1

AN ANALYSIS OF WRITING ABILITIES IN DESCRIPTIVE TEXTS

OF THE TENTH GRADE STUDENTS OF MAN 2 BOYOLALI IN THE
ACADEMIC YEAR OF 2016/2017

THESIS
Submitted as A Partial Requirements for degree of Sarjana in
State Islamic Institute of Surakarta

Muhammad Abduh Sunyoto

SRN: 12.32.2.1.193

ENGLISH EDUCATION DEPARTMENT

ISLAMIC EDUCATION AND TEACHER TRAINING FACULTY
THE STATE ISLAMIC INSTITUTE OF SURAKARTA
2017
2
3
 4

DEDICATION

This thesis is dedicated for:

1. My beloved Father and Mother (HarjoDimejo and Tukiyem). Who always pray

for me and gives all of their life

2. My beloved brothers and Sister (Sumadi, Sumari, Suratmin, Sumarti)

3. My beloved Big Family

4. My beloved TigaSerangkai, LPM PANDAWA, KSR PMI unit IAIN

SURAKARTA and all of my organization.

5. My beloved Fantastic Class

6. All of my friends
 5

MOTTO

Pray because Allah always listen

~Anonymous~

Hope is a Waking Dream

~Aristoteles~
6
 7

ACKNOWLEDGMENT

Alhamdulillah, all praises be to Allah, the single power, the Lord of the

universe, master of the Day of Judgment, God all mighty, for all blessings and

mercies so the researcher was able to finish this thesis entitled“An Analysis of

Writing Abilities in Descriptive Text of the Tenth Grade Students of MAN 2

Boyolali in the Academic Year 2016/2017”. Peace be upon Prophet Muhammad

SAW, the great leader and good inspiration of world revolution. The researcher is

sure that this thesis would not be completed without the helps, supports, and

suggestions from several sides. Thus the researcher would like to express her

deepest thanks to all of those who had helped, supported, and suggested her

during the process of writing this thesis. This goes to:

1. Dr. Mudofir, S.Ag. M.Pdas the Head of the State Islamic Institute of Surakarta.

2. Dr. H. Giyoto, M.Hum as the Dean of Islamic Education and Teacher

Training Faculty.

3. Dr. ImroatusSolikhah, M.Pd as the Head of English Education Study Program

4. M. ZainalMuttaqien the advisor.Thanks for guidance, precious advices and

correction for the researcher.

5. Drs.H. MahsunAlwa‟id, M.Ag.as the headmaster of MAN 2 Boyolali. Thanks

for giving permission to do this research.

6. RinningS.Pd.I as the English teacher of MAN 2 Boyolali. Thanks for helping

the researcher to do this research.

7. All of the students of XIPS2MAN 2 Boyolali as the subject of the research.

8. The researcher‟s beloved mother, father, and family who always pray for the

best support and give motivation.

 8

9. The researcher‟s brothers, sister and big family who always support.

10. Fantastic Class of English Education Study Program 2012, especially for

ali, dafit, wahyudi, fadrul, tri, mul, ifur, sam, masud, ikhsan, faris, mutma,

naimah, andri, nur, novita, putri, nopita,nita, mila, nina, nanik, meida, duo

mifta, for the togetherness and cheerfulness.

11. Tiga Serangkai especially for Samsul Arifin and Elyta Novi Viandani.

12. Muhajirin gank especially for Muhammad Wildan A, S.Pd, Ikhsan Amirudin,

S.Pd, Saiful Bakri, S.Pd, Fauzan Karim, S.Pd, Muhamat Ali, S.Pd,

Muhammad Wahyudi, S.Pd, Faris Isnawan, S.Pd, Syeh Adam, S.Pd, Hendro

Sayekti, S.Pd, Muhammad Nur Ikhsan, Syaiful, esc.

The researcher realizes that this thesis is still far from being perfect. She hopes

that this thesis is useful for the researcher in particular and readers in general.

Surakarta,14th February 2017

The researcher,

Muhammad Abduh Sunyoto

NIM. 123221193
 9

TABLE OF CONTENTS

TITLE ........................................................................................................... i

ADVISOR SHEET ....................................................................................... ii

RATIFICATION .......................................................................................... iii

DEDICATION .............................................................................................. iv

MOTTO ........................................................................................................ v

PRONOUNCMENT ..................................................................................... vi

ACKNOWLEDGEMENT ........................................................................... vii

TABLE OF CONTENT ............................................................................... ix

ABSTRACT .................................................................................................. xii

