (m3/s) forces acting on the
Pelton runner
Distance between bucket 0.625 Dr The torque on the
U QDr V j 
xnb Dr
and nozzle, xnb (m) runner is Tr: Tr F
2

Radius of bucket centre of Rbr 0.47 Dr Turbine shaft diameter 0.35


mass to runner centre, Rbr Dshaft (mm) §P·
Dshaft 105 ¨ t ¸
(m) ©N¹
Bucket axial width, Bw 3.2 D j Number poles of the 3000
Bw (m) generator, Zp N
Zp
Bucket radial length, Bl Bl 3D j
(m)
Where Șt = efficiency of the wheel; N = generator rotation (rpm); x = ratio of Vtr to Vj (at maximum Kt , x = 0.5);
Q = flow rate (m /s); g = acceleration due to gravity (9.81m/s ); Hn = net head (m); ȡ = density of water (kg/m3)
3 2

and; nz = no of nozzle; Vj = absolute velocity of water jet (ms-1); Cn = nozzle coefficient (Cn = 0.96...0.98); g =
gravitational constant, 9.81 (ms-2) and, Hn = net head (m); ku = Coefficient after Impact (ku = 0.45 to 0.49)
assume worst case 0.45; nz = number of nozzles (nz t 17); Q = flow rate (m3/s);
Rules of thumb: Bw = 3.1Dj for 1 nozzle; Bw = 3.2Dj for 2 nozzles; Bw = 3.3Dj for 4-5 nozzles and Bw > 3.3Dj for
Bw
6 nozzles. The general relation between Bw and Dj: 3.1 ! t 3.4
Dj
There are always losses LQ3HOWRQUXQQHUWKHUHIRUHȘt < 1.

98
7.3.4.5 Turbine shaft diameter

Shaft diameter is an important part of a hydro turbine in determining the preliminary runner
geometry. Enough space should be provided in accordance with the design in a runner for a
structurally safe shaft.

7.4 Pelton turbine bucket production

7.4.1 Selection of material

The environment in which the runner of a turbine works is aggressive and hostile. The bucket
is prone to corrosion and erosion wear caused by impinging free jets that may contain sand
and chemically aggressive elements. Fabrication, assembly and installation of buckets are also
associated with challenges, especially in an environment with poor manufacturing
infrastructure, as is the case in SSA presently. Buckets are sometimes used in seawater which
is the most corroding natural medium containing corrosive halide reagents such as NaCl and
MgCl2. The compositional content of seawater depends on geographical location and varies
over a wide range, however, the salt content of the world’s oceans is approximately constant,
about 3.1 % [5, 6]. To satisfy both rigidity and environment requirements, stainless steels
have been the common materials for buckets [43-45], coated with epoxy or polyurethane
based resins materials. However, considering present functionally graded aluminium alloys
and composites, this group of materials seems feasible for the production of Pelton turbine
buckets.

Corrosion and erosion wear are problems shortening the life span of a bucket, and therefore
are major factors to be considered and tackled during design and manufacture processes.
According to this study, there are basically two methods to ameliorate the challenges posed to
the life span of the bucket and other turbine parts: enhancing desilting in the basin to prevent
sand and other particles from getting to the bucket; and, improving the wear and corrosion
resistance of the selected material used in the manufacturing process.

7.4.2 Manufacturing of a Pelton turbine bucket

The production processes of steel materials are complex, very expensive and require huge
energy for casting and welding. The dwindling power and manufacturing sectors in SSA
cannot adequately support the production of Pelton buckets. Despite these limitations, a lot
can still be achieved in the production of hydro turbine components with a design process that
takes into consideration materials and manufacturing inadequacies. Quite often, projects fail
99
or take longer time than necessary when the design process fails to sufficiently capture the
relation that exists between material and manufacturing process. For manufacturing purposes,
the choice of material is governed not only by operational requirements but also by cost,
availability, and the manufacturing methods available [5].

If the desirable is not available, the available becomes desirable. The use of locally sourced
materials can be enhanced through manufacturing and heat treatment processes as an
alternative to stainless steel, and this should be promoted. This study, therefore, exploits
locally sourced aluminium alloy and composites whose mechanical properties can be
improved by functionally graded manufacturing method (FGM) techniques for Pelton bucket
production. Aluminium based materials are locally sourced in SSA and possess good
aerodynamics and natural corrosion resistance attributes and can be enhanced by
manufacturing and heat treatment processes. The FGM method of centrifugal casting
combined with heat treatment have been chosen for the production of a Pelton bucket due to
the simplicity and cost-effectiveness of the processes involved [46]. The manufacturing
process of a Pelton turbine bucket has two steps: production of a permanent mould; and,
centrifugal casting process. The concept is to produce a bucket that has hardness and strength
properties in gradient form, such that the inner surface denoted by (a), as shown in Figure
7.18, is the hardest and toughest zone.

Figure 7.18: An offset of section X-X of a Pelton bucket

7.5 SHP system design results

The design of the SHP system was executed by Matlab software for civil and mechanical
sections and the bucket was simulated with Solidworks. The entire process started with the
hydrological data in Table 7.10. The civil components considered include the intake, weir,
open channel (canal), settling basin, forebay, and penstock. In the mechanical design, the

100
main operating parameters of a Pelton hydro turbine were considered and design charts
developed. The Matlab codes are presented in appendixes 3 and 4

7.5.1 Civil works design charts for SHP

Figure 7.19 shows the relation between intake sectional area and intake discharge when hr - hh
= 0.3 m; where hr = normal river water level (m) and hh = headrace level (m). Figure 7.20
depicts the correlation that exists between headrace canal sectional area and discharge at canal
velocity of 1.4 m/s and width of 0.3 m.

Figure 7.19: Intake discharge vs sectional area

Figure 7.20: Canal discharge vs sectional area

Figure 7.21 shows the link between headrace canal sectional area and depth for rectangular
and radius for the circular canal. Notch discharge against weir depth at a width of 0.3 m for
both Vee notch and the rectangular notch is shown in Figure 7.22.

101
Figure 7.21: Canal area vs depth and radius

Figure 7.22: Notch discharge vs weir depth

Variations of the headrace canal sectional area and perimeter wet at the width of 0.3 m and
velocity of 1.4 m/s is shown in Figure 7.23. Figure 7.24 shows the relationship between
length and volume of settling basin silt emptying frequency of 43,200 seconds.

Figure 7.23: Canal sectional area vs perimeter wet

102
Figure 7.24: Length vs volume of settling basin

Figures 7.25 and 7.26 show variations of penstock flow rate against internal diameter and
penstock thickness using theoretical and empirical relations according to Warnick et al. [28]
and United States Department of the Interior, Bureau of Reclamation [30].

Figure 7.25: Discharge vs penstock internal diameter

Figure 7.26: Discharge vs Penstock vent diameter

103
7.5.2 Pelton turbine bucket design charts

Figure 7.27 shows the relation between flow rate and turbine power when turbine efficiency is
83 %. Figure 7.28 shows the variations of flow rate against water jet diameter for two nozzles.

Figure 7.27: Discharge vs power of turbine

Figure 7.28: Discharge vs Jet diameter

The variations of runner tangential velocity against runner diameter at different speeds of
rotation are shown in Figure 7.29, while the relation between bucket features and jet diameter
is presented in Figure 7.30.

104
Figure 7.29: Velocity vs runner diameter of a turbine

Figure 7.30: Bucket design parameters

Figure 7.31 shows the correlation between the operational flow rate and specific speed at
varying rotational speed. The efficiency against turbine power at varying net heads is shown
in Figure 7.32.

Figure 7.31: Rotational speed vs specific speed

105
Figure 7.32: Turbine power vs turbine efficiency

The relationship between the runner torque and reaction force shows proportionality; the
resulting curve is shown in Figure 7.33. The graph of turbine shaft against turbine power at
different rotation speeds is shown in Figure 34.

Figure 7.33: Graph of torque against reaction force

Figure 7.34: Graph of turbine shaft against power

106
7.6 Prototype design parameters

A prototype bucket was designed and Table 7.11 contains the results of the design calculation.

Table 7.11: Main turbine design parameters and constants

Given quantities: Q = 0.033 m3/s; Hn = 60 m; g = 9.81 m/s2; Cn = 0.97; ku ȡ 103 Kg/m3; x = 0.46; nz =
2; N = 1500 rpm; and Șt = 95%
Parameters Calculated Value Parameters Calculated
Value
The input power to the turbine, 18.45 kW Bucket radial length, Bl (m) 0.75 m
Pti (kW)
Specific speed (Ns) 8.98 Bucket depth, Bd (m) 0.03 m
Jet velocity, Vj (m/s) 33.28 m/s Cavity Length, h1 (m) 0.009 m
Jet/nozzle diameter, Dj 0.025 m Length to Impact Point, h2 (m) 0.038 m
Tangential velocity of the runner, Vtr 15.31 m/s Offset of Bucket, k (m) 0.004 m
Runner diameter Dr, (m) 0.19 m Cavity Width, a (m) 0.03 m
nozzle cross-sectional area, Aj 0.0005 m Number of buckets nz 19
3 3
Nozzle flow rate, Qn (m /s) 0.017 m /s Length of bucket moment 0.049 m
arm, Lab (m)
Distance between bucket and nozzle, 0.119 m Absolute reaction force acting 1,186 N
xnb (m) on the Pelton runner, F (N)
Radius of bucket centre of mass to 0.089 m The torque on the runner is Tr: 112.67 N/m
runner centre Rbr (m)
Bucket axial width, Bw (m) 0.08 m

Figure 7.35: The designed bucket prototype

7.7 Pelton bucket simulation results

The Pelton designed as shown in Figure 7.35 was simulated with Solidworks software and the
simulation results were reported. Table 7.12 contains information regarding the name and
mechanical properties of the bucket material.

Table 7.12: Mechanical properties of the bucket material

Name: 356.0-T6 (Permanent Mould Elastic modulus: 7.24e+010 N/m^2


cast)
Model type: Linear Elastic Isotropic Poisson's ratio: 0.33
Yield strength: 1.52e + 008 N/m^2 Mass density: 2680 kg/m^3

107
Tensile strength: 2.28e + 008 N/m^2 Shear modulus: 2.72e + 010 N/m^2
Compressive 1.85e + 008 N/m^2 Thermal expansion 2.1e-005 / Kelvin
strength: coefficient:

Table 7.13 presents information about the simulation study properties.

Table 7.13: Study properties

Study name Static stress


Analysis type Static
Mesh type Solid Mesh
Type of load applied Normal force
Load value 1186 N

Figure 7.36(a-e) shows the simulation processes: (a) the computer aided drafting (CAD) of
the bucket; (b) the areas of force application and the fixtures; (c) the mesh pattern; (d) the von
Mises representation of static stress; and, (e) the von Mises static stress results in colour bar.
Table 7.14 and Figure 7.36e present the maximum stress of 6.723 x 107 N/m2, recorded in the
upper part of the splitter, denoted as S in Figure 7.36d. This value is less than the yield
strength (1.52 x 108 N/m2) of the bucket material (A356-T6). This means that the design is
safe.

Figure 7.36: Diagrammatic representation of simulation process and von Mises result

108
Table 7.14 presents the von Mises stress, displacement, and strain performance of the
prototype Pelton bucket.

Table 7.14: von Mises stress, displacement, and strain results

Name Type Min Max


Stress VON: von Mises 49016.3 N/m^2 6.73216e+007 N/m^2
Stress Node: 10307 Node: 7460
Displacement URES: Resultant 0 mm 0.172845 mm
Displacement Node: 370 Node: 1289
Strain ESTRN: Equivalent 4.82532e-007 0.000622133
Strain Element: 2977 Element: 8721

7.8 Conclusion

Adequate access to reliable, quality and affordable power is a necessity to enhance the
standard of living in SSA. Inadequate power supply has hindered economic development in
the region, especially in the rural areas, for decades, yet the huge SHP potentials available in
the region are untapped. Small hydropower systems have been identified as environmentally
friendly, cost effective and simple renewable energy schemes suitable for rural electrification
in the region. There is a need to popularise SHP schemes for rural areas, industrial estates and
standalone electrification rather than for national grids in SSA. Domestic design and
development of SHP components and systems will facilitate greater access to power in the
region. Small hydropower capacity building and use of locally sourced materials will promote
domestic participation in the design, manufacturing of SHP components and application of
SHP systems. This study, therefore, developed SHP system design codes and charts using
Matlab and a simplified SHP design process and considered materials and manufacturing
techniques available locally. A390 and A390-5Mg cast aluminium alloys were investigated
for a Pelton bucket using Solidworks simulation software. The materials performances
measured by von Mises, displacement and strain results were outstanding.

109
Bibliography

[1] M. M. Alnakhlani, Mukhtar Mukhtar, D. A. Himawanto, A. Alkurtehi and D.


Danardono, "Effect of the bucket and nozzle dimension on the performance of a pelton
water turbine," Modern Applied Science, vol. 9, pp. 25-33, 2015.
[2] M. Mohibullah, A. M. Radzi and M. I. A. Hakim, "Basic design aspects of micro-
hydro-power plant and its potential development in Malaysia," presented at the
National Power and Energy Conference (PECon), Pan Pacific Glenmarie Kuala
Lumpur, Malaysia, 2004.
[3] B. A. Nasir, "Design of micro-hydro-electric power station," International Journal of
Engineering and Advanced Technology (IJEAT), vol. 2, pp. 39-47, 2013.
[4] W. S. Ebhota and F. L. Inambao, "electricity insufficiency in Africa: a product of
inadequate manufacturing capacity," African Journal of Science, Technology,
Innovation and Development, vol. 8, pp. 197-204, 2016.
[5] W. S. Ebhota and F. L. Inambao, "Design basics of a small hydro turbine plant for
capacity building in sub-Saharan Africa" African Journal of Science, Technology,
Innovation and Development, vol. 8, pp. 111-120, 2016.
[6] O. Paish, "Small Hydropower: technology and current status. renewable and
sustainable," Energy Reviews, vol. 6 pp. 537-556, 2002.
[7] UNIDO Projects for the Promotion of Small Hydropower for Productive Use
(11/10/2016). Independent Thematic Review. Available:
https://www.unido.org/fileadmin/user_media/About_UNIDO/Evaluation/Project_repo
rts/e-book_small-hydro.PDF.
[8] S. Sebin, A. A. Tom, J. G. Nikhil and C. A. Ashwin, "Design and modelling of a
pelton wheel bucket: theoretical validation and software comparison," International
Journal of Engineering Research & Technology (IJERT), vol. 3, 2014.
[9] B. A. Nasir, "Design of high-efficiency pelton turbine for micro-hydropower plant,"
International Journal of Electrical Engineering and Technology (IJEET), vol. 4, no. 1,
pp. 171-183, 2013.
[10] L. Gudukeya and I. Madanhire, "Efficiency improvement of pelton wheel and
crossflow turbines in micro-hydropower plants: case study," International Journal of
Engineering and Computer Science, vol. 2, pp. 416-432, 2013.
[11] W. Bolon, V. Sharma and M. Singh, "Green mechatronics project: pelton wheel driven
micro-hydro plant," Mechanical Engineering University of Ottawa, 2010.

110
[12] R. N. Mbiu, S. M. Maranga and H. Ndiritu, "Performance of aluminium A356 alloy
based buckets towards bending forces on Pelton turbines," in Proceedings of the
Sustainable Research and Innovation (SRI) Conference, Nairobi, Kenya, 2015, pp.
134-138.
[13] A. K. M. K. Islam, S. Bhuyan and F. A. Chowdhury, "Advanced composite Pelton
wheel design and study its performance for pico/micro hydropower plant application,"
International Journal of Engineering and Innovative Technology (IJEIT), vol. 2, no.
11, pp. 126-132, 2013.
[14] N. N. I. Reddy and T. S. Prasad, "Design and static analysis of Pelton turbine bucket"
International Journal of Science Technology and Management, vol. 4, pp. 19-25,
2015.
[15] W. S. Ebhota and F. L. Inambao, "Design basics of a small hydro turbine plant for
capacity building in sub-Saharan Africa," African Journal of Science, Technology,
Innovation and Development, vol. 8, pp. 111-120, 2016.
[16] European Small Hydropower Association (ESHA), "Energy recovery in existing
infrastructures with small hydropower plants," presented at the Sixth Framework
Programme, Mhylab, Switzerland, 2010.
[17] V. T. Chow, Open-Channel Hydraulics. Michigan: McGraw-Hill, 1959.
[18] M. E. S. Haestad and E. M. Michael, Computer Applications in Hydraulic
Engineering: Basic Hydraulic Principles. Waterbury, CT: Haestad Methods, Inc.,
2002.
[19] British Hydropower Association (BHA), "A guide to UK mini-hydro development,"
Wimborne, United Kingdom: British Hydropower Association 2012.
[20] A. Kunwor, "Technical specifications of micro hydropower system design and its
implementation: feasibility analysis and design of Lamaya Khola micro hydropower
plant," Bachelor’s Degree Thesis, Industrial Management, Arcada Polytechnic, Nepal,
2012.
[21] Pakistan Poverty Alleviation Fund (PPAF), Renewable Energy Guidelines:
Micro/Mini Hydropower Design Aspects vol. 11. Islamabad: Pakistan Poverty
Alleviation Fund, 2013.
[22] C. Penche, Layman's Guidebook on How to Develop a Small Hydro Site, Second
edition ed. Belgium: The European Small Hydropower Association (ESHA), 1998.
[23] B. A. Nasir, "Design consideration of micro hydro-electric power plant," Energy
Procedia, vol. 50, pp. 19–29, 2014.
111
[24] Y. Amarjeet and P. G. Shriram, "Prospect of micro hydropower in hilly area,"
International Journal of Scientific Research and Development, vol. 2, pp. 2321-0613,
2014.
[25] Indonesian Renewable Energy Commission (IREC). (2015, 10/08/2016). Penstock
thickness calculation (case study). Available:
http://indmicrohydro.blogspot.co.za/search/label/Penstocks.
[26] The Engineering ToolBox. (2016, 19/07/2016). Manning's roughness coefficients for
common materials. Available: www.engineeringtoolbox.com/mannings-roughness-
d_799.html.
[27] M. K. Singhal and A. Kumar, "Optimum design of penstock for hydro projects,"
International Journal of Energy and Power Engineering, vol. 4, pp. 216-226, 2015.
[28] C. C. Warnick, H. A. Mayo, J. L. Carson and L. H. Sheldon, Hydropower
Engineering. Englewood Cliffs, NJ: Prentice-Hall Inc., 1984.
[29] G. S. Sarkaria, "Economic penstock diameter: a 20-year review," Water Power and
Dam Construction November, vol. 31, pp. 70-72, 1979.
[30] United States Department of the Interior, Bureau of Reclamation, "Welded steel
penstocks," Engineering Monograph No. 3, Washington, 1986.
[31] F. Fablbusch, "Determining diameters for power tunnels and pressure shafts" Water
Power and Dam Construction, February, 1987.
[32] American Society of Civil Engineers (ASCE), Steel Penstocks Manuals and Reports
on Engineering Practice No. 79. New York: American Society of Civil Engineers,
1993.
[33] A. Bulu. (no date, 30/07/2016). Hydroelectric power plants. Available:
web.itu.edu.tr/~bulu/hyroelectic.../lecture_notes_12.pdf.
[34] O. Zia, O. A. Ghani, S. T. Wasif and Z. Hamid, "Design, fabrication and installation
of a micro-hydropower plant," Mechanical Engineering, GIK Institute of Engineering
Sciences & Technology, 2010.
[35] American Society of Mechanical Engineers (ASME) Hydropower Technical
Committee, The Guide to Hydropower Mechanical Design. New York, NY: American
Society of Mechanical Engineers, 1996.
[36] J. F. Claydon. (2015, 18/05/2015). Turbines. Available:
http://www.jfccivilengineer.com/turbines.htm.
[37] S. L. Dixon and C. A. Hall, Fluid Mechanics and Thermodynamics of
Turbomachinery-Chapter 9 – Hydraulic Turbines, 7th ed. Oxford: Elsevier Inc, 2014.
112
[38] E. Logan and R. Roy, Handbook of Turbomachinery, New York, NY: Marcel Dekker
Inc, 2003
[39] P. Henry, Turbomachines Hydrauliques, 1st ed. Ecublens, Switzerland,: PPUR, 1992.
[40] H. Brekke, Pumper & Turbiner. Trondheim: Vannkraftlaboratoriet NTNU, 2003.
[41] M. F. White, Fluid Mechanics. New York, NY: McGraw Hill 2008.
[42] G. Okhay, "Utilisation of CFD tools in the design process of a Francis turbine,"
Master thesis, Middle East Technical University, Ankara, Turkey, 2010.
[43] International Energy Agency (IEC), "Field acceptance tests to determine the hydraulic
performance of hydraulic turbines, storage pumps and pump-turbines," IEC
International standard 60041, 3rd ed, 1991.
[44] North American Electric Reliability Corporation (NERC), "Appendix F, performance
indexes and equations," Atlanta, GA: North American Electric Reliability
Corporation, 2011.
[45] P. Adhikary, P. K Roy and A, Mazumdar, "Selection of hydro-turbine blade material:
application of fuzzy logic (MCDA)," International Journal of Engineering Research
and Applications, vol. 3, pp. 426-430, 2013.
[46] W. S. Ebhota, A. S. Karun and F. L. Inambao, "Centrifugal casting technique baseline
knowledge, applications, and processing parameters: overview," International Journal
of Materials Research, 04 August, 2016.

113
CHAPTER 8: INVESTIGATION OF FUNCTIONALLY GRADED
ALUMINIUM A356 ALLOY AND A356-10%SICP COMPOSITE FOR
HYDRO TURBINE BUCKET APPLICATION

W. S. Ebhota and F. L. Inambao, "Investigation of Functionally Graded Aluminium A356


Alloy and A356-10%SiCp Composite for Hydro Turbine Bucket Application," International
Journal of Engineering Research in Africa, 2016, Vol. 26, pp 30-46.
DOI:10.4028/www.scientific.net/JERA.26.30 (Published).

114
International Journal of Engineering Research in Africa Submitted: 2016-07-01
ISSN: 1663-4144, Vol. 26, pp 30-46 Revised: 2016-07-30
doi:10.4028/www.scientific.net/JERA.26.30 Accepted: 2016-08-02
© 2016 Trans Tech Publications, Switzerland Online: 2016-10-07

,QYHVWLJDWLRQRI)XQFWLRQDOO\*UDGHG$OXPLQLXP$$OOR\
DQG$6L&S&RPSRVLWHIRU+\GUR7XUELQH%XFNHW$SSOLFDWLRQ
(EKRWD:LOOLDPV6D$NKLO6.DUXQEDQG,QDPEDR)UHGGLH/F

'LVFLSOLQHRI0HFKDQLFDO(QJLQHHULQJ+RZDUG&ROOHJH8QLYHUVLW\RI.ZD=XOX1DWDO'XUEDQ
6RXWK$IULFD

0DWHULDOV6FLHQFHDQG7HFKQRORJ\'LYLVLRQ&6,51DWLRQDO,QVWLWXWHIRU,QWHUGLVFLSOLQDU\
D
(PDLOZLOO\PRRQ#\DKRRFRPE(PDLODNKLOVNDUXQ#JPDLOFRP
F(PDLOLQDPEDRI#XN]QDF]D

.H\ZRUGV )XQFWLRQDOO\ JUDGHG PDWHULDOV FHQWULIXJDO FDVWLQJ $ DOOR\ $6L&S


FRPSRVLWH3HOWRQEXFNHWWXUELQHEODGH

$EVWUDFW7KHVWXG\LQYHVWLJDWHVWKHDSSOLFDWLRQRIFHQWULIXJDOFDVWLQJSURFHVVLQWKHSURGXFWLRQRI
D FRPSOH[ VKDSH FRPSRQHQW 3HOWRQ WXUELQH EXFNHW 7KH EXFNHW PDWHULDOV H[DPLQHG ZHUH
IXQFWLRQDOO\JUDGHGDOXPLQLXP$DOOR\DQG$6L&SFRPSRVLWH$SHUPDQHQWPRXOGIRU
WKH FDVWLQJ RI WKH EXFNHW ZDV GHVLJQHG ZLWK D 6ROLGZRUNV VRIWZDUH DQG IDEULFDWHG E\ WKH
FRPELQDWLRQ RI&1&PDFKLQLQJ DQGZHOGLQJ2LOKDUGHQLQJQRQVKULQNLQJGLHVWHHO 2+16 ZDV
FKRVHQ IRU WKH PRXOG PDWHULDO 7KH 2+16 ZDV KHDW WUHDWHG DQG D KDUGQHVV RI  %+1 ZDV
REWDLQHG 7KH PRXOGZDVSXWLQWRXVHWKHEXFNHWVRI$$OOR\DQG$6L&SFRPSRVLWH
ZHUHFDVWFXWDQGPDFKLQHGLQWRVSHFLPHQV6RPHRIWKHVSHFLPHQVZHUHJLYHQ7KHDWWUHDWPHQW
DQG WKH VSHFLPHQV ZHUH SUHSDUHG DFFRUGLQJ WR WKH GHVLJQHG LQYHVWLJDWLRQV 7KH PLFURJUDSKV RI
$6L&SFRPSRVLWHVKRZVPRUHFRQFHQWUDWLRQRI6L&S SDUWLFOHVDWWKHLQQHUSHULSKHU\RIWKH
EXFNHW7KHPD[LPXPKDUGQHVVRI$V&DVW$DQG$6L&SFRPSRVLWHZHUH%51DQG
%51UHVSHFWLYHO\UHFRUGHGDWWKHLQQHUSHULSKHU\RIWKHEXFNHW$QGWKHVHYDOXHVDSSUHFLDWHGWR
%51 DQG %51 IRU $ DOOR\ DQG $6L&S FRPSRVLWH UHVSHFWLYHO\ DIWHU KHDW
WUHDWPHQW7KHSUHGLFWLRQFXUYHVRIWKHXOWLPDWHWHQVLOHVWUHVVDQG\LHOGWHQVLOHVWUHVVVKRZWKHVDPH
WUHQGDVWKHKDUGQHVVFXUYHV

,QWURGXFWLRQ
7KH VWXG\ IRFXVHV RQ WKH ZHDU DQG VWUHQJWK SURSHUWLHV HQKDQFHPHQW RI $ DOXPLQLXP DOOR\
DQG $6L&S FRPSRVLWH H[SORULQJ PDQXIDFWXULQJ SURFHVV FDVWLQJ  DQG KHDW WUHDWPHQW
SURFHVV IRU3HOWRQEXFNHWSURGXFWLRQ7KHXVHRIORFDOO\VRXUFHGPDWHULDOVIRU6+3K\GURWXUELQH
FRPSRQHQWV DQG WKHLU PDQXIDFWXULQJ WHFKQRORJLHV LV YHU\ FUXFLDO WR HQHUJ\ SURYLVLRQ DQG
VXVWDLQDELOLW\ LQ VXE6DKDUD $IULFD 66$  'RPHVWLFDWLRQ RI 6+3 WHFKQRORJ\ LV WKH NH\ WR WKH
SHUHQQLDO UXUDO HOHFWULILFDWLRQSUREOHPV LQWKHUHJLRQ7RHIIHFWLYHO\WDFNOHWKHSHUHQQLDOSRZHULQ
6XE 6DKDUD $IULFD 66$  WKH HOHFWULFLW\ JHQHUDWLRQ DQG GLVWULEXWLRQ WHFKQRORJLHV VKRXOG EH
GRPHVWLFDWHGLQWKHUHJLRQ7KLVZLOOHQVXUHWKDWFKDOOHQJHVDVUHJDUGVWRKLJKFRVWRISRZHUSURMHFW
GXUDWLRQRISURMHFWH[HFXWLRQLQVWDOODWLRQRSHUDWLRQPDLQWHQDQFHDQGUHSDLUDQGGRZQWLPHZLOOEH
WDFNOHGDQGVXVWDLQHG6HYHUDODXWKRUVDQGHQHUJ\UHVHDUFKRUJDQLVDWLRQVVHHVPDOODQGPLFURSRZHU
V\VWHP RI UHQHZDEOH HQHUJ\ DUH WKH EHVW RSWLRQ IRU UXUDO DQG RII JULG DUHDV LQ 66$ > @ ,W
WKHUHIRUHLPSHUDWLYHIRUFRXQWULHVRI66$WRGHYHORSVPDOODQGPLFURUHQHZDEOHHQHUJ\V\VWHPIRU
KHUHFRQRPLFJDLQV
7HFKQLFDO FDSDFLWLHV EXLOGLQJ IRU K\GUR WXUELQH FRPSRQHQWV DQG V\VWHP GHVLJQ PDWHULDO
VHOHFWLRQ DQG PDQXIDFWXULQJVKRXOGEHSURPRWHGWKURXJKUHJLRQDOMRLQWHIIRUWDFDGHPLFUHVHDUFK
H[FKDQJHSURJUDPPHZLWKWKHGHYHORSHGFRXQWULHVHWF>@7KHFDSDFLW\EXLOGLQJVKRXOGEHVXFK
WKDWZLOOLQFUHDVHORFDOSDUWLFLSDWLRQLQ6+3WHFKQRORJ\GRPHVWLFDWLRQLQWKHUHJLRQ66$ZLWKDORW
RI XQWDSSHG 6+3 SRWHQWLDOV DV SUHVHQWHG LQ 7DEOH  QHHGV WR H[SORUH PHULWV RI 6+3 IRU JUHDWHU
DFFHVVWRSRZHU>@

All rights reserved. No part of contents of this paper may be reproduced or transmitted in any form or by any means without the written permission of Trans
Tech Publications, www.ttp.net. (#70366975, University of Illinois, Urbana, USA-10/10/16,01:24:21)
International Journal of Engineering Research in Africa Vol. 26 31

7DEOH6+3SRWHQWLDOLQ66$>@
5HJLRQVLQ66$ $YDLODEOH6+3 ,QVWDOOHG ,QVWDOOHG
SRWHQWLDO 0:  FDSDFLW\ 0:  FDSDFLW\  
(DVWHUQ$IULFD   
0LGGOH$IULFD   
6RXWK$IULFD   
:HVW$IULFD   

5HYLHZ
/RLFHDQG,JQDWLRLQYHVWLJDWHGWKHHIIHFWVRIPDWHULDOVXUIDFHWH[WXUHDQGIDEULFDWLRQPHWKRGVRQ
HIILFLHQF\ RI K\GUR SRZHU SODQW ZLWKLQ DQ DFFHSWDEOH FRVW UDQJH 7KH VWXG\ FRQFOXGHG WKDW
PDQXIDFWXULQJ RI PRUH HIILFLHQW ILQDQFLDOO\ YLDEOH 3HOWRQ WXUELQHV IRU 6+3 LV SRVVLEOH ,Q WKHLU
SURMHFW PRUH HOHFWULFLW\ ZDV JHQHUDWHG DW D UHGXFHG FRVW SHU XQLW N: >@ $ WKHRUHWLFDO PLFUR
K\GURHOHFWULF SODQW GHVLJQ IRU RII JULG DSSOLFDWLRQV ZDV FDUULHG RXW WR SURGXFH D JUHHQ SRZHU IRU
UHPRWHIDUPVRUFRWWDJH$SURWRW\SHRIWKHV\VWHPZDVEXLOWWRWHVWWKHGHVLJQ>@
$VWXG\RQWKHPRGHOOLQJDQGYDOLGDWLRQRIUHVXOWVHPSLULFDOO\XVLQJORFDOO\DYDLODEOHPDWHULDOV
ZDVFDUULHGRXWLQ.HQ\DQ>@,QWKHVWXG\VWUHVVUHGXFWLRQZDVDFKLHYHGE\PRGLI\LQJWKH
SURILOH RI WKH 3HOWRQ EXFNHW $ UHF\FOHG $ DOXPLQLXP DOOR\ ZDV IRXQG WR ZLWKVWDQG VWUHVV RI
0SD SURGXFHG E\ WKH JHQHUDWHG  N: SRZHU >@  $ 3HOWRQ WXUELQH ZDV GHVLJQHG DQG
PDQXIDFWXUHG IRU 3LFR 3HOWRQ WXUELQH XVLQJ FKRSSHG JODVV ILEUHV UHLQIRUFHG HSR[\ PDWUL[
FRPSRVLWHDVWKHEXFNHWPDWHULDO>@$OLWUHVFDSDFLW\VWRUDJHWDQNLQDVWRUH\WRZHUZDV
XVHGDVDZDWHUVRXUFHWRRSHUDWHWKHWXUELQH,QWKHVWXG\N:ZDVJHQHUDWHGRXWWKHN:
WKDWZDVWKHRUHWLFDOO\GHVLJQHGIRU ,QWKHGHVLJQVWXG\RI1DYDDQG6LYD&$7,$9GHVLJQ DQG
PRGHOOLQJVRIWZDUHZDVXVHGWRGHVLJQHGDQGRSWLPLVHG3HOWRQWXUELQHFRQVLGHULQJWKUHHPDWHULDOV
LQWKHDQDO\VLV>@(IILFLHQWDQGVWUHVVLQUHODWLRQZLWKWKHQXPEHURIEXFNHWVZHUHVWXGLHGLQWKH
ZRUN ,Q WKH WKUHH EXFNHW PDWHULDOV VHOHFWHG VWHHO FDVW LURQ DQG ILEUH JODVV UHLQIRUFHG SODVWLF
PDWUL[  WKH VWXG\ FRQFOXGHG WKDW ILEUH JODVV UHLQIRUFHG SODVWLF PDWUL[ VKRZV H[FHSWLRQDO
SHUIRUPDQFHFRPSDUHGWRFDVWLURQ+RZHYHUWKHUHDUHVWULNLQJOLPLWDWLRQLQWKDWDUHDVVRFLDWHGZLWK
WKHXVHILEUHUHLQIRUFHGFRPSRVLWH,WUHTXLUHVGHSWKH[SHUWLVHPRVWRIWKHPDWHULDOFRQVWLWXHQWVDUH
LPSRUWHG DQG IRUPV VROLG ZDVWH LW LV GDPDJH DV PRVW FDVHV UHF\FOLQJ DQG GHFRPSRVLWLRQ DUH QRW
SRVVLEOH$ORWRIWKHRUHWLFDOGHVLJQZRUNRIK\GURWXUELQHKDYHEHHQVWXGLHG+RZHYHURQO\IHZLV
NQRZQ RI WKH XVH RI DOXPLQLXP DOOR\V DQG WKHLU FRPSRVLWHV IRU WKH IDEULFDWLRQ RI 3HOWRQ WXUELQH
EXFNHW3UHVHQWDSSOLFDWLRQVRIDOXPLQLXPDOOR\VDQGWKHLUFRPSRVLWHVK\SRWKHWLFDOO\VXJJHVWWKDW
DOXPLQLXP DOOR\V DQG FRPSRVLWHV DUH SURPLVLQJ PDWHULDOV IRU 3HOWRQ WXUELQH EXFNHW DQG WXUELQH
EODGHIDEULFDWLRQ

$SSOLFDWLRQRI$DOOR\DQG$6L&SFRPSRVLWHVXLWDELOLW\IRU3HOWRQWXUELQHEXFNHW
3UHYLRXV VWXGLHV RI K\GUR WXUELQH SODQWV UHYHDOHG WKDW VLOW HURVLRQ DIIHFWV WKH XQGHUZDWHU
FRPSRQHQWV JUHDWO\ ZKLFK LQFOXGH WXUELQH EODGH >@ ,Q VRPH FDVHV ZDWHU LV VWRUHG LQ D
UHVHUYRLURULQDVHWWOLQJEDVLQWREHXVHGZKHQWKHQHHGDULVHV2YHUDSHULRGRIWLPHVHGLPHQWVWKDW
LQFOXGHV VLOWV DQG KDUG DEUDVLYH VDQG VHWWOH DW WKH ERWWRP RI WKH UHVHUYRLU RU EDVLQ 7KLV SUREOHP
PXVW EH WDNHQ FDUH RI E\ VHGLPHQW VHWWOLQJ V\VWHPV LQ SRZHU SODQWV +RZHYHU D ORW RI XQVHWWOHG
VHGLPHQW VWLOO SDVV WKURXJK WKH WXUELQH HYHU\ \HDU DQG WKH WXUELQH UXQQHU LV WKHUHIRUH H[SRVHG WR
VHYHUH HURVLRQ ZHDU 7KLV VHGLPHQWV DUH RIWHQ SUHYHQWHG IURP JR WKURXJK WKH WXUELQH E\
LQFRUSRUDWLQJVHGLPHQWVHWWOLQJV\VWHPVLQWKHSRZHUSODQW+RZHYHUWKHUHDUHVWLOOSRVVLELOLWLHVRI
XQVHWWOHG VHGLPHQW SDVVLQJ WKURXJK WKH WXUELQH DQG WKLV RFFXUUHQFH FDXVHV VHULRXV HURVLRQ WR WKH
QR]]OHV\VWHPDQGWKHWXUELQHUXQQHU7KHSDUWVWKDWDUHYXOQHUDEOHWRVLOWHURVLRQDUHEXFNHWEODGH
IDFHSODWHV DQG VHDO ULQJV 6WXGLHV KDYH VKRZQ WKDW VLOW HURVLRQ PHQDFH LV PRUH VHYHUH GXULQJ WKH
UDLQLQJVHDVRQ>@
32 International Journal of Engineering Research in Africa Vol. 26