CHAPTER I INTRODUCTION

A. Background of Study ................................................................................. 1

B. The Problem Statement ............................................................................. 4

C. The Objective of the Study ........................................................................ 4

D. Limited of the Study .................................................................................. 4

E. The Benefit of the Study ........................................................................... 4

F. Previous Study........................................................................................... 5

G. Definition of Key Terms ........................................................................... 6

CHAPTER II THEORETICAL REVIEW

A. The Nature of Writing

1. The Definition of Writing ..................................................................... 7

2. Micro- And Macro skills of Writing..................................................... 8

3. Aspect of Writing ................................................................................. 10

4. The Purpose of Writing ........................................................................ 17

 10

5. The Reason of Teaching Writing .......................................................... 23

6. Teaching Writing .................................................................................. 24

7. The Writing Process ............................................................................. 26

8. Problem in Writing ............................................................................... 28

9. Criteria for Good Writing ..................................................................... 29

10. The Scoring Writing ............................................................................. 30

B. Review on Descriptive text

1. The Meaning of Descriptive Text ......................................................... 33

2. The Parts of Descriptive ....................................................................... 33

3. The Social Function of Description Text ............................................. 34

4. The Parts of Descriptive Text ............................................................... 34

5. The Example of Descriptive Text ......................................................... 35

CHAPTER III RESEARCH METHODOLOGY

A. Research Design ........................................................................................ 37

B. Setting of the Research .............................................................................. 38

C. Subject and Information of the Research .................................................. 38

D. Instrument .................................................................................................. 39

E. Technique of Collecting Data.................................................................... 39

F. The Technique of Analyzing Data ............................................................ 41

G. The Trustworthiness of Data ..................................................................... 43

CHAPTER IV FINDING AND DISCUSSION

A. Research Finding ....................................................................................... 45

B. Discussion ................................................................................................. 70

CHAPTER V CONCLUSIONS AND SUGESTION

 11

A. Conclusions ............................................................................................... 75

B. Suggestions ................................................................................................ 76

BIBLIOGRAPHY ........................................................................................ 78

APPENDICES .............................................................................................. 81
 12

ABSTRACT

Muhammad AbduhSunyoto. 2017. An Analysis of Writing Abilities in

Descriptive Text of the Tenth Grade Students of MAN 2 Boyolali in the
Academic Year 2016/2017. Thesis, The English Department Islamic Education
and Teacher Training Faculty The State Islamic Institute of Surakarta.

Advisor : M. ZainalMuttaqien, S.S, M. Hum

The Key Word : Students‟, Writing Ability, Descriptive Text, Analysis

The Objectives of this research are (1) To the students‟ writing abilities
in Descriptive Text, (2) To difficulties student‟s in composing Descriptive
text in MAN 2 Boyolali. Therefore the researcher formulated the problem
statement: How are the students‟abilities of writing descriptive texts at tenth
grade of MAN 2 Boyolaliand What are difficulties the students find in writing
descriptive texts at Tenth grade of MAN 2 Boyolali.
This research was conducted in the First Grade students‟ worksheet of
MAN 2 Boyolali. It was descriptive qualitative research. The subjects of this
research were the students worksheet of the Intensive class (XIPS2 Class) of
the first Grade students in MAN 2Boyolali. XIPS2 Class consist 27 students.
The data was collected from the documentation (Students‟ worksheet),
interview, and observation. The data were analyzed by reducing the data,
presenting the data, analyzing the data by using Hughes‟s theory and taking
the conclusion and verification. This research used methodological
triangulation which compared from the result of documentation (Students‟
worksheet), interview, and observation in order to get the valid data.
The findings of the study showed that, first the students writing ability
in Descriptive text was categorized 15 students or (65%) was categorized as
excellent, 8 students (35%) were categorized as good, there was no students
were categorized as fair, poor and failed. The second, there were some
difficulties faced by the students in writing Descriptive text, are: 1) The
students difficult in arranging the sentences 2) The students lack of vocabulary
3) The students do not master grammar well.
 13

CHAPTER 1

INTRODUCTION

A. Background of Study

Language is very important as a tool of communication with other

people to share the human moods. Fauziati (2009) says that language is

very critical to human lives and its main function is for communication.

We know that without language, people cannot interact with the other.

People can share their experiences, their feelings, and their needs to each

other by speaking and writing using language. There are many languages

in this world. Almost every country and every city have a different

language. One of the languages in the world is English.

English as one of languages is very important in the world, because

it has become an international language. Harmer (1998:24) states most

adults can learn a language without studying it, providing they are in the

right kind of contact with it. They may have more trouble with

pronunciation and grammar than younger learner. However, they may still

be able to communicate fluently. It means that English is an international

language which is not only students or younger peoplewant to learn it, but

also the adults. Today, English is very important and every kind of jobs

needs someone who masters it. English is certainly important for all people

to learn. All of people in this world and also Indonesian people have to

learn it because we know that almost all of the book, of science,

knowledge, and international business are in English. Therefore,

 14

Indonesian people must master English to improve the quality of education

and the quality of progression of Indonesian itself.

Globalization era has made English be taught at school. The

Indonesian Government curriculum has informed that all schools in

Indonesian have to teach English. Indonesia is a developing country which

uses English as foreign language, but not all of citizen can speak English,

although English has already beenstudied by Indonesian people from

kindergartens until university. According to Cohen (1998:4) “foreign

language is the language being learned, not spoken in the local

community”. In addition, English has to be mastered by students and it

causes government of Indonesia to make English not only as lesson which

must be learnt by students of Indonesia, but also as one of subjects in

National Examination in Indonesia.

In practicing English there are four skills which must be mastered

by the students. Brown (in Al-Khasawneh: 2008) states that languages

consist of main four skills: reading, listening, writing, and speaking.

Learners should be exposed to the all the mentioned skills to successfully

master English. Writing is placed in the last among the four skills. The

stage of the skill shows that students have to be familiar with the first three

skills. Writing is the production of the written word in the form of text and

it must be read and comprehended in order to communicate (Murcia,2001:

142). Writing is an important skill for the learners to enter science and

technology. So, students will get so many difficulties when they do not

master English well. The main problem of Indonesian students in learning

 15

writing is that they have little chance to practice writing English.

Therefore, they still think that writing is not more important than the other

skills. Some years ago, it might be true. But now, when the international

language is being the key to enter science and technology, writing