7KH HIIHFWV RI HURVLRQ RQ WXUELQH GHSHQGV RQ FHUWDLQ ZDWHU DQG WXUELQH PDWHULDO IDFWRUV 7KH
IDFWRUV LQFOXGH ZDWHU IORZ YHORFLW\ DQG GLVFKDUJH ZDWHU VDOW FRQFHQWUDWLRQ VLOW TXDQWLW\ DQG VL]H
DQG ZHDU DQG FRUURVLRQ UHVLVWDQFH KDUGQHVV DQG VWUHQJWK RI WKH WXUELQH PDWHULDO 7R HIIHFWLYHO\
JXLGHDJDLQVWWXUELQHIDLOXUHDQGWRHQKDQFHLWVOLIHVSDQWKHGHVLJQFRQVLGHUDWLRQRIWKHVHIHDWXUHV
LVYLWDO+RZHYHUZHDUDQGFRUURVLRQUHVLVWDQFHHQKDQFHPHQWRIWKHWXUELQHEODGHFDQEHDFKLHYHG
WKURXJKPDQXIDFWXULQJPHWKRG7KLVDWWULEXWHLPSURYHPHQWKHOSVWKHEODGHWRZLWKVWDQGWKHHIIHFW
RIWKHZDWHUVDOWFRQFHQWUDWLRQDQGWKHPRYLQJXQVHWWOHGVLOWDQGKDUGDEUDVLYHVDQG

0HWDO5HDFWLRQLQ(QYLURQPHQW
3UHVHQWO\ K\GUR WXUELQH EODGHV DUH PDGH IURP PHWDOV DQG WKH\ VKRZ WKUHH W\SHV RI EHKDYLRXU
ZKHQLPPHUVHGLQWKHHQYLURQPHQW,PPXQHEHKDYLRXUDFWLYHEHKDYLRXUDQGSDVVLYHEHKDYLRXUDV
VKRZQLQ)LJ>@7KHQREOHPHWDOVOLNHJROGVLOYHUDQGSODWLQXPVKRZLPPXQHEHKDYLRXUDV
WKH\GRQRWUHDFWZLWKWKHHQYLURQPHQWDQGWKHUHIRUHQRFRUURVLRQ$PHWDOLVVDLGWRKDYHDQDFWLYH
EHKDYLRXUZKHQLWFRUURGHVLQDVROXWLRQDQGIRUPVVROXEOHQRQSURWHFWLYHFRUURVLRQSURGXFW7KLV
DFWLYH EHKDYLRXU LV DVVRFLDWHG ZLWK KLJKHU ZHLJKW ORVV RI WKH PHWDO DQG H[DPSOH LV PLOG VWHHO
LPPHUVLRQLQ1D&OVROXWLRQ VHDZDWHU ,QWKHWKLUGEHKDYLRXUWKHPHWDOFRUURGHVLQDVROXWLRQEXW
IRUPVDQLQVROXEOHSURWHFWLYHILOPWKDWPDNHVLWWRKDYHDSDVVLYHVWDWH3DVVLYHILOPVDUHGLIIHUHQW
IURP SDLQWV IRU FRDWLQJ DV VRPH SHRSOH KROG 6RGLXP SRWDVVLXP DQG PDJQHVLXP DUH DFWLYH LQ
DOPRVWDOODTXHRXV PHGLD 7LWDQLXPDQG WDQWDOXPDUHSDVVLYHQHDUO\LQDOODTXHRXVHQYLURQPHQWV
$OXPLQLXP DQG ]LQF DUH SDVVLYH LQ VRPH PHGLD EXW DUH YHU\ DFWLYH PHWDOV DQG VKRZ DFWLYH
FKDUDFWHULQPDQ\HQYLURQPHQWV


)LJ7KUHHPHWDOFKDUDFWHUVLQDQHQYLURQPHQW>@
6HDZDWHU LV WKH PRVW FRUURGHQW QDWXUDO PHGLXP ZKHUH PHWDOV DUH FRPPRQO\ XVHG DQG LWV
FRPSRVLWLRQ KDV FRUURVLYH UHDJHQWV KDOLGHV 1D&O DQG 0J&O  7KH FRPSRVLWLRQDO FRQWHQW RI
VHDZDWHUGHSHQGVRQJHRJUDSKLFDOORFDWLRQDQGYDULHVRYHUDZLGHUDQJHKRZHYHUWKHVDOWFRQWHQW
RI:RUOG2FHDQLVDSSUR[LPDWHO\FRQVWDQWDERXW>@7KHZRUOGVHDVVDOWFRPSRVLWLRQV
DUHVKRZQLQWDEOH
7DEOH&RQWHQWVRIVDOWLQZRUOG2FHDQVDQGULYHUZDWHU>@
2FHDQV VDOWFRQWHQW
$WODQWLF2FHDQ ±
3DFLILF2FHDQ ±
0HGLWHUUDQHDQ6HD ±
5HG6HD 
6HDRI$]RY ±
%DOWLF6HD ±
:KLWH6HD ±
&DVSLDQ6HD ±
%ODFN6HD ±
5LYHUV ±

$OXPLQXPDOOR\VVXVFHSWLELOLW\WRFRUURVLRQDUHUHDVRQDEO\GLIIHUDVDUHVXOWDOXPLQXPDOOR\V
FDQEHFDWHJRULVHGLQWRWZRJURXSVDFFRUGLQJWRWKHLUVHDZDWHUFRUURVLRQUHVLVWDQFH
International Journal of Engineering Research in Africa Vol. 26 33

L +LJKFRUURVLRQUHVLVWDQFHDOOR\VEXWYXOQHUDEOHWRSLWWLQJFRUURVLRQ
LL $OOR\VYXOQHUDEOHWRLQWHUJUDQXODUFRUURVLRQ ,*& H[IROLDWLRQFRUURVLRQ (& DQGFRUURVLRQ
FUDFNLQJ && WKHVWUXFWXUDOFRUURVLRQW\SHV
(PSLULFDOO\FRQGXFWLQJODERUDWRU\FRUURVLRQWHVWZLWKWUDGLWLRQDOVHDZDWHULVQRWDOZD\VDFFXUDWH
GXH WR WKH HIIHFWV RI RWKHU LPSXULWLHV DSDUW IURP FKORULGHV LQ VHDZDWHU 7DEOH  SUHVHQWV RWKHU
LPSXULWLHV LQ VHDZDWHU 7KH LPSXULWLHV DIIHFW VWUXFWXUDO FRUURVLRQ W\SHV (& ,*& DQG && 
VXVFHSWLELOLW\RIPHWDO
7DEOH7KHVWDQGDUGVHDZDWHUFRPSRVLWLRQ>@
6DOWV JOZDWHU 
1D&O  
0J&O  
0J62  
&D62  
.62  
&D&2  
0J%U  
7RWDOO\  

7KH $O6L FDVW DOOR\V DQG WKHLU FRPSRVLWHV DUH NQRZQ IRU VXSHULRU SURSHUWLHV OLNH FRUURVLRQ DQG
ZHDU UHVLVWDQFH KLJK VWUHQJWK ORZ WKHUPDO FRHIILFLHQW H[FHOOHQW FDVWDELOLW\ HWF 7KLV KDV PDNH
WKHP UHOHYDQW PDWHULDOV IRU QXPEHU RI DSSOLFDWLRQV LQ DLUVSDFH DQG RWKHU HQJLQHHULQJ LQGXVWULHV
9DULRXV PHWKRGV DUH XVHG WR GHYHORS DQG LPSURYH WKH SURSHUWLHV RI $O6L FDVW DOOR\V DQG
FRPSRVLWHV7KHVHSURSHUWLHVDUHGHSHQGHGRQPLFURVWUXFWXUHRIWKHPDWUL[DQGWKHVL]HVKDSHW\SH
DQGYROXPHRIUHLQIRUFHPHQWLQWKHPDWUL[ :HDUUHVLVWDQFHDQGRWKHUPHFKDQLFDOSURSHUWLHVDUH
IXQFWLRQRIWKHKDUGQHVVRIWKHVHFRQGSKDVHSDUWLFOHVLQWKHPDWUL[>@

)XQFWLRQDOO\JUDGHGPDQXIDFWXULQJWHFKQLTXH&HQWULIXJDOFDVWLQJWHFKQLTXH
&HQWULIXJDO FDVWLQJ WHFKQLTXH ZDV FKRVHQ GXH WR LWV PHFKDQLFDODQG PLFURVWUXFWXUDO HQKDQFLQJ
DGYDQWDJHV7KHSURFHVVDLGVPLFURVWUXFWXUHJUDGLHQWDQGLPSURYHKDUGQHVVRIDOOR\VHYHQZLWKRXW
UHLQIRUFHPHQW DQG WKHUHIRUH JLYHV WKH PDWHULDO D EHWWHU ZHDU DQG FRUURVLRQ UHVLVWDQFH >@ 7KH
PHFKDQLFDOSURSHUWLHVRIDOXPLQLXP±VLOLFRQDOOR\VDUHRIWHQLPSURYHGE\FDVWLQJWHFKQRORJ\>@
4XLWHRIWHQK\SRHXWHFWLFDQGQHDUHXWHFWLF$O6LDOOR\VDUHDSSOLHGZKHQFRUURVLRQUHVLVWDQFHDQG
JRRGFDVWDELOLW\DUHQHHGHGDQGZLWKOLWWOHTXDQWLW\RI0JDQG&XIRUKHDWWUHDWPHQWHQKDQFHPHQW,W
KDV EHHQ UHYHDOHG WKDW FHQWULIXJDO FDQ LQFUHDVH UXSWXUH VWUDLQ E\  DQG UXSWXUH VWUHQJWK E\
\RXQJPRGXOXVE\DQGIDWLJXHOLIHE\>@

0HWKRGRORJ\RIWKH6WXG\
7KH VWXG\ LV GLYLGHG LQWR WZR SDUWV PDQXIDFWXULQJ RI 3HOWRQ WXUELQH EXFNHW E\ FHQWULIXJDO
FDVWLQJWHFKQLTXHDQGFKDUDFWHULVDWLRQRI3HOWRQWXUELQHEXFNHWPDWHULDOV

0DQXIDFWXULQJRI3HOWRQWXUELQHEXFNHW
7KH IDEULFDWLRQ RI 3HOWRQ WXUELQH EXFNHW KDV WZR VWDJHV 3URGXFWLRQ RI SHUPHQDW PRXOG DQG
FHQWULIXJDO FDVWLQJ RI WKH 3HOWRQ EXFNHW  7KH ' PRGHO RI WKH EXFNHW LV VKRZQ LQ )LJ  ,Q WKLV
VWXG\WKHEXFNHWZDVGHVLJQHGIRUDFDSDFLW\RIN:WXUELQHSRZHU
34 International Journal of Engineering Research in Africa Vol. 26

 
)LJ7KHGLDJUDPVKRZVWKHGHVLJQSDUDPHWHUVRIDEXFNHW
3URGXFWLRQRI0RXOG7KHPRXOGZDVGHVLJQHGZLWK6ROLGZRUNVVRIWZDUHZKHUHWKH,*(6ILOHV
RI WKH PRXOG FRPSRQHQWV ZHUH JHQHUDWHG &RPSXWHU QXPHULFDO FRQWURO &1&  PDFKLQLQJ FHQWUH
ZDVXVHGWRPDFKLQHWKHFRPSRQHQWVRIWKHSHUPDQHQWPRXOG7KHFRPSXWHUDLGHGGHVLJQ &$' 
GUDZLQJRIWKHPRXOGDVGHVLJQHGDQGDVSURGXFHGDUHVKRZQLQ)LJ D DQG E UHVSHFWLYHO\


D 


E 
)LJD ([SORGHGGLDJUDPRIWKH3HOWRQEXFNHWPRXOGDVGHVLJQHGE ([SORGHGGLDJUDPRIWKH
3HOWRQEXFNHWPRXOGDVIDEULFDWHG
International Journal of Engineering Research in Africa Vol. 26 35

0RXOG 0DWHULDO 2LO +DUGHQLQJ 1RQ 6KULQNLQJ 'LH 6WHHO 2+16  ZDV XVHG DV WKH PRXOG
PDWHULDO DQG WKH FRPSRQHQWV ZHUH KHDWHG WUHDWHG EHIRUH WKH\ ZHUH SXW WR XVH 7KH FKHPLFDO
FRPSRVLWLRQ LV VKRZQ LQ 7DEOH  2+16 VWHHO LV D UHOLDEOH PDWHULDO IRU JDXJLQJ EODQNLQJ DQG
FXWWLQJ WRROV DV ZHOO DV IRU KDUGQHVV DQG HOHYDWHG WHPSHUDWXUH SHUIRUPDQFH >@ 7KH KDUGHQLQJ
WHPSHUDWXUH XVHGZDV R&DQGKDGDKDUGQHVVRIDERXWRI%ULQHOO.JIVWDQGDUG7KH
IDEULFDWHG3HOWRQEXFNHWPRXOGFRPSRQHQWVDUHVKRZQLQ)LJ
7DEOH&KHPLFDOFRPSRVLWLRQRIWKH2+16PDWHULDOXVHGIRUWKH3HOWRQEXFNHWPRXOG
(OHPHQW & 0Q &U : 9
     


)LJ7KHIDEULFDWHG3HOWRQEXFNHWPRXOGFRPSRQHQWV
&HQWULIXJDO&DVWLQJRI3HOWRQ%XFNHW7KHIXQFWLRQDOO\JUDGHGPDWHULDOV )*0V $DOOR\
DQG $6L&SDUHXQGHULQYHVWLJDWLRQ 7KH FKHPLFDOFRPSRVLWLRQRI$ XVHGLVVKRZQLQ
7DEOH
7DEOH$DOOR\FKHPLFDOFRPSRVLWLRQ
(OHPHQWV &X 0J 0Q 6L )H 7L =Q $O
        
&DVWLQJRI$$OOR\&OD\JUDSKLWHFUXFLEOHZDVXVHGWRSURFHVVWKHDOOR\+H[DFKORURHWKDQH
ZDV DSSOLHG DW  R& IRU GHJDVVLQJ RI WKH PROWHQ PHWDO WR SUHYHQW K\GURJHQ HQWUDSPHQW 7KH
PROWHQPHWDOZDVVXSHUKHDWHGWRR&DERYHLWV/LTXLGXVWHPSHUDWXUH7KHOLTXLGPHWDOZDVWKHQ
SRXUHGLQWRDVSLQQLQJ3HOWRQEXFNHWPRXOG FHQWULIXJDOFDVWLQJ DQGDVWDWLRQDU\UHFWDQJXODUPRXOG
JUDYLW\FDVWLQJ 7KHPRXOGVZHUHSUHKHDWHGWRR&DQGWKH3HOWRQEXFNHWPRXOGZDVURWDWHGDW
530GXULQJSRXULQJDQGVROLGLILFDWLRQ7KHURWDWLRQZDVVWRSSHGPLQXWHVDIWHUSRXULQJ
&DVWLQJ RI $6L&S &RPSRVLWH 7KH VDPH PHOWLQJ FRQGLWLRQV IRU $ DOOR\ DV VWDWHG
DERYH ZHUH IROORZHG IRU WKH FDVWLQJ RI $6L&S FRPSRVLWH 7KH  —P 6L& SDUWLFOH ZDV
SUHKHDWHG WR  R& EHIRUH LQVHUWLQJ LW LQWR WKH $ PROWHQ DQG WKH PL[WXUH ZDV VWLUUHG ZLWK
HOHFWULFPRWRUGULYHQLPSHOOHUDWDVSHHGRI5307KHSDUWLFOHIHHGUDWHWRWKHPROWHQPHWDOLV
DERXWJPVDQGWKHPL[WXUHZDVVWLUUHGPLQXWHVPRUHDIWHUWKHSDUWLFOHDGGLWLRQ

,QWKHPRXOGFRQILJXUDWLRQLWLVGHVLJQHGWRSURGXFHFDVWLQJVLQRQHRSHUDWLRQ7KHDUUDQJHPHQW
LVVXFKWKDWWKHIDFHVDUHLQWKHVDPHGLUHFWLRQDVGHSLFWHGLQ)LJ
36 International Journal of Engineering Research in Africa Vol. 26

)LJ&HQWULIXJDOFDVWLQJPDFKLQHZLWKDQRSHQHGPRXOGLQZKLFKWKHEXFNHWVDUHIDFLQJWKH
VDPHGLUHFWLRQ

3UHSDUDWLRQRIWHVWVSHFLPHQ
0LFURVWUXFWXUH([DPLQDWLRQ7KHFDVWEXFNHWRIERWKPDWHULDOVXQGHULQYHVWLJDWLRQZHUHVOLFHG
DW WKH PLGGOH SODQ ;; VHH )LJ D  LQWR WZR SDUWV DQG ERWK KDOYHV ZHUH SUHSDUHG IRU
PLFURVWUXFWXUDO H[DPLQDWLRQ DQG KDUGQHVV WHVW 7KH VDPSOHV IRU WKH PLFURVWUXFWXUDO YLHZ ZHUH
SROLVKHG XVLQJ WKH IROORZLQJ JUDGHV RI JULW HPHU\ SDSHUV RI      DQG 
FRQVHFXWLYHO\7KHHPHU\SDSHUSROLVKLQJZDVIROORZHGE\FORWKSROLVKLQJZLWKȝPȝPDQG
ȝP6L&SSDUWLFOHSDVWHV7KHSUHSDUHGVDPSOHVIRUPLFURVWUXFWXUDOH[DPLQDWLRQDUHVKRZQLQ)LJ
7KHSROLVKHGVDPSOHZDVVXEMHFWHGWR/HLFDRSWLFDOPLFURVFRS\IRUWUDQVYHUVHYLHZLQJDVVKRZQE\
WKHDUURZLQ)LJGDQGFDSWXULQJ


)LJ0HWKRGRISUHSDULQJWKHVDPSOHVIRUPLFURVWUXFWXUDOH[DPLQDWLRQDQGKDUGQHVVWHVW
+DUGQHVV 7HVW7KHVHFRQGKDOIRIWKH VDPSOHZDVSUHSDUHGIRU%ULQHOOKDUGQHVVWHVWDQGZDV
RQO\VXEMHFWHGWRSROLVKLQJXVLQJJUDGHVRI JULWHPHU\SDSHUVRIDQG
UHVSHFWLYHO\ 7KH VSHFLPHQV IRU KDUGQHVV WHVW DUH VKRZQ LQ )LJ  7KH SROLVKHG VDPSOH ZDV
VXEMHFWHGWR.JIORDGRI7LQXV2OVHQKDUGQHVVWHVWPDFKLQHWUDQVYHUVHO\DVVKRZQE\WKHGRWV
LQ)LJE
International Journal of Engineering Research in Africa Vol. 26 37


)LJD 6SHFLPHQVIRUPLFURVWUXFWXUDOH[DPLQDWLRQDQGIRUKDUGQHVVWHVWE RIIVHWRIWKHIDFHRI
WKHVSHFLPHQ
+HDW7UHDWPHQW7KHVROXWLRQKHDWWUHDWPHQW 7 LVWKHPRVWZLGHO\XVHGIRUWKHLPSURYHPHQW
RI WKH FRPELQDWLRQ RI VWUHQJWK DQG GXFWLOLW\ $ DOOR\ WHVW VDPSOH ZDV WUHDWHG DFFRUGLQJ WR 7
KHDW WUHDWPHQW VWDQGDUG IRU $ DOOR\ IRU KDUGQHVV VWUHQJWK DQG GXFWLOLW\ HQKDQFHPHQW 7KH
VSHFLPHQZDVKHDWHGWRR&DQGKHOGIRUKRXUVDQGTXHQFKLQJLQDZDWHURIR&WHPSHUDWXUH
DFFRUGLQJWRHDUOLHUVWXGLHV>@$UWLILFLDODJLQJZDVFDUULHGRXWDW R&IRUKRXUVDQGWKH
SURFHVVSURILOHLVVKRZQLV)LJ$6L&S FRPSRVLWHVSHFLPHQZDVKHDWHGWR R&KHOG
IRUKRXUVDQGTXHQFKLQJLQDZDWHURI R&WHPSHUDWXUH7KHDUWLILFLDODJLQJZDVGRQHDW R&
DQGKHOGIRUKRXUV>@7KHKHDWWUHDWPHQWSURFHVVIRU$6L&SLVUHSUHVHQWHGLQ)LJ
4XHQFKLQJZDVGRQHLQDFFRUGDQFHZLWKWKH%$670VWDQGDUGZLWKWKHFRROLQJIURP R&
WR R&DQGWKHTXHQFKLQJGHOD\WLPHZDVOHVVWKDQVHFRQGV7KHVHSUHFDXWLRQPHDVXUHVZHUH
QHFHVVDU\WRSUHYHQWWKHIRUPDWLRQRISUHPDWXUHSUHFLSLWDWH


)LJ6FKHPDWLFRI7+HDW7UHDWPHQWRI$$OOR\SURILOH


)LJ6FKHPDWLFRI7+HDW7UHDWPHQWRI$6L&FRPSRVLWHSURILOH

5HVXOWVDQG'LVFXVVLRQ

&DVWLQJRI3HOWRQEXFNHWE\FHQWULIXJDOSURFHVV
7KHILUVWIHZFDVWLQJVVKRZQWKHVDPHGHIHFWDVWKHRQHVKRZQLQ)LJD7KHGHIHFWZDVFDXVHG
E\WKHFHQWULIXJDOIRUFHHIIHFWRQWKHFDVWEXFNHW7KLVZDVDPDMRUFKDOOHQJHLQWKLVVWXG\6HYHUDO
DWWHPSWVZHUHPDGHE\FKDQJLQJWKHSURFHVVYDULDEOHVEHIRUHDJRRGFDVWZDVPDGH,QFHQWULIXJDO
FDVWLQJ WKHUH LV WKH WHQGHQF\ RI WKH VXUIDFH RI WKH FDVW WRZDUGV WKH FHQWUH RI URWDWLRQ WR IRUP D
SDUDERODRIUHYROXWLRQDVGHSLFWHGLQWKHVFKHPDWLFLQ)LJE
38 International Journal of Engineering Research in Africa Vol. 26


)LJD DGHIHFWHGFDVWFDXVHGE\FHQWULIXJHE VFKHPDWLFRIWKHHIIHFWRIFHQWULIXJHFDVW
7KHFXUYHIRUPHGLVDIXQFWLRQRIWKHVHSDUDPHWHUVWKHURWDWLRQDOVSHHGWKHFDVWJHRPHWU\DQG
SRXULQJDQGPRXOGWHPSHUDWXUHV,QWKLVZRUNWKHGHIHFWZDVFRUUHFWHGVLJQLILFDQWO\E\JHRPHWU\
DQG)LJVKRZVWKHGHIHFWIUHH3HOWRQEXFNHWFDVW



)LJ7KHGHIHFWIUHH3HOWRQEXFNHWFDVW

0LFURVWUXFWXUDOH[DPLQDWLRQ
7KHPLFURJUDSKRIEXFNHWVDQGLVVKRZQLQ)LJ,WZDVREVHUYHGWKDWWKHWZREXFNHWVKDYH
WKHVDPHJUDGLHQWWUHQG+RZHYHUWKHWUHQGLQZDVLQRSSRVLWHGLUHFWLRQRI)RUWKHSXUSRVHRI
WKHRSHUDWLRQDOSHUIRUPDQFHRIWKHEXFNHWHVSHFLDOO\IRUZHDUUHVLVWDQFHEXFNHWDUUDQJHLQ)LJ
LVSUHIHUUHG)LJVDQGVKRZWKHSDWWHUQRIPLFURVWUXFWXUHJUDGLHQWRIWKHDOOR\DQGFRPSRVLWH
UHVSHFWLYHO\XVHGLQEXFNHW


)LJ7KHPLFUJUDSKWKHJUDGLHQWRIFDVWEXFNHWRI$DOOR\
International Journal of Engineering Research in Africa Vol. 26 39


)LJ7KHPLFUJUDSKWKHJUDGLHQWRIFDVWEXFNHWRI$6L&SFRPSRVLWH

(IIHFWRI7KHDWWUHDWPHQWDQGFHQWULIXJDOFDVWLQJWHFKQLTXHRQKDUGQHVV
$ DOOR\ ZKLFK KDV $,6L0J LV ZLGHO\ XVHG LQ HQJLQHHULQJ LQGXVWULHV OLNH
DXWRPRWLYHDHURVSDFHDQGPLOLWDU\DSSOLFDWLRQVIRUKLJKVWUHQJWKSDUWV,WRIIHUVJRRGFRPELQDWLRQ
RIPHFKDQLFDOSURSHUWLHVVXFKDVFDVWDELOLW\VWUHQJWKFRUURVLRQUHVLVWDQFHDQGSUHVVXUHWLJKWQHVVLQ
ERWK WKH SHUPDQHQW PRXOG DQG VDQG FDVW FRQGLWLRQ 'HVSLWH WKHVH DWWULEXWHV LQ PRVW FDVHV $
DOOR\ LV QRW XVHG DVFDVW DV WKH SUHVHQFH RI HXWHFWLF VLOLFRQ FDXVHV LW WR SHUIRUP EHORZ RSWLPDO
YDOXH*HQHUDOO\PHFKDQLFDOSURSHUWLHVRIDOXPLQLXPDOOR\VDQGFRPSRVLWHVDUHUHGXFHGE\FRDUVH
JUDLQ FDYLWLHV DQG QHHGOH VKDSH HXWHFWLF VLOLFRQ 0RGLILFDWLRQ DQG UHILQHPHQW LPSURYH WKH
PHFKDQLFDO SURSHUWLHV RI DOOR\ VXFK DV WHQVLOH VWUHQJWK LPSDFW VWUHQJWK ZHDU UHVLVWDQFH DQG
KDUGQHVV VLJQLILFDQWO\ > @ 5DSLG VROLGLILFDWLRQ YLEUDWLRQ KHDW WUHDWPHQW DQG FKHPLFDO
WUHDWPHQW DUH WKH EDVLF PHWKRGV RI PDQLSXODWLQJ WKH PRUSKRORJ\ RI DQ DOOR\ IRU SURSHUWLHV
HQKDQFHPHQW,QFKHPLFDOWUHDWPHQWVPDOODPRXQWRIVRGLXPLVDGGHGWRWKHPHOWDQGWKLVFKDQJHV
WKH HXWHFWLF VLOLFRQ SKDVH PRUSKRORJ\ IURP FRDUVH DFLFXODU WR ILQH ILEURXV 7KH SURFHVV UHVXOWV LQ
HQKDQFHPHQWRIPHFKDQLFDOSURSHUW\>@
&HQWULIXJDO &DVWLQJ 7KH ODUJH GHQGULWLF FHOOV ODUJH IODNHV RI VLOLFRQ DQG ODUJH LQWHUGHQGULWH
DUP VSDFLQJ RI ĮDOXPLQXP GHQGULWHV WKDW DUH SURGXFHG E\ ORZ VROLGLILFDWLRQ UDWH 7KHVH
PRUSKRORJLFDOIHDWXUHVQHHGWREHUHILQHGDQGPRGLILHGIRUWKHDOOR\WRSRVVHVVEHWWHUPHFKDQLFDO
SURSHUWLHV+LJKVROLGLILFDWLRQUDWHJLYHVVPDOOGHQGULWLFFHOOVVPDOOLQWHUGHQGULWHDUPVSDFLQJDQG
VPDOO IODNHV RI VLOLFRQ DQG PRUSKRORJLFDOO\ FKDQJHG IURP DFLFXODU WR ILEURXV >@ &HQWULIXJDO
FDVWLQJLQIOXHQFHVWKHUDWHRIVROLGLILFDWLRQDQGFRQVHTXHQWO\HQKDQFHVWKHTXDOLW\RIFDVWLQJ
7KHUDWHDWZKLFKFHQWULIXJHDIIHFWVWKHPLFURVWUXFWXUHRIDQDOOR\LVVSHHGRIURWDWLRQGHSHQGHG
6WXGLHVKDYHVKRZQWKDWWKHRSWLPXPFHQWULIXJDOLVEHWZHHQ530>@$WWKHVSHHG
RI530WKHPLFURVWUXFWXUHRIWKHEXFNHWH[SHULHQFHVWKHIROORZLQJWUDQVIRUPDWLRQRIODUJH
SULPDU\VLOLFRQLQWRQHHGOHVKDSHGHXWHFWLFVLOLFRQLQWKHLQQHUORQJQHHGOHVKDSHGHXWHFWLFVLOLFRQ
DUH FRQYHUWHG LQWR ILQH SULPDU\ VLOLFRQ DW WKH RXWHU DQG WKHUH LV WKH IRUPDWLRQ RI ILQH JUDLQ 7KH
WUDQVIRUPDWLRQVDQGWKHKLJKUDWHRIVROLGLILFDWLRQHQKDQFHGWKHKDUGQHVVYDOXHRIERWK$DOOR\
DQG $6L&S FRPSRVLWH 7KLV WUDQVIRUPDWLRQ LV HYLGHQWO\ SURQRXQFHG LQ )LJ  /RQJ
QHHGOHVKDSHGHXWHFWLFVLOLFRQDUHVHHQEURNHQLQWRILQHSULPDU\VLOLFRQDWWKHRXWHURIWKHEXFNHW
ZKLOHDWWKHLQQHUODUJHSULPDU\VLOLFRQDUHEHLQJFRQYHUWHGLQWRQHHGOHVKDSHGHXWHFWLFVLOLFRQ7KH
PD[LPXP KDUGQHVV RI  %51 ZDV UHFRUGHG DW  PP IURP WKH VXUIDFH RI WKH LQQHU SDUW RI WKH
EXFNHGDQG%51ZDVUHFRUGHGDWWKHRXWHUUHJLRQDVVKRZLQ)LJ
40 International Journal of Engineering Research in Africa Vol. 26


)LJ7KHIHDWXUHVRIWKHPLFURJUDSKRIWKHEXFNHWPDGHIURP$DOOR\E\FHQWULIXJDOFDVW
+HDW 7UHDWPHQW 7KH KHDW WUHDWPHQW RI $ FDQ EH FODVVLILHG LQWR WKUHH EDVHG RQ VRDNLQJ
WHPSHUDWXUHV 6RDNLQJ DW KLJK WHPSHUDWXUH RI &> @ VRDNLQJ WHPSHUDWXUH VOLJKWO\ EHORZ
WKH HXWHFWLF WHPSHUDWXUH & >@ DQG VRDNLQJ WHPSHUDWXUH DW & 4XLWH RIWHQ
K\SRHXWHFWLF DQG QHDU HXWHFWLF $O6L DOOR\V DUH DSSOLHG ZKHQ FRUURVLRQ UHVLVWDQFH DQG JRRG
FDVWDELOLW\ DUH QHHGHG DQG ZLWK OLWWOH TXDQWLW\ RI 0J DQG &X IRU KHDW WUHDWPHQW HQKDQFHPHQW ,Q
FHUWDLQKHDWWUHDWPHQWFRQGLWLRQVDVLQWKHFDVH7WUHDWPHQWRI$SUHFLSLWDWLRQRI0J6LDQG
WKDWRIVLOLFRQRFFXU>@7KHPLFURJUDSKRIWKHPLFURVWUXFWXUHH[DPLQDWLRQRI7WUHDWHG$LV
VKRZQLQ)LJ


)LJ2SWLFDOPLFURJUDSKRIDOOR\$DIWHUVROXWLRQWUHDWPHQWDW&IRUKRXUV
7KHKDUGQHVVRIERWKDOOR\DQGFRPSRVLWHVDPSOHVLQFUHDVHGDSSUHFLDEO\DIWHUWKHKHDWWUHDWPHQW
0D[LPXPKDUGQHVV %51DQG%51IRUDOOR\DQGFRPSRVLWHUHVSHFWLYHO\ ZHUHUHFRUGHGDW
DERXWPPIURPWKHLQQHUIDFHLQERWKVDPSOHV/RZHUKDUGQHVVYDOXHVZHUHUHFRUGHGDWPP
IURPWKHLQQHUVXUIDFHLQDOOWKHVDPSOHV7KLVLVGXHWRWKHUDSLGVROLGLILFDWLRQDWWKHLQQHUSHULSKHU\
FDXVHGE\IDVWFRROLQJIDFLOLWDWHGE\WKHPRXOGURWDWLRQ
7KH LQFUHDVH WKH KDUGQHVV REVHUYHG LV GXH WR VXSHUVDWXUDWHG VROLG VROXWLRQ SURGXFWLRQ WKDW
RFFXUUHGGXULQJWKHVRDNLQJRI$DOOR\DW&IRUKRXUV7KLVSURFHVVFDXVHVWKHGLVVROXWLRQ
RIKDUGHQLQJHOHPHQWV 0J6L LQWKHPDWUL[LQWR JOREXODUSULPDU\ Į$OVSKHURLGLVDWLRQRIHXWHFWLF
VLOLFRQDQGFDVWLQJKRPRJHQLVDWLRQ>@)LJVKRZVKDUGQHVVWUHQGVLQWKHVDPSOHV
International Journal of Engineering Research in Africa Vol. 26 41

 
   D        E 
)LJ%ULQHOOPLFURKDUGQHVVSORWIRUD $DOOR\DVFDVWDQGKHDWWUHDWHGDQGE $
6L&SDVFDVWDQGKHDWWUHDWHG
:KHUH $&  DVFDVW $ DOOR\ $ +7  $ DOOR\ KHDW WUHDWHG $&&  $VFDVW $
6L&FRPSRVLWH&+7 $6L&FRPSRVLWHKHDWWUHDWHG
7KH GLVVROXWLRQ RI 0J6L 6SKHURLGLVDWLRQ DQG KRPRJHQLVDWLRQ RI HXWHFWLF VLOLFRQ LQ $
KDSSHQZLWKLQPLQXWHVRIVRDNLQJDW&7KHGLDJUDPRIWKH3VHXGRELQDU\RI$,0J6LSKDVH
LVVKRZQLQ)LJ


)LJ3VHXGRELQDU\RI$,0J6LSKDVHGLDJUDP

<LHOGVWUHQJWK <6 DQG8OWLPDWHWHQVLOHVWUHQJWK 876 SUHGLFWLRQV


7KHVWUHQJWKRI$7DQG$6L&7FDQEHSUHGLFWHGXVLQJWKLVUHODWLRQLQHTXDWLRQ  
>@

[ 9+1 [    


Q
<6          
:KHUH <6  \LHOG VWUHQJWK 9+1 ± 9LFNHUV KDUGQHVV QXPEHU DQG Q  VWUDLQ KDUGHQLQJ H[SRQHQW
 7KH<6DQG876SUHGLFWLRQFXUYHVIRUWKHVDPSOHVDUHVKRZQLQ)LJVDQG
42 International Journal of Engineering Research in Africa Vol. 26

 
D       E 
)LJ<LHOGVWUHQJWKSUHGLFWLRQRID $DVFDVW <6B$&$ DQGKHDWWUHDWHG <6B$&+7 
DQGE $6L&SDVFDVW <6B$& DQGKHDWWUHDWHG <6B&+7 

 
D       E 
)LJ<LHOGVWUHQJWKSUHGLFWLRQRID $DVFDVW <6B$&$ DQG$6L&SDVFDVW <6B$
& DQGE $KHDWWUHDWHG <6B$+7 DQG$6L&SKHDWWUHDWHG <6B&+7 
$JDLQ<6876UDWLRFDQEHSUHGLFWHGLQWHUPVRIQXVLQJWKHH[SUHVVLRQV  DQG  
ª  Q H[S Q º
<6
 ¬ ¼         
876 Q
Q


<6 Q Q
876         
ª  Q H[S Q º
¬ ¼
International Journal of Engineering Research in Africa Vol. 26 43


)LJ876SUHGLFWLRQRIKHDWWUHDWHGD $ 876B$+7 DQG$6L&S 876B&+7 
)URP)LJVLWZDVREVHUYHGWKDWWKH<6DQG876DSSUHFLDWHGJUHDWO\DFURVVWKHVXUIDFH
IRUERWK$DOOR\DQG$6L&SFRPSRVLWHDIWHUKHDWWUHDWPHQW

3URWHFWLYH&RDWLQJRI3HOWRQ%XFNHW
'HVSLWHWKHZHDUDQGFRUURVLRQUHVLVWDQFHRI$DOOR\DQG$6L&SFRPSRVLWHWKH\DUHVWLOO
YHU\ PXFK VXVFHSWLEOH WR VHDZDWHU FRUURVLRQ DQG VLOW HURVLRQ RYHU WLPH )RU EHWWHU RSHUDWLRQ
SHUIRUPDQFHDQGORQJHUOLIHVSDQFRDWLQJWKHLQQHUVXUIDFHRIWKHEXFNHWZLWKWRXJKHUDQGKDUGHQHG
PDWHULDO LV UHFRPPHQGDEOH &RDWLQJ 3HOWRQ EXFNHW ZLWK FHUDPLF LV ZLOO EH HIIHFWLYH GXH WR WKH
SURYLVLRQ RI WKH IROORZLQJ SURWHFWLYH VHUYLFH WR WKH VXUIDFH RI WKH EXFNHW :HDU DQG FRUURVLRQ
SURWHFWLRQLPSLQJHPHQWSURWHFWLRQVLOWHURVLRQSURWHFWLRQDQGVXUIDFHKDUGQHVVLPSURYHPHQW7KLV
VWXG\ UHFRPPHQGV FHUDPLF FRDWLQJ RI $O2 LPSODQWHG )H PLFURJUDLQV DQG PLFURDUF R[LGDWLRQ
0$2 RUSODVPDHOHFWURO\WLFR[LGDWLRQ 3(2 

&RQFOXVLRQ 
'RPHVWLFDWLRQ RI 6+3 WHFKQRORJLHV ZDV QRWHG DV D VLJQLILFDQW ZD\ RI UHOLDEO\ WDFNOLQJ UXUDO
HOHFWULILFDWLRQSUREOHPVLQ66$DQGWKHXVHRI)*0VSURGXFWLRQWHFKQLTXHZDVFRQVLGHUHGYLWDO,Q
HQJLQHHULQJVHFWRUVVXFKDVDHURVSDFHDXWRPRWLYHDQGHQHUJ\)*0VSOD\DYLWDOUROHLQHQVXULQJ
WKDW WKH GHVLUHG DWWULEXWHV RI FRPSRQHQWV DV UHJDUGV WKHLU IXQFWLRQDOLW\ DUH DFKLHYHG 7KH QHHGHG
RSHUDWLRQDOSURSHUWLHVRISDUWVKDYHSXVKHGWKHPDWHULDOHQJLQHHUVDQGVFLHQWLVWVWRGHYHORSGLIIHUHQW
)*0VSURGXFWLRQPHWKRGV7KLVVWXG\WKHUHIRUHH[SORLWVWKH)*0VSURGXFWLRQPHWKRGWRHQKDQFH
ORFDOO\VRXUFHGDOXPLQLXPDOOR\IRU3HOWRQK\GURWXUELQHEXFNHWSURGXFWLRQ+RZHYHUWKHFRVWRI
SURGXFWLRQFRPSOH[LW\RIWHFKQLTXHDQGPDVVSURGXFWLRQRISDUWVDUHVRPHRIWKHPDMRUEDUULHUVWR
WKHDSSOLFDWLRQRIWKHVHIDEULFDWLRQWHFKQLTXHV7KLVQRWZLWKVWDQGLQJFHQWULIXJDOFDVWLQJWHFKQLTXH
ZDV LGHQWLILHG DV D VLPSOH DQG FRVWHIIHFWLYH SURFHVV WKDW HQKDQFHV WKH PHFKDQLFDO SURSHUWLHV RI
DOXPLQLXPDOOR\VDQGFRPSRVLWHV7KLVVWXG\WKHQFRQFOXGHVWKDW
L 7RJHQXLQHO\WXUQDURXQGWKHSHUHQQLDOSRZHULVVXHVLQ66$SRZHUVKRXOGEHJHQHUDWHGIURP
WKH DEXQGDQW VPDOO K\GUR SRWHQWLDOV ZLWK WKH DSSOLFDWLRQ RI LQGLJHQRXV WHFKQRORJ\ DQG PDGH
IURPORFDOO\VRXUFHGPDWHULDOV
LL 8VH RI FHQWULIXJDO FDVWLQJ PHWKRG DQG KHDW WUHDWPHQW LPSURYHG WKH PHFKDQLFDO SURSHUWLHV RI
$ DOOR\ DQG $6L&S FRPSRVLWH PDNLQJ WKHP PRUH VXLWDEOH IRU 3HOWRQ EXFNHW
SURGXFWLRQ
LLL +HDWWUHDWHG$DOOR\DQG$6L&SFRPSRVLWHZLOOEHVXLWDEOHIRUWXUELQHPDWHULDOVIRU
ZDWHUVWRUDJHWXUELQHV\VWHP7KLVLVGXHWRPLQLPDORIVLOWLQWKHVWRUHGZDWHUDQGWKH
HQKDQFHGFRUURVLRQDQGZHDUUHVLVWDQFHSURSHUW\RIWKHPDWHULDOV
LY 7RIXUWKHULPSURYHWKHOLIHVSDQRIEXFNHWKDUGVXUIDFHFRDWLQJVKRXOGEHDSSOLHG
44 International Journal of Engineering Research in Africa Vol. 26

$FNQRZOHGJHPHQW
7KH DXWKRUV KHUHE\ DFNQRZOHGJH WKH &HQWUH IRU (QJLQHHULQJ 3RVWJUDGXDWH 6WXGLHV
&(36 +9'&6PDUWJULG&HQWUHRIWKH8QLYHUVLW\RI.ZD=XOX1DWDO

5HIHUHQFHV
>@ %(73     +\GUDXOLF 7XUELQHV $YDLODEOH
KWWSZZZEHWSQHWSHOWRQZKHHOWXUELQH
>@ 3 +< %U\DQ 'HVLJQ RI D /RZ +HDG 3LFR +\GUR 7XUELQH IRU 5XUDO (OHFWULILFDWLRQ LQ
&DPHURRQ (QJLQHHULQJ DQG ,QWHUQDWLRQDO 'HYHORSPHQW 7KH 8QLYHUVLW\ RI *XHOSK *XHOSK
2QWDULR&DQDGD
>@ : 6 (EKRWD $ & (ORND(ERND DQG ) / ,QDPEDR (QHUJ\ VXVWDLQDELOLW\ WKURXJK
GRPHVWLFDWLRQ RI HQHUJ\ WHFKQRORJLHV LQ WKLUG ZRUOG FRXQWULHV LQ $IULFD LQ ,QGXVWULDO DQG
&RPPHUFLDO 8VH RI (QHUJ\ ,&8(   ,QWHUQDWLRQDO &RQIHUHQFH RQ WKH ³(QHUJ\ HIILFLHQF\ LQ
EXLOGLQJVSS
>@ +/LX'0DVHUDDQG/(VVHU:RUOG+\GURSRZHU'HYHORSPHQW5HSRUW8QLWHG
1DWLRQ ,QGXVWULDO 'HYHORSPHQW 2UJDQLVDWLRQ 81,'2  DQG ,QWHUWLRQDO &HQWUH RQ 6PDOO
+\GURSRZHU ,&6+3 
>@ */RLFHDQG0,JQDWLR(IILFLHQF\,PSURYHPHQWRI3HOWRQ:KHHODQG&URVVIORZ7XUELQHV
LQ 0LFUR+\GUR 3RZHU 3ODQWV &DVH 6WXG\ ,QWHUQDWLRQDO -RXUQDO RI (QJLQHHULQJ DQG &RPSXWHU
6FLHQFHYROSS
>@ % :LOOLDP 6 9DVX DQG 6 0DQMRW *UHHQ 0HFKDWURQLFV 3URMHFW 3HOWRQ :KHHO 'ULYHQ
0LFUR+\GUR3ODQW0HFKDQLFDO(QJLQHHULQJ8QLYHUVLW\RI2WWDZD
>@ 5 1 0ELX 6 0 0DUDQJD DQG + 1GLULWX 3HUIRUPDQFH RI $OXPLQLXP $ $OOR\
%DVHG %XFNHWV 7RZDUGV %HQGLQJ )RUFHV RQ 3HOWRQ 7XUELQHV LQ 6XVWDLQDEOH 5HVHDUFK DQG
,QQRYDWLRQ 65, &RQIHUHQFH1DLUREL.HQ\DSS
>@ , $ . 0 .KDELUXO % 6DKQHZD] DQG $ & )DURRTXH $GYDQFHG &RPSRVLWH 3HOWRQ
:KHHO 'HVLJQ DQG 6WXG\ LWV 3HUIRUPDQFH IRU 3LFR0LFUR +\GUR 3RZHU 3ODQW $SSOLFDWLRQ
,QWHUQDWLRQDO-RXUQDORI(QJLQHHULQJDQG,QQRYDWLYH7HFKQRORJ\ ,-(,7 YROSS
>@ 1 , 5 1DYD DQG 7 6 3UDVDG 'HVLJQ DQG 6WDWLF $QDO\VLV RI 3HOWRQ 7XUELQH %XFNHW 
,QWHUQDWLRQDO-RXUQDORI6FLHQFH7HFKQRORJ\DQG0DQDJHPHQWYROSS
>@ ' 9 .KHUD DQG 5 6 &KDGKDZRUN 6LOW (URVLRQ 7URXEOH IRU 7XUELQHV ,QWHUQDWLRQDO
:DWHU3RZHUDQG'DP&RQVWUXFWLRQYROSS
>@ 0.3DGK\DQG536DLQL(IIHFWRI6L]HDQG&RQFHQWUDWLRQRI6LOW3DUWLFOHVRQ(URVLRQ
RI3HOWRQ7XUELQH%XFNHWV(QHUJ\YROSS
>@ $1HJL569LUHQGUDDQG666DPDQW(IIHFWRI&U2DQG7L1&RDWLQJVRQ&U1L
7XUELQH %ODGH 0DWHULDO E\ +92) 3URFHVV $ 5HYLHZ ,QWHUQDWLRQDO -RXUQDO RI :DWHU  +\GUR
&RQVWUXFWLRQV±,-:+&YRO
>@ 75%DMUDFKDU\D%$FKDU\D-&%536DLQLDQG2*'DKOKDXJ6DQG(URVLRQRI
3HOWRQ7XUELQH1R]]OHVDQG%XFNHWV$&DVH6WXG\RI&KLOLPH+\GURSRZHU3ODQW:HDUYRO
SS
>@ $60 &RUURVLRQ 8QGHUVWDQGLQJ WKH %DVLFV $60 ,QWHUQDWLRQDO 0DWHULDOV 3DUN 2KLR
$PHULFDQ7HFKQLFDO3XEOLVKHUV/WG
International Journal of Engineering Research in Africa Vol. 26 45

>@ * 9 $NLPRY 7KHRU\ DQG 0HWKRGV RI 6WXG\LQJ 0HWDO &RUURVLRQ 0RVFRZ  $1 6665

>@ 966LQ\DYVNLLDQG9'.DOLQLQ0DULQH&RUURVLRQDQG3URWHFWLRQRI$OXPLQXP$OOR\V
$FFRUGLQJWRWKHLU&RPSRVLWLRQDQG6WUXFWXUH3URWHFWLRQRI0HWDOVYROSS
>@ 966LQ\DYVNLL9'9DO¶NRYDQG9'.DOLQLQ&RUURVLRQDQG3URWHFWLRQRI$OXPLQXP
$OOR\V0RVFRZ0HWDOOXUJL\D
>@ 0 NRUUR]L\D +DQGERRN RQ 0DULQH &RUURVLRQ 6KXPDNKHU 00 HG 0RVFRZ
0HWDOOXUJL\D
>@ +3*RGDUG7KH&RUURVLRQRI/LJKW0HWDOV$OXPLQXP-RKQ:LOH\,QFYRO</6S

>@ +7RUDELDQ-33DWKDNDQG617LZDUL:HDU&KDUDFWHULVWLFVRI$O6L$OOR\V:HDU
YROSS
>@ 3 . 5RKDWJL DQG % & 3DL (IIHFW RI 0LFURVWUXFWXUH DQG 0HFKDQLFDO 3URSHUWLHV RQ WKH
6HL]XUH5HVLVWDQFHRI&DVW$OXPLQLXP$OOR\V:HDUYROSS
>@ $ & 9LHLUD 3 ' 6HTXHLUD - 5 *RPHV DQG / $ 5RFKD 'U\ 6OLGLQJ :HDU RI $O
$OOR\6L&S)XQFWLRQDOO\*UDGHG&RPSRVLWHV,QIOXHQFHRI3URFHVVLQJ&RQGLWLRQV:HDUYRO
SS±
>@ &DVWLQJ0HWDOKDQGERRNWKHGYRO$60,QWHUQDWLRQDO
>@ *&KLULWD,6WHIDQHVFX'&UX]'6RDUHVDQG)66LOYD6HQVLWLYLW\RI'LIIHUHQW$O±6L
$OOR\VWR&HQWULIXJDO&DVWLQJ(IIHFW0DWHULDOVDQG'HVLJQYROSS
>@ 6$$-    'LH 6WHHO *UDGH 2+16 $YDLODEOH
KWWSVDDMVWHHOFRP"SDJHBLG 
>@ ' / =KDQJ / =KHQJ DQG ' + 6W-RKQ (IIHFW RI 6ROXWLRQ 7UHDWPHQW 7HPSHUDWXUH RQ
7HQVLOH 3URSHUWLHV RI $,6L ZW  $OOR\ 0DWHULDOV 6FLHQFH DQG 7HFKQRORJ\ YRO  SS

>@ 66KLYNXPDU65LFFL%6WHHQKRIIDQG'$SHOLDQ$Q([SHULPHQWDO6WXG\WR2SWLPL]H
WKH+HDW7UHDWPHQWRI$DOOR\$PHULFDQ)RXQGU\6RFLHW\7UDQVDFWLRQYROSS

>@ 0 'URX]\ 6 -DFRE DQG 0 5LFKDUG ,QWHUSUHWDWLRQ RI 7HQVLOH 5HVXOWV E\ 0HDQV RI
4XDOLW\,QGH[DQG3UREDEOH<LHOG6WUHQJWK$)6,QWHUQDWLRQDO&DVW0HWDOV5HVHDUFK-RXUQDOYRO
SS
>@ .*%DVDYDNXPDU3*0XNXQGDDQG0&KDNUDERUWK\,PSDFW7RXJKQHVVLQ$O6L
DQG $O6L&X &DVW $OOR\V 3DUW  , (IIHFW RI 3URFHVV 9DULDEOHV $QG 0LFURVWUXFWXUH
,QWHUQDWLRQDO-RXUQDORI,PSDFW(QJLQHHULQJYROSS
>@ 70&KDQGUDVKHNKDUDLDKDQG6$.RUL(IIHFWRI*UDLQ5HILQHPHQWDQG0RGLILFDWLRQRQ
WKH'U\6OLGLQJ:HDU%HKDYLRXURI(XWHFWLF$O6L$OOR\V7ULERORJ\,QWHUQDWLRQDOYROSS

>@ ) + 3 -XDQ +HDW 7UHDWPHQW DQG 3UHFLSLWDWLRQ LQ $ $OXPLQXP $OOR\ 'RFWRU RI
3KLORVRSK\ 0LQLQJ 0HWDOV DQG 0DWHULDOV (QJLQHHULQJ 0F*LOO 8QLYHUVLW\ 0RQWUHDO &DQDGD

>@ / +HXVOHU DQG : 6FKQHLGHU 5HFHQW ,QYHVWLJDWLRQV RI ,QIOXHQFH RI 3 RQ 1D DQG 6U
0RGLILFDWLRQRI$O6L$OOR\V$PHULFDQ)RXQGU\6RFLHW\7UDQVDFWLRQYROSS
46 International Journal of Engineering Research in Africa Vol. 26

>@ % & D - ( *UX]OHVNL 0HFKDQLFDO 3URSHUWLHV RI $ $OOR\V 0RGLILHG ZLWK 3XUH
6WURQWLXP$PHULFDQ)RXQGU\6RFLHW\7UDQVDFWLRQSS
>@ % 3 9LNUDPNXPDU ,QYHVWLJDWLRQV RQ WKH 3URSHUWLHV RI $O6L $OOR\ 6\QWKHVL]HG %\
&HQWULIXJDO&DVWLQJ3URFHVV0HWDOOXUJLFDO(QJLQHHULQJ*DQSDW8QLLYHUVLLW\.KHUYD,QGLD
>@ $65DR670DKDQWHVKDQG656KULNDQWKD8QGHUVWDQGLQJ0HOW)ORZ%HKDYLRUIRU
$O6L $OOR\V 3URFHVVHG 7KURXJK 9HUWLFDO &HQWULIXJDO &DVWLQJ 0DWHULDOV DQG 0DQXIDFWXULQJ
3URFHVVHVYROSS
>@ 0 ,VKDN $ $PLU DQG $ +DGL (IIHFW RI 6ROXWLRQ 7UHDWPHQW 7HPSHUDWXUH RQ
0LFURVWUXFWXUH DQG 0HFKDQLFDO 3URSHUWLHV RI $ $OOR\ SUHVHQWHG DW WKH ,QWHUQDWLRQDO
&RQIHUHQFH RQ 0HFKDQLFDO (QJLQHHULQJ 5HVHDUFK ,&0(5  %XNLW *DPEDQJ 5HVRUW &LW\
.XDQWDQ3DKDQJ0DOD\VLD
>@ % $ 'HZKLUVW 2SWLPL]DWLRQ RI WKH +HDW 7UHDWPHQW RI 6HPL 6ROLG 3URFHVVHG $
$OXPLQXP$OOR\0DVWHUV:RUFHVWHU3RO\WHFKQLF,QVWLWXWH
>@ 05RVVRDQG*0$FWLV2SWLPL]DWLRQRI+HDW7UHDWPHQW&\FOHVIRU $XWRPRWLYH3DUWV
3URGXFHG%\5KHRFDVWLQJ3URFHVV6ROLG6WDWH3KHQRPYROSS
>@ : 6 0LOOHU / =KXDQJ - %RWWHPD $ - :LWWHEURRG 3 'H 6PHW $ +DV]OHU HW DO
5HFHQW 'HYHORSPHQW LQ $OXPLQLXP $OOR\V IRU WKH $XWRPRWLYH ,QGXVWU\ 0DWHULDO 6FLHQFH
(QJLQHHULQJ$YROSS


CHAPTER 9: ENHANCING THE WEAR AND CORROSION
RESISTANCE OF A PELTON TURBINE BUCKET SURFACE BY
CENTRIFUGAL CASTING TECHNIQUE AND HEAT TREATMENT

W. S. Ebhota and F. L. Inambao, "Enhancing the wear and corrosion resistance of a Pelton
turbine bucket surface by centrifugal casting technique and heat treatment," Australian
Journal of Mechanical Engineering, 2016. (Under review.)

115
Enhancing the Wear and Corrosion Resistance of a Pelton Turbine Bucket Surface
by Centrifugal Casting Technique and Heat Treatment

Williams S. Ebhotaa and Freddie L. Inambaob


a, b
Discipline of Mechanical Engineering, Howard College, University of KwaZulu-Natal,
Durban, South Africa.
Correspondence email: [email protected]

Abstract–This study examines the possibility of fabricating a complex, non-cylindrical


shaped Pelton turbine bucket by centrifugal casting technique. The functionally graded
aluminium A356 alloy and A356-10%SiCp composite produced were characterised for hydro
turbine bucket application. Oil Hardening Non-Shrinking Die Steel (OHNS) steel was
selected for the permanent mould material, machined with CNC and heat treated to a hardness
of 432 BHN. Aluminium alloys A390 and A390-5%Mg were considered as the Pelton
materials, cast and characterised. Gravity casting of A390 and A390-5%Mg were done for
comparison purposes. For detailed investigation, a cylindrical shape cast of A390-5%Mg was
fabricated. The effects of the casting method and heat treatment on the mechanical properties
and corrosion resistance of A390 and A390-5%Mg alloys were investigated. A hardness of
150 BHN (maximum) was recorded near the inner surface of the bucket and 157 BHN
(maximum) was recorded in the inner periphery of the cylindrical cast. From the corrosion
test, it was observed that A360-5%Mg by gravity casting shows higher corrosion resistance
than the base alloy A390, and the specimen from the inner zone of the circular cast shows a
higher corrosion resistance than the specimen from the outer periphery.

Keywords: A360-5%Mg alloy; Centrifugal casting technique; Electrochemical corrosion test;


T6-heat treatment; Pelton turbine bucket.

9.1 Introduction

Functionally Graded Materials (FGMs) are a class of composite materials that have unique
properties as a consequence of the gradual transition of the constituent materials. This group
of knowledge-based materials occurs in nature such as bone and teeth [1, 2]. The concept of
FGM was modelled from nature in the quest of solving engineering problems [3]. Most
metals in their pure nature have little significance in engineering application as their
properties sometimes conflict with what is required of them. For instance, a part may require
hardness and ductility for proper functioning in a given working environment. Naturally, such
material is hard to find. This kind of scenario has driven scientists and the engineers to
116
develop various material fabrication processes. These processes are used to combine different
elements or compounds in order to explore the comparative advantages of the individual
elements or compounds.

In the case of aluminium and its alloys, microstructures are modified chemically or
mechanically. The properties of a material are defined by its microstructure characteristics. In
chemical modification, certain elements or chemicals are added to the matrix depending on
the attribute required from the material. The grain size distribution, primary silicon (Si) and
morphology of the microstructure are mainly responsible for the properties of hypereutectic
Al-Si-Mg alloys. However, the mechanical properties are affected by the presence of coarse
massive irregular or star shaped primary Si which are usually associated with typical casting
methods.

The centrifugal casting process generates radial forces that segregate composite materials
including the matrix into zones with the denser components farthest away from the axis of
rotation. In addition to the centrifugal effect, the rotation of the mould after pouring facilitates
rapid cooling and solidification. In the centrifugal casting of ceramic particle reinforced
aluminium matrix, two distinct regions are created: a particle-enriched zone and a particle-
depleted zone. However, the meeting point of this segregation is in a gradual transition, not
sharp. In the case of SiC in an aluminium matrix, experiments have shown that SiC will
segregate to the outer periphery of the cast [4, 5]. The particle-enriched zone thickness is
reduced by the increase in rotation speed and pouring temperature.

In a study, the hypereutectic aluminium alloy was physically modified with intensive melt
shearing while solidifying and the effect on the microstructure was examined [6]. The results
revealed that the shearing greatly refined the primary silicon with heat treatment playing a
significant role. 660 0C was recorded as the optimum temperature for Al-20wt%Si alloy Si
particles refinement. A centrifugal in-situ process was used to fabricate an Al-Al2Cu FGM
ring from Al-3%Cu in a study which reSRUWHG WKH IROORZLQJ ILQGLQJV WKH Į-Al particles
drifted to the outer periphery of the ring; the presence of Cu in the ring was massive in the
inner part; the hardness of the Al2Cu FGM ring increased towards the inner region; and the
specimen hardness increased tremendously after heat treatment [7]. This occurrence suggests
WKDWWKHĮ-Al particle is denser than Cu.

An investigative work was conducted on the different aluminium matrices reinforcing


particles of B4C, SiC, graphite hybrid, primary silicon, Al3Ni and Mg2Si produced by a

117
centrifugation process. The study observed that reinforcement density and size are the
parameters that affect the microstructure gradient. Denser SiC and Al3Ni particles were
observed close to the outer surface while less dense particles of graphite, primary silicon and
Mg2Si were found close to the inner surface. B4C particles were more frequently distributed
around the matrix than others because it has the closest density to the aluminium matrix.
Mechanical stir and electromagnetic stir casting techniques were used to fabricate A356-SiC
metal matrix composites with varying weight proportions of SiC particles. The study
investigated macrostructure, microstructure and mechanical properties of the castings and
observed that the trend of mechanical properties improvement corresponds to the trend in the
increase of reinforcement particles in all cases, and a lesser number of the void was produced
by electromagnetic stir casting than stir casting. K. Patel, H. Patel and F. Patel examined the
effect of the rotation speed of a horizontal centrifugal casting process on the tribological and
hardness properties of a hyper-eutectic (Al–17Si) alloy [8]. According to the study, hardness
and wear rate followed the same trend – their values increased toward the outer periphery; the
primary silicon was refined by the increase in the spinning speed from coarse shape to fine
shape; and 700 RPM was considered to be the optimal mould rotation speed at which the wear
rate at the outer periphery was minimised.

9.1.1 Pelton turbine material and fabrication

The turbine bucket is basically designed for aerodynamics, strength, wear and corrosion
resistance, and cavitation attributes. In a Pelton turbine, nozzle and bucket are severely
affected by silt erosion and high velocity jet water. Stainless steels SS(16Cr-5Ni), SS(13Cr-
4Ni), SS(13Cr-Ni) etc. are the commonest materials used for hydro turbines and water pumps
because of their mechanical performance attributes [9]. However, these materials are
expensive, complex to formulate, require huge energy to cast, are not erosive wear resistant,
and are comparatively difficult to machine and weld. The manufacturing infrastructure in
most countries in sub-Saharan Africa is inadequate to sufficiently support stainless steel
production and working with stainless steel. This has made the production of hydro turbines
blades out of reach in the region despite the need to generate more electricity. Aluminium
based materials have reasonable corrosion wear resistance naturally that could be improved
through various production and modification processes.

This study aimed to cast an irregularly shaped component, a Pelton turbine bucket, by vertical
centrifugal casting technique with A390 and A390-5%Mg as bucket materials. Previous

118
studies consulted regarding the centrifugal casting process have considered perfect cylindrical
bodies in their investigations. This study hypothetically identifies the successful designing
and fabrication of a permanent mould as the most important outcome in this research work.

9.2 Experimental method

9.2.1 Fabrication of a permanent mould for a Pelton turbine bucket

The fabrication of a Pelton turbine bucket was divided into two stages: production of a
permanent mould and centrifugal casting of the Pelton bucket. The CAD model of the bucket
is shown in Figure 9.1 and was designed for a capacity of 18.45 kW turbine power.

Figure 9.1: The design parameters of a bucket

9.2.2 Production of the mould

Solidworks software was used for the mould design and generation of IGES files of the mould
components for CNC machining application. The mould parts were machined according to
the specifications stated in the IGES files. Figures 9.2(a) and 9.2(b) show the exploded
assembly of the mould as designed and as fabricated respectively.

119
Figure 9.2: a) Exploded view of Pelton bucket mould assembly as designed; b) Exploded view of Pelton
bucket mould assembly as fabricated

9.2.3 Mould material

Oil Hardening Non-Shrinking Die Steel (OHNS) was selected as the material for the mould
production. The OHNS chemical composition is shown in Table 9.1. OHNS steel is a reliable
material for gauging, blanking and cutting tools as well as for hardness and elevated
temperature performance [10]. The CNC machined components of the mould were heat
treated as follows: 800 oC was used as hardening temperature and 432 BHN was recorded
after the heat treatment. A photograph of the manufactured components for the Pelton bucket
mould is shown Figure 9.3.

Table 9.1: OHNS material chemical composition

Element C Mn Cr W V
% 0.95 1.1 0.6 0.6 0.2

Figure 9.3: The manufactured mould components for Pelton bucket


120
9.2.4 A390-aluminium alloy formation

The chemical composition of A390 aluminium alloy is contained in Table 9.2. A calculated
kilogramme of the commercial A390 was charged into the induction furnace. The alloy was
processed in clay graphite crucibles. Degassing of the molten metal to prevent hydrogen
entrapment was done at 720 oC by rotary impeller degassing (RID) machine, shown in Figure
9.4. The RID set parameters were: rotor speed - 500 rpm, gas (Nitrogen) flow rate - 0.4 m3/h
and refining time - 15 min, in accordance with previous studies [11]. The rotary shaft was
placed about 50 mm from the centreline in order to avoid vortex formation. The molten metal
was poured into a circular mould rotating at a constant speed of 1200 rpm and held at this
speed for 5 minutes before it was stopped.

Figure 9.4: Degassing of the molten metal with RID machine

9.2.5 A390-5%Mg aluminium alloy formation

Commercially available A390 alloy was used as the raw material for the production of A390-
5%Mg ingots. For the A390-5%Mg ingot preparation, 5 %W of pure magnesium (Mg) was
added to the molten metal of A390 alloy at 750 oC, which is about 100 oC above A390
melting point temperature [12]. The ingot was processed in clay graphite crucibles and
degassing of the molten metal to prevent hydrogen entrapment was done by adding
hexachloroethane at 750 oC. The chemical composition of A390-5%Mg ingot as analysed by
spark emission spectrometer is contained in Table 9.2.

Table 9.2: Elemental composition of A390 and A390-5%Mg

Alloy Al Si Cu Mg Fe Mn Zn Ti
A390 77.10 17.00 4.50 0.60 0.40 0.10 0.10 0.20
A390-5%Mg 74.03 16.20 4.30 4.80 0.37 0.06 0.07 0.17

121
The A390-5%Mg ingot was charged into the furnace with the addition of 1 Kg of pure Mg to
account for the loss due to oxidation. The molten A390-5%Mg was poured at 750 0C into the
Pelton turbine bucket mould that was preheated to 300 0C and spinning at a speed of 1200
rpm. The rotation continued for 5 minutes after pouring and Figure 9.5 shows the vertical
centrifugal casting machine used.

Figure 9.5: Vertical centrifugal casting machine: a) Unloaded centrifugal machine; b) Centrifugal
machine with circular mould and; c) Centrifugal machine ready for pouring

The schematic diagram in Figure 9.6 depicts the arrangement of the buckets in the mould and
the direction of rotation. The face of one of the buckets is turned away from the centre of
rotation while the other faces the centre of rotation.

Figure 9.6: The arrangement of the buckets in the mould

Apart from the bucket mould, circular and rectangular moulds were also prepared. A390-
5%Mg molten metal was poured into the circular mould at rotational speed of 1200 rpm while
the rectangular mould was filled with A390-5%Mg alloy gravity casting. The moulds were
pre-heated to 300 0C and the circular mould rotated for 5 minutes after pouring. The castings
made are shown in Figure 9.7.

122
Figure 9.7: Castings from different casting techniques: a) Pelton Turbine bucket cast by centrifugal
casting method; b) Cylindrical from circular casting mould cast by centrifugal casting method; c)
Castings made by gravity casting method.

9.2.6 Electrochemical corrosion test

A CH Instrument 680 Amp Booster laboratory workstation was used to carry out
electrochemical corrosion tests. The setup is shown in Figure 9.8 and consists of three
standard electrodes in a Pyrex glass cell; a platinum counter electrode; saturated calomel
electrode as a reference electrode; and working electrode (specimen). 3.5 % sodium chloride
(NaCl) solution was used as the corrodent. Potentiodynamic current-potential curves were
obtained from specimens’ polarisation into cathode (-) and anode (+) as regards the open
circuit potential (OCP) and scanned at 0.05 V/s. Electrochemical Impedance Spectroscopy
(EIS) measurements at the calculated OCP in 1200 seconds were carried out at frequency
range 0.01 Hz-100 kHz at a small amplitude AC signal (10 mV). Rectangular specimens of
dimension 25 mm x 25 mm x 2 mm were prepared based on the standard metallographic
process: polished with grit emery papers of the following grades 80, 100, 320, 400, 600 and
1000 consecutively and washed with distilled water [13]. This was followed by whirl cloth
SROLVKLQJZLWKȝPȝPDQGȝP6L&SDUWLFOHSDVWHFRQVHFXWLYHO\ZDVKHGLQDFHWRQHDQG
rinsed with distilled water.

Figure 9.8: The setup of the electrochemical corrosion laboratory workstation (CH Instrument 680 Amp
Booster)

123
9.2.7 Specimen preparation

The test samples were prepared from A390-5%Mg aluminium alloy. The bucket was sliced at
the centre into two specimens, A and B (Figure 9.9) and then their surfaces were prepared for
microstructure examination and hardness testing respectively.

Figure 9.9: Preparing microstructural and hardness specimens

Three specimens (C, D and E) were cut from the cylindrical cast as shown in Figure 9.10.
Specimen C and D were prepared for microstructure examination and hardness testing
respectively.

Figure 9.10: Schematic of how the specimens were cut from the cylindrical casting

The electrochemical corrosion test specimens, E1, E2 and E3, were produced from specimen E
as depicted in Figure 9.11. Specimens F and G were cut from the A390 cylindrical cast alloy
in the same way as represented in Figure 9.10. The specimens were prepared for
microstructure examination and hardness testing respectively. Specimens H and I were
prepared from gravity casting of A390-5%Mg microstructure examination and hardness
testing respectively.

Figure 9.11: Specimens for electrochemical test

124
The specimens for the microstructural view were prepared by polishing the surface of the
specimens with grit emery papers of 80, 100, 320, 400, 600 and 1000 grades consecutively
aQGZDVKLQJZLWKGLVWLOOHGZDWHU7KLVZDVIROORZHGE\ZKLUOFORWKSROLVKLQJZLWKȝPȝP
DQGȝP6L&SDUWLFOHSDVWHFRQVHFXWLYHO\DFHWRQHZDVKLQJDQGULQVLQJZLWKGLVWLOOHGZDWHU

9.2.8 Hardness test

A Tinus Olsen hardness test machine with 2.5 mm diameter indenter ball was used to measure
the macro-hardness of the different specimens in terms of the Brinell Hardness Number
(BHN) scale under a load of 62.5 Kgf for 20 seconds. The samples for hardness testing were
polished with grit emery papers of 80, 100, 320, 400, 600 and 1000 grades consecutively and
washed with distilled water. The offset of the bucket specimen surface prepared for hardness
test and the points where the readings were taken is depicted in Figure 9.12.

Figure 9.12: Bucket test samples

9.2.9 Heat treatment

Heat treatment was carried out on specimens B, D, G and I and were given the same heat
treatment as represented in the diagram in Figure 9.13. A temperature of 495 oC was used for
solutionizing and held for 8 hours followed by quenching with 60 oC hot water. Artificial
ageing was done at 175 oC and held for 8 hours.

Figure 9.13: Schematic of T6-Heat Treatment profile of A390 and A390-5%Mg

125
9.3 Theoretical background

In the vertical centrifugal casting process, a particle moving in a molten metal is under the
influence of four forces: gravity, FG; drag force (viscosity effect), FD; centrifugal force
(spinning of the mould), FC; and Van der Waal forces repulsive force (solid-liquid interface
movement), FL.

The particle movement is controlled by the net resultant force Fnet:

Fnet FC – FD – FL (9.1)

7KHIRUFHEDODQFHH[SUHVVLRQZKHQIOXLGIORZLVODPLQDU 5H”  DVVXPSWLRQ LV

4 3 S R 3 U P d 2 r dt 4 3 S R 2 U P  U m Z 2 r  6 S R P dr dt (9.2)

Where R - particle radius; g - gravitational acceleration; μ - PHOW YLVFRVLW\ ǻȡ  ȡp – ȡm -


GHQVLW\GLIIHUHQFHDQGȡp DQGȡm particle and molten metal densities respectively; Ȧ- angular
velocity and; r - particle position.

3
d 2x 4 §D · dx
mp 2 U P  U m S ¨ p ¸ Gg  3SP D p (9.3)
dt 3 © 2 ¹ dt

The direction of the movement of particles is due to centrifugal force, determined by the
relative values of the densities; particles are segregated to the oXWHUSHULSKHU\RIWKHFDVWLIȡp
!ȡm and vice versa.

The ratio of the centrifugal force to gravity, G is defined as:

4S 2 N 2
G r (9.4)
g

Where dx/dt - velocity; d2x/dt2 - acceleration; m - mass; g - gravitational acceleration; Dp -


particle diameter; r - circular mould diameter (m); N - velocity of mould rotation and; μ -
viscosity (m2/s).

The centripetal acceleration, ap, of the reinforcement particle is derived from equations (3) and
(4):

3
d 2x 4 §D ·
mp 2 U P  U m S ¨ p ¸ 4S 2 N 2 r (9.5)
dt 3 © 2 ¹

126
U P  Um
ap 4S 2 N 2 r (9.6)
Up

9.4 Result and discussion

9.4.1 Microstructure

The microstructural examination of the centrifugal casting of A390 was divided into three
zones; the inner zone, Figure 9.14(a-b); middle zone, Figure 9.14(c-d); and outer zone (Figure
9.14(e-f)). It was observed that the highest volume of the distribution of fine Si particles of an
average size of 5-15 μm was observed at the outer periphery and few at the mid zone.
+RZHYHUWKHIRUPDWLRQRIODUJHIODNHVRIĮ-Al dendrites and bigger Si particles of the average
of 25 μm to 35 μm were seen in the inner zone.

Figure 9.14: Micrographs of centrifugally cast aluminium A390 alloy, showing the trend of gradient

The micrographs of As-Cast A390-5%Mg alloys fabricated by gravity and centrifugal casting
methods are shown in Figure 9.14. Figures 9.15(a) and 9.15(b-h) are the micrographs of
A390-5%Mg alloys fabricated by gravity and centrifugal casting methods respectively. The
micrographs in Figure 9.15(b-h) represent the gradient of the microstructure. As can be seen
in the micrographs, there is a difference in the microstructure morphology between gravity
cast and centrifugal cast alloys. In Figure 9.15(a), large flakes of silicon, coarse Mg2Si, large
GHQGULWLF FHOOV DQG ODUJH Į-aluminium dendrites are seen. In the centrifugal casting alloy
micrographs, a fibrous form of silicon is seen in the outer periphery (Figure 9.15(h)),
followed by fine Si particles toward the inner surface. In the inner surface, there are a lot of
coarse Mg2Si surrounding Si and also standing individually, polygon primary silicon and
ODUJHĮ-aluminium dendrites segregation.

127
Figure 9.15: Optical micrographs of a) A390-5%Mg by gravity; (b-g) Gradient of A390-5%Mg by
centrifugal casting, taken at 15 mm intervals with (g) and (b) at 65 mm and 145 mm from the centre
rotation respectively

A similar gradient trend, as represented in Figure 9.16, was found in the bucket specimens.
However, the gradient direction of the two specimens is in opposite directions. It was
observed that bucket 1 has a fibrous silicon at the inner surface periphery and coarse Mg2Si,
DQG ODUJH Į-aluminium dendrites at the outer surface. But for bucket 2, the reverse was the
case (Figures 9.6, 9.7 and 9.9).

Figure 9.16: Optical micrograph showing the gradient pattern of A390-5%Mg bucket fabricated by the
centrifugal cast process

The microstructure formation was affected in both the cylindrical cast and the bucket by the
centrifugal force generated by the spinning of the mould. Some of the coarse Mg2Si and large
primary Si in the microstructure formed were modified and refined by the centrifugal casting

128
technique into fibrous and finer Si. Consequently, the mechanical properties of the alloy are
improved by this modification and refinement [6, 14-16]. The inherent attributes of corrosion
and wear resistance, light weight, the thermal and electrical conductivity of aluminium and its
alloys and composites are resultant effects of microstructure modifications.

Fine Si particles are formed from the liquid by the melt rotation of Al-Si-based alloys during
solidification. The cooling rate of Al-Si alloys has a strong effect on the microstructure; as
such, rapid cooling causes transformation of plate morphology of eutectic silicon to fibre [17,
18]. Rapid solidification processing (RSP) during liquid to solid state transition results in
grain size reduction, increased alloying elements solid solubility and segregation reduction.
Furthermore, amorphous phases and metastable crystalline are formed at times. Rapid
solidification is very effective in the production of nanocrystalline of Al-based alloys with Si,
rare earth metal (RE), and late transition metal (Ni) (19). Centrifugal casting causes rapid
cooling that facilitates the rate of solidification and consequently enhances the quality of
casting.

The speed of rotation is a factor that affects the rate at which the microstructure of an alloy is
modified and refined. Some studies have put the optimum speed of rotation in centrifugal
casting operation between 1200 rpm to 1500 rpm [18, 20]. The microstructure of both the
cylindrical and bucket cast was observed to show the following at the speed of 1200 rpm:
changing of large primary Si into needle-shaped eutectic Si near the surface; long needle-
shaped eutectic Si transformed into fine primary Si; and, the formation of fine grain.

The particles acceleration variation and solidifications model as related by equation (6), is
represented in the graph in Figure 9.17. The graph shows that the particles of the Mg2Si and
Al-Si possess different acceleration at the same speed. This is due to the difference in their
densities. The densities of the particles are: Mg2Si = 1.93x103 Kg/m2; Si = 2.33103 Kg/m2 and
Al-Si (matrix) = 2.37103 Kg/m2.

129
Figure 9.17: The particles acceleration and centrifugal-gravity ratio curve

9.4.2 Effect of centrifuge and heat treatment on hardness

The magnitude of the hardness varied between the inner region and the outer region of both
the cylindrical cast and the bucket. A hardness of 150 BHN was observed at points 2 and 6,
while the minimum, 110 BHN, was recorded at points 1 and 5 in the bucket specimen of
A360-5Mg-T6. Figure 17 shows the hardness values along specimen D as-cast. The
maximum and minimum BHN of as-cast were obtained at 140 mm (120 BHN) and 100 mm
(87 BHN) from the axis of rotation respectively. A maximum hardness of 157 BHN was
recorded at 70 mm and 145 BHN at 140 mm in a heat treated sample.

The microstructure formation at the maximum hardness point in as-cast A390-5%Mg is fine
and fibrous silicon particles, wKLOHYRLGVDQGĮ-Al dendrites are the predominant features of
the minimum hardness point. The hardness magnitude at 140 mm from the centre of rotation
is the resultant effect of coarse Mg2Si and large primary Si refinement by the centrifuge. The
high volume of aluminium insoluble hard Si precipitates at the inner zone and is responsible
for the 118 BHN hardness recorded (Figure 9.18).

130
Figure 9.18: Hardness of A390-5%Mg as-cast by centrifugal casting in relation to the microstructure

A non-uniform morphology was seen in A360-T6, as shown in Figure 9.19(b), due to the
formation of smaller Mg2Si and primary Si particles, a fusion of Si and Mg2Si particles, finer
and needle-shaped eutectic Si after heat treatment. A hardness of 143 BHN was observed in
A360-T6.

Figure 9.19: Optical micrographs of A390 and A390-6T as-cast by gravity casting a) A390 as-cast; b)
A390-6T

A390 belongs to the heat treatable class of aluminium alloy (3xx series) and heat treatment
studies have shown that the process enhances mechanical properties such as hardness and
strength [21-23]. The increase in hardness that accompanies the T6 process is caused by the
production of supersaturated solid solution during solutionizing and re-precipitation during
ageing. The T6 heat treatment process executes homogeneity of the structure of as-cast
intermetallic phases such as Al2Cu and Mg2Si dissolution and refinement of eutectic silicon
morphology [24, 25]. The modification and refinement which occurs includes the

131
disintegration of the eutectic silicon branches and spheroidization of the separated branches
[26-29]. The high hardness value observed at the inner region of A360-5%Mg-T6,
represented in Figure 9.20 is due to the high volume of Mg2Si precipitates that dissolved
during solutionizing, and to the presence of a cluster of the refined eutectic Si in the region.

Figure 9.20: Graphs of hardness variation of A390 and A390-5%Mg fabricated by centrifugal casting
technique of both as-cast and heat treated alloys

9.4.3 Electrochemical corrosion

The difference in corrosion behaviour of A390 and A390-5%Mg alloys in 3.5% NaCl solution
is shown in Figure 9.21 and Table 9.3. The tafel (polarisation) curves in the Figure 20(a)
indicate that less corrosion occurred in the A390-5%Mg alloy. The base alloy showed
continuous pitting prospect while the alloy with 5%Mg showed higher resistance. Table 9.3
presents the A390 and A390-5%Mg alloys in 3.5% NaCl solution polarisation parameters. It
was observed that the corrosion current (Icurr) of A390 alloy is higher than that of A390-
5%Mg alloy. This means that A390 alloy will corrode more.

Table 9.3: A390 and A390-5%Mg alloys in 3.5 % NaCl solution polarisation parameters

Alloy Ecorr (V) Icorr (A) Acathode Aanode


A390 -0.886 2.98x10-4 4.833 6.228
-6
A390-5%Mg -0.01 2.8x10 9.169 4.484

In Figure 9.21(b) the inner (E1), and the mid (E2) regions show the highest and least resistance
respectively. The A390-5%Mg alloy resistance arrangement as shown in Figure 9.21(b), is
due to the large Mg2Si precipitates at the surface of the A390-5%Mg alloy. This result is in
accord with some of the previous studies. Several studies have shown that alloying aluminium
with 3 % to 4 % magnesium enhances the corrosion resistance of aluminium and its alloys in
132
seawater. The high corrosion resistance of the Al-Mg system coupled with its mechanical and
weldability properties, means that alloys of Al-Mg are widely applied in sea shipbuilding and
other seawater related applications [30,
31].

Figure 9.21: Tafel of a) A390 and A390-5%Mg; b) Specimens E1, E2, and E3 (see also Figure 9.10)

9.5 Protective coating of Pelton bucket

For functional performance therefore, the surface of the bucket should be hardened and
smoothed to withstand the silt erosion, cavitation and pressure from jet water. Using
centrifugal casting processes and heat treatment has tremendously enhanced the surface
hardness property and strength.

For better service performance, bucket surface coating with harder and tougher material is
recommended. Coating the surface of a bucket with a ceramic material is effective and the use
of Al2O3 implanted with Fe micrograins, and microarc oxidation (MAO) or plasma
electrolytic oxidation (PEO) as coatings are recommended by this study.

9.6 Conclusion

This study observed that: it is possible to fabricate a complex shaped Pelton turbine bucket by
means of a centrifugal casting process with the right permanent mould configuration; the
mechanical properties of the bucket can be improved by 5 %Mg addition to A390 alloy using
gravity casting and heat treatment; a hardness of 143 BHN was observed in A360-T6; large
VLOLFRQIODNHVODUJHĮ-aluminium dendrites inter-dendrite arm spacing and large dendritic cells
are formed by low solidification which are converted to small silicon flakes, small inter-

133
dendrite arm spacing and changed acicular silicon to fibrous silicon by centrifugal casting
technique; and, the mechanical properties of the inner surface (the face that receives jet water)
can be improved using a centrifugal casting technique and heat treatment. Improvement was
also observed at the outer surface of the bucket due to large Si and Mg2Si particles that were
segregated in that region, and the electrochemical corrosion property of A390 alloy in 3.5
NaCl solution was enhanced by the addition of 5 %Mg to form A390-5%Mg alloy. However,
due to the pattern of the microstructure influenced by the centrifuge, the inner zone of the
circular cast shows the highest corrosion resistance.

134
Bibliography

[1] S. K. Bohidar, R. Sharma and P. R.. Mishra, "Functionally graded materials: A critical
review," International Journal of Research (IJR), vol 1, pp. 289-301, 2014.

[2] G. E. Knoppers, J. W. Gunnink, J. Van Den Hout, W. P. Van Vliet, "The reality of
functionally graded material products," International Solid Freeform Fabrication
Symposium; University of Texas at Austin, Texas 2004, pp. 38-43.

[3] S. S. Wang, "Fracture mechanics for delamination problems in composite materials,"


Journal of Composite Materials, vol. 17, no. 3, pp. 210-223, 1983.

[4] T. P. D. Rajan and B. C. Pai, "Formation of solidification microstructures in


centrifugal cast functionally graded aluminium composites," Transactions of The
Indian Institute of Metals, vol 62, no. 4-5, pp. 383-389, 2009.

[5] A. Banerji, P. K. Rohatgi and W. Reif, "Research and development of transportation


of composites,". In Procedures of the European MRS Conference on Advanced
Materials, Strassburg, France 1985.

[6] Y. B. Zuo, Z. Fan, Q. F. Zhu, L. Lei and J. Z. Cui, "Modification of a hypereutectic


aluminium silicon alloy under the influence of intensive melt shearing." Materials
Science Forum, vol. 765, pp. 140-144, 2013.

[7] Y. Watanabe, H. Sato, T. Ogawa and I. S. Kim, "Density and hardness gradients of
functionally graded material ring fabricated from Al-3 mass%Cu alloy by a centrifugal
in-situ method," Materials Transactions, vol. 48, 2945-2952, 2007.

[8] K. Patel, H. Patel and F. Patel, "Effect of mould rotation speed on hardness and sliding
wear resistance of hypereutectic Al-Si alloy," Indian Journal of Applied Research, vol.
5, no. 1, pp. 78-81, 2015.

[9] P. Adhikary, P. K. Roy and A. Mazumdar, "Selection of hydro-turbine blade material:


application of fuzzy logic (MCDA)," International Journal of Engineering Research
and Applications. vol. 3, no. 1, pp. 426-430, 2013.

[10] SAAJ Steel Corporation, Die steel grade OHNS: SAAJ Steel Corporation; 2014 [cited
2016 23/03/2016]. Available from: http://saajsteel.com/?page_id=1055.

135
[11] The New Zealand Digital Library Project. Micro Pelton turbines: components and
design principles - bucket, New Zealand Digital Library Project; [cited 2016
06/03/2016]. Available from: http://www.nzdl.org/cgi-bin/library.cgi.

[12] M. M. Rahvard, M. Tamizifar, S. M. A. Boutorabi and S.G. Shiri, "Characterization of


the graded distribution of primary particles and wear behaviour in the A390 alloy ring
with various Mg contents fabricated by centrifugal casting," Materials and Design,
vol. 65, pp. 105-114, 2014.

[13] R. D. Pruthviraj, P. V. Krupakara and H. P. Nagaswarupa, "Open circuit potential


studies of ZA- 27/SiC metal matrix composites in acid chloride mediums,"
Transactions of SAEST, vol. 41, pp. 94-96, 2006.

[14] O.V. Abramov, B.B. Straumal and W. Gust, "Hypereutectic Al-Si based alloys with a
thixotropic microstructure produced by ultrasonic treatment," Material and Design,
vol. 18, no. 4-6, 323-326, 1997.

[15] C. Cui, A. Schulz, K. Schimanski and H. W. Zoch, "Spray forming of hypereutectic


Al–Si alloys," Journal of Material Process Technology, Vol. 209, pp. 5220-5228,
2009.

[16] D. Lu, Y. Jiang, G. Guan, R. Zhou, Z. Li and R. Zhou, "Refinement of primary Si in


hypereutectic Al–Si alloy by electromagnetic stirring," Journal of Material Processes
Technology, vol. 189, pp. 13-18, 2007.

[17] N. V. Rafiei, N. Varahram and P. Davami, "Microstructure study of Al-20Si-5Fe


alloys produced by melt-spinning process," Metallurgy Material Engineering, vol. 19,
no. 1, pp. 85-94, 2013.

[18] V. B. Patel, "Investigations on the properties of Al-Si alloy synthesized by centrifugal


casting process," Doctor of Philosophy dissertation, Ganpat Uniiversiity, Kherva,
India; 2014.

[19] E. J. Abed, "Rapidly solidified of hyper eutectic aluminum-silicon alloys ribbons by


using melt-spinning techniques," International Journal of Current Engineering and
Technology, vol. 4, no. 3, pp. 1394-1398, 2014.

[20] R. A. Shailesh, M. S. Tattimani and S. S. Rao, "Understanding melt flow behavior for
Al-Si alloys processed through vertical centrifugal casting," Materials and
Manufacturing Processes, vol. 30, no. 11, pp. 1305-1311, 2015.

136
[21] S. Raghunandan, J. A. Hyder, T. P. D. Rajan, K. N. Prabhu and B. C. Pai, "Processing
of Primary silicon and Mg2Si reinforced hybrid functionally graded aluminum
composites by centrifugal casting," Materials Science Forum, vol. 710 pp. 395-400,
2012.

[22] A. M. A. Mohamed, F. H. Samuel and S. Alkahtani, "Influence of Mg and solution


heat treatment on the occurrence of incipient melting in Al-Si-Cu-Mg cast alloys,"
Materials Science and Engineering A, vol. 543, pp. 22-34, 2012.

[23] A. M. A. Mohamed, F.H. Samuel: "A review on the heat treatment of Al-Si-Cu/Mg
casting alloys," InTech, Chapter 4, 2012.

[24] J. Barresi, M. J. Kerr, H. Wang and M. J. Couper, "Effect of magnesium, iron, and
cooling rate on mechanical properties of Al-7Si-Mg foundry alloys," Transactions
American Foundrymens’ Society, vol. 108, pp. 563-570, 2000.

[25] J. Gauthier, P. Louchez and F. H. Samuel, "Heat treatment of 319.2 Al automotive


alloy: Part 1, solution heat treatment," Cast Metals, vol. 8, no. 1, pp. 91-106, 1995.

[26] D. V. Khera and R. S. Chadhawork, "Silt erosion. trouble for turbines," International
Water Power and Dam Construction, vol. 53, no. 4, pp. 22-23, 2001.

[27] W. S. Miller, L. Zhuang, J. Bottema, A. J. Wittebrood, P. De Smet, A. Haszler, et al.,


"Recent Development in Aluminium Alloys for the Automotive Industry," Material
Science Engineering A, vol. 280, pp. 37-49, 2000.

[28] M. K. Padhy and R. P. Saini, "Effect of size and concentration of silt particles on
erosion of Pelton turbine buckets," Energy, vol. 34, no. 10, pp. 1477-1483, 2009.

[29] G. W. Birdsall, "Aluminium heat treatment," Reynolds Metal Company, Virginia,


1958.

[30] F. I. Kvasov and I. N. Fridlyander, Eds., "Commercial Wrought, Sintered, and Casting
Aluminum Alloys," Moscow: Metallurgiya, 1972.

[31] H. H. Uhlig and R. W. Revie: Corrosion and Corrosion Control: An Introduction to


Corrosion Science and Engineering, 4th ed. New York, NY: John Wiley & Sons, Inc.,
2008.

137
CHAPTER 10: CONCLUSION AND FUTURE WORK

10.1 Conclusion

The aim of the study was to analyse and identify power issues, advance solutions and
facilitate increase in the domestic production of hydropower components and systems. The
objectives of the study were set to reflect the aim and to ensure that the set goals were
achieved. Consequently, the study cuts across energy management, engineering design and
manufacturing. These have been executed successfully in a number of publications and
conferences papers presented in this thesis.

Chapters 2 deals with power issues and ways of lifting the present power situation in SSA and
the chapter is divided into three parts. These parts observed that there is gross power
inadequacy and erratic power supply in SSA. It noted that the majority of people without
access to power in SSA live in the rural and remote areas. This has deterred economic growth,
notwithstanding the enormous energy sources and other economic natural resources present in
the region. This situation was attributed to many factors which include insufficient national
and continental collective efforts, research results not being used appropriately, inadequate
manufacturing infrastructure, over dependence on foreign technology, insufficient human
capacity development and high cost of power projects in the region. The study identified SHP
off grid schemes as being vital for rural, industrial estate and standalone electrification but
that the region lacks the capacity. It was, however, proposed that many of these limitations
can be resolved by domestic participation in the design and production of SHP components
and their production technologies. The papers concluded that capacity development needs to
occur in the design and manufacture of SHP components and systems.

The needed sensitisation and capacity enhancement in SHP design and manufacturing were
tackled in Chapter 3. A simplified general hydro turbine design process was presented and a
locally sourced A6061 aluminium alloy was considered as the blade material. The
performance of the material as shown by the simulation results was satisfactory.

Further, the study found that bulk functionally graded materials production methods could be
used to enhance the mechanical and corrosion properties of Pelton bucket. Various FGM
fabrication techniques were studied and presented in Chapter 4. Chapter 5 presented
centrifugal casting technique as a simple, and cost effective production process that can
improve the mechanical properties of locally sourced aluminium based FGMs. Functionally

138
graded metal matrix composite by centrifugal casting technique mathematical correlation was
studied in Chapter 6.

Chapter 7 presented a smart design procedure of civil works and mechanical design aspects of
a SHP system. Design charts that will be useful in the selection and design of SHP were
developed. A Pelton turbine bucket was designed for prototype purposes and locally sourced
aluminium based material was considered as the bucket material.

Domestic development of SHP technologies was considered as a viable way of tackling rural
electrification problems in SSA. Thus, the study developed a particular production technology
of a prototype Pelton turbine bucket, involving the centrifugal casting method and heat
treatment as showed by Chapters 8 and 9. The prototype buckets were successfully fabricated
and characterised to investigate the effects of the manufacturing technique and other process
parameters. The performance of A390, A390-5%Mg, A356 alloy, and A356-SiCp composite
that are locally sourced were satisfactory. The results show that: centrifugal casting method
and heat treatment improved the mechanical properties of A356 alloy and A356-SiCp
composite; the anti-corrosion properties of A390 alloy in 3.5 NaCl solution were enhanced by
the addition of 5 %Mg to form A390-5%Mg alloy; and, the mechanical properties of the inner
surface of the bucket (the face that receives jet water) was improved using a centrifugal
casting technique and heat treatment.

10.2 Future work

In the course of this research, a number of areas were noted, where worthwhile further
investigative study and development are required. The number of iterations that could be
made to enhance the performance of the SHP system is limitless and include the areas
enumerated below.

10.2.1 Materials and manufacturing process

Much research is required regarding manufacturing methods to enhance mechanical


properties of locally sourced materials for hydro turbine blade production, for instance, other
FGMs fabrication methods such as squeeze and stirring casting methods. In terms of
materials, other types of aluminium alloys and scrap such as automobile pistons need to be
investigated for turbine blade or bucket fabrication.

139
10.2.2 Optimisation of domestic design and production

Study of the hydrodynamic and aerodynamic behaviour of blades or buckets fabricated from
locally sourced material for hydro turbine optimisation is recommended.

140
APPENDIXES

141
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
1
Appendix 3

Civil works design;

Q = 0.0:0.02:1; % Design discharge (m^3/s)


V = 1.4; % Channel/canal Velocity (m/s)
A = Q/V; % Cross sectional area of the canal
b = 0.30; % width
h = A/b;% Depth
plot(A,Q) % rating curve
% grid on
% axis on
% Xlabel('Canal sectional area m^2')
% Ylabel('Canal discharge m^3/s')

% Intake
hr = 0.7; % Normal river water level (m)
hh = 0.4; % headrace level (m)
g = 9.81; % gravity acceleration
Cint = 0.6; % discharge coefficient for roughly finished masonry
Qint = A*Cint*(2*g*(hr-hh)).^0.5; % Intake discharge
% plot(A,Qint);
% grid on
% axis on
% Xlabel('Intake sectional area m^2')
% Ylabel('Intake discharge m^3/s')

% Weir
C1 = 1.84;
for i=1:length(h)
Qwr(i) = C1*(b-0.2*h(i))*h(i).^1.5; % retangular notch
end
% plot(h,Qwr);
% grid on
% axis on

C2 = 0.60;
tan45 = 1;
for i=1:length(h)
Qwv = C2*(8/15)*(2*9.81).^0.5*tan45*(h/2).^1.5; % V notch
end
% plot(h,Qwv);
% grid on
% axis on

C3 = 1.86;
for i=1:length(h)
Qwc = C3*b*h.^1.5; % Cipolleti notch
end
% plot(h,Qwc);
% grid on
% axis on

% plot(h,Qwc,'r',h,Qwv,'b')
% Xlabel('weird depth (m)')
% Ylabel('Cipolleti & Vee notch discharge (m^3/s)')
% grid on

2
% axis on

% Headrace canal
Qch = 0.0:0.02:1; % Design discharge (m^3/s)
Vch = 1.4; % Channel/canal Velocity (m/s)
Ach = Qch/Vch; % Cross sectional area of the canal
bch = 0.30; % width
hch = Ach/bch;% Depth
Pw = bch+2*hch;
for i = 1:length(Ach)
Rch(i) = Ach(i)/Pw(i); % hydraulic radius
end
% plot(Pw,Ach)
% grid on
% axis on
% Xlabel('wet perimeter (m)')
% Ylabel('Cross sectional area of the canal (m^2)')

nch = 0.014; % manning roughness value


k = 0.85;
Cc = (1/nch)*Rch.^0.1667; % roughness coefficient
% for ii = 1:length(Rch)
% Sch = ((Qch*nch)/(Ach*Rch.^0.667)).^2;
% end

for i=1:length(Ach)
Sch(i) = (Qch(i)*nch)/((Ach(i)*Rch(i).^0.667)).^2; % side slope
end

for ii=1:length(Sch)
Vchc(ii) = (Cc(ii)*Rch(ii)*Sch(ii)).^0.5; % Velocity by Chezy equation
end
% plot(Sch,Rch)
%grid on
% axis on

Cw = 135; % assumed Hazen-Williams roughness coefficient


for ii=1:length(Sch)
Vchw(ii) = k*Cw*Sch(ii)*Rch(ii).^0.64; % Velocity by Hazen-Williams
equation
end

for ii=1:length(Sch)
Vchm(ii) = ((Rch(ii).^0.667)*(Sch(ii).^0.5))/nch; % Velocity by Manning
equation
end
% plot(Vchw,Qch,'b',Vchm,Qch,'g')
% grid on
% axis on
% Xlabel('Hazen & Manning velocity relations (m/s)')
% Ylabel('Canal discharge (m^3/s)')

% Settling basing

Tsilt = 43200;
bch = 0.30;
W = 5*bch; % width

3
Vvert = 0.03; % fall velocity
Lset = (2*Qch)/(W*Vvert); %settling basin length
Csilt = 0.5; % silt concentration of incoming flow
psilt = 2600; % silt density
Pfactor = 0.5; % p factor
Sload = Qch*Tsilt*Csilt; % Silt load Sload (kg)
Vlsilt = Sload/(psilt*Pfactor); % Volume of the silt in basin

% plot(Lset,Vlsilt)
% grid on
% axis on
% Xlabel('settling basin length (m)')
% Ylabel('Volume of the silt in basin (m^3)')

% Penstock

Vp = 3.5; % penstock velocity (m^3/s)


Lp = 20; % gross head (m)
np = 0.011;
Hg = 50:4:250; % penstock length
f = 0.0014; % friction factor in Darcy Weisbach and ASCE relation
SF = 10; % safety factor
Q = 0.0:0.02:1;
Dp = ((4*Q)/(3.14*Vp)).^0.5; % theoritical relation of penstock internal
diameter (m)
Dpmm = Dp*1000; % penstock internal diameter (mm)
Ap = Q/Vp; % penstock cross sectional area (m^2)
for q=1:length(Q)
hl = ((10.29*np.^2*Q(q).^2)/Dp(q).^5.33)*Lp; % major head loss
end
for ij=1:length(Hg)
hlp(ij) = [hl/Hg(ij)]*100; % percentage head loss
end
Kent = 0.2; % Loss of head through entrance
Kben = 0.34; % Loss of head through bend
Kcon = 0; % Loss of head through contraction
Kval = 0.04; % Loss of head through valves
hlm = (Vp.^2/(2*g))*(Kent+Kben+Kcon+Kval); % minor head loss

Hn = Hg-hl-hlm; % net head (m)


for ij=1:length(Hg)
neff(ij) = (Hn(ij)/Hg(ij))*100; % penstock efficiency
end
% plot(Hg,neff)

tp1 = ((Dpmm+508)/400)+1.2; % penstock thickness (mm)


E = 206*10.^9; % Young modulus of the penstck material (N/m^2)
Ew = 2.1*10.^9; % bulk modulus of water (N/m^2)
p = 0.000617800; % Working pressure (kN/mm^2)
Tst = 0.400; % Tensile strength (kN/mm^2)
tc = 3; % corrosion allowance
tp2 = ((p*Dpmm)/(2*Tst))+tc; % minimum thickness based on hoop-stress
relation
for j=1:length(Dpmm)
check1(j) = Dpmm(j)/tp2(j); % Dp/tp>20
end
tp = tp1+3; % extra 3mm is added for impact of pipe handling in
transportation, laying, deformation, etc
tpd = tp2+3;

4
% plot(tp,Q,'r',tpd,Q,'b')
% grid on
% axis on
% Xlabel('penstock thickness (mm)')
% Ylabel('Penstock discharge (m^3)')

for ij=1:length(Hg)
check2 = Hg/Lp; % Surge tank is needed if Hg/Lp>5
end

% Empirical calculation of penstock diameter Dp

Dpw = 0.7*Q.^0.5; % Warnick et al relation


Dpf = (1.127*Q.^0.45)/Hg.^0.17; % Fahlbusch relation for Q>0.56
for q=1:length(Q)
Dpu(q) = ((1.517*Q(q).^0.5)/Hg(q).^0.25); % USBR relation for Q>0.56
end

Dpl = (0.05*(Q.^0.143)).^0.143; % Ludin–Bundschu relation when Hg<100m


% for t=length(Q)
% Dpm = 2.69*((np.^2)*(Q(t).^2)*(Lp/Hg(t)).^0.1875)
% end
% % plot(Q,Dp,'r',Q,Dpw,'b',Q,Dpu,'g')
% % grid on
% % axis on
% Xlabel('Penstock flow rate (m^3/s)')
% Ylabel('penstock internal diameter (m)')
%
% penstock air vent
Es = 201*10.^9; % Young’s modulus of mild steel for the penstock (N/m^2)
Epvc = 2.75*10.^9;
f = 0.0014; % dimensionless friction factor for pipe material
F = 5; % safety factor for exposed pipe
dvth = Q.^0.5*[(F/E)*(Dp/(tp*f)).^3]; % penstock air vent diameter from
theoreitical
dvw = Q.^0.5*[(F/E)*(Dpw/(tp*f)).^3]; % penstock air vent diameter from
Warnick et al relation
dvu = Q.^0.5*[(F/E)*(Dpu/(tp*f)).^3]; % penstock air vent diameter from
USBR relation

% plot(Q,dvth,'r',Q,dvw,'b',Q,dvu,'g')
% grid on
% axis on
% Xlabel('Penstock flow rate (m^3/s)')
% Ylabel('penstock vent diameter (m)')

5
% plot(Dp,dvent,'b')
% grid on
% axis on
K = 2.1*10.^9; % bulk modulus of water (N/m^2)

for r=1:length(tpd)
Vws(r) = [(K*10.^-3)/(1+K*Dp(r)/(Es*tpd(r)))].^0.5;
end

for r=1:length(tpd)
Vwpvc(r) = [(K*10.^-3)/(1+K*Dp(r)/(Epvc*tpd(r)))].^0.5;
end

% plot(Dp,Vws,'b',Dp,Vwpvc,'r')

% Turbine Design

% Q = 0.033 m3/s;
% Hn = 60 m;
% g = 9.81 m/s2;
% Cn = 0.97;
% ku = 0.46;
% den = 103 Kg/m3;
% x = 0.46;
% nz =2;
% N = 1500 RPM;
% nt = 95%

6
Appendix 4;

Turbine design;

g = 9.81; % gravity (m/s2)


Vp = 3.5; % penstock velocity (m^3/s)
Lp = 20; % gross head (m)
np = 0.011;
Hg = 50:4:250; % penstock length
f = 0.0014; % friction factor in Darcy Weisbach and ASCE relation
SF = 10; % safety factor
Q = 0.0:0.02:1;
% Dp = ((4*Q)/(3.14*Vp)).^0.5; % penstock internal diameter (m)
C = 1.273; % constants
Dp = ((C*Q)/Vp).^0.5;
Dpmm = Dp*1000; % penstock internal diameter (mm)
Ap = Q/Vp; % penstock cross sectional area (m^2)
for q=1:length(Q)
hl = ((10.29*np.^2*Q(q).^2)/Dp(q).^5.33)*Lp; % major head loss
end
for ij=1:length(Hg)
hlp(ij) = [hl/Hg(ij)]*100; % percentage head loss
end
Kent = 0.2; % Loss of head through entrance
Kben = 0.34; % Loss of head through bend
Kcon = 0; % Loss of head through contraction
Kval = 0.04; % Loss of head through valves
hlm = (Vp.^2/(2*g))*(Kent+Kben+Kcon+Kval); % minor head loss
Hn = Hg-hl-hlm; % net head (m)

% Turbine Design

Cn = 0.97;
ku = 0.46;
den = 10.^3; % water density Kg/m3;
x = 0.46;
nz = 2;
N = 1500; % generator rotation (rpm)
nt = 0.83; %
for q=1:length(Q)
Pti(q) = (den*g*nt*Hn(q)*Q(q))/1000; % The input power to the turbine, Pti
(kW)
end
% % Q = 0.0:0.02:1;
% % plot(Q,Pti);
% % grid on
% % axis on
% % Xlabel('Flow rate (m^3/s)')
% % Ylabel('Turbine power (kW)')

% plot(Hn,Pti)
% grid on
% axis on
% Xlabel('Net head (m^3/s)')
% Ylabel('Turbine power (kW)')

for i=1:length(Pti)
Ns(i) = (N*(Pti(i)).^0.5)/Hn(i).^1.25; % Specific speed (Ns)
end
Vj = Cn*(2*g*Hn).^0.5; % Jet velocity, Vj (m/s)

7
for q=1:length(Q)
Dj(q) = ((4*Q(q))/(pi*nz*Vj(q))).^0.5; % Jet/nozzle diameter, Dj
end
N1 = 1200;% generator rotation (rpm)
N2 = 1000; % generator rotation (rpm)
N3 = 800; % generator rotation (rpm)
N4 = 600; % generator rotation (rpm)
N5 = 400; % generator rotation (rpm)
Vtr = x*Vj; % Tangential velocity of the runner, Vtr
Dr = (60*Vtr)/(pi*N); % Runner diameter Dr, (m)
Dr1 = (60*Vtr)/(pi*N1);
Dr2 = (60*Vtr)/(pi*N2);
Dr3 = (60*Vtr)/(pi*N3);
Dr4 = (60*Vtr)/(pi*N4);
Dr5 = (60*Vtr)/(pi*N5);

%
plot(Dr,Vtr,'r',Dr1,Vtr,'b',Dr2,Vtr,'g',Dr3,Vtr,'y',Dr4,Vtr,'c',Dr5,Vtr,'m'
)
% grid on
% axis on
% Xlabel('Runner diameter (m)')
% Ylabel('Tangential velocity of the runner(m/s)')

% plot(Dj,Q)
% grid on
% axis on
% Xlabel('Jet diameter(m)')
% Ylabel('Flow rate(m^3/s)')

Aj = (pi*Dj.^2)/4; % nozzle cross sectional area, Aj


for ij=1:length(Vj)
Qn(ij) = Vj(ij)*Aj(ij); % Nozzle flow rate, Qn (m3/s)
end

Xnb = 0.625*Dr; % Distance between bucket and nozzle, Xnb (m)


Rbr = 0.47*Dr; % Radius of bucket centre of mass to runner centre Rbr (m)
Bw = 3.2*Dj; % Bucket axial width, Bw (m)
Bl = 3*Dj; % Bucket radial length, Bl (m)
Bd = 1.2*Dj; % Bucket depth, Bd(m)
h1 = 0.35*Dj; % Cavity Length, h1 (m)
h2 = 1.5*Dj; % Length to Impact Point, h2 (m)
k = 0.17*Dj; % Offset of Bucket(m)
a = 1.2*Dj; % Cavity Width (m)
Lab = 0.195*Dr; % Length of bucket moment arm(m)

for j=1:length(Dj)
nz(j) = 15+(Dr(j)/(2*Dj(j))); % number of nozzle
end
% plot(Dj,Bw,Dj,Bd,Dj,Bl,Dj,h1,Dj,h2)
% grid on
% axis on
% legend('Bw','Bd','Bl','h1','h2')
% Xlabel('Jet diameter (m)')
% Ylabel('Bucket dimension parameters(m)')

for i=1:length(Pti)
Ns(i) = (N*Pti(i).^0.5)/(Hn(i).^1.25);
Ns1(i) = (N1*Pti(i).^0.5)/(Hn(i).^1.25);
Ns2(i) = (N2*Pti(i).^0.5)/(Hn(i).^1.25);

8
Ns3(i) = (N3*Pti(i).^0.5)/(Hn(i).^1.25);
Ns4(i) = (N4*Pti(i).^0.5)/(Hn(i).^1.25);
Ns5(i) = (N5*Pti(i).^0.5)/(Hn(i).^1.25);
end
% plot(Q,Ns,'r',Q,Ns1,'b',Q,Ns2,'g',Q,Ns3,'y',Q,Ns4,'c',Q,Ns5,'m')
% grid on
% axis on
% Xlabel('Operational flow rate(m^3/s)')
% Ylabel('Specific speed (Ns)Specific speed (Ns)')

Hn1 = 30; % net head (m)


Hn2 = 50;
Hn3 = 70;
Hn4 = 90;
Hn5 = 110;
Hn6 = 130;
for i=1:length(Pti)
nt1(i) = (100*Pti(i))/(den*g*Hn1*Q(i));
nt2(i) = (100*Pti(i))/(den*g*Hn2*Q(i));
nt3(i) = (100*Pti(i))/(den*g*Hn3*Q(i));
nt4(i) = (100*Pti(i))/(den*g*Hn4*Q(i));
nt5(i) = (100*Pti(i))/(den*g*Hn5*5*Q(i));
nt6(i) = (100*Pti(i))/(den*g*Hn6*Q(i));
end
% plot(Pti,nt1,Pti,nt2,Pti,nt3,Pti,nt4,Pti,nt5,Pti,nt6)
% grid on
% axis on
% Xlabel('Turbine power(kW)')
% Ylabel('Turbine efficiency')

for q=1:length(Q)
F(q)= 2*den*Q(q)*(Vj(q)-Vtr(q)); % Absolute reaction force acting on the
Pelton runner
end

for ii=1:length(Dr)
Tr(ii) = (Dr(ii)*F(ii))/2; % The torque on the runner is Tr
end
% plot(Tr,F)
% grid on
% axis on
% Xlabel('The torque on the runner(N-m)')
% Ylabel('reaction force acting on the Pelton runner (N)')

% Shaft
N1 = 1500; % generator rotation (rpm)
N2 = 1200; % generator rotation (rpm)
N3 = 1000; % generator rotation (rpm)
N4 = 800; % generator rotation (rpm)
N5 = 600; % generator rotation (rpm)
N6 = 400; % generator rotation (rpm)

Ds1 = 105*(Pti/N1).^0.38;
Ds2 = 105*(Pti/N2).^0.38;
Ds3 = 105*(Pti/N3).^0.38;
Ds4 = 105*(Pti/N4).^0.38;
Ds5 = 105*(Pti/N5).^0.38;
9
Ds5 = 105*(Pti/N6).^0.38;

plot(Ds1,Pti,Ds2,Pti,Ds3,Pti,Ds4,Pti,Ds5,Pti)
grid on
axis on
Xlabel('Shaft diameter (mm)')
Ylabel('Turbine power (kW)')

% plot(Ds1,Pti,'r',Ds5,Pti,'b')

10

You might also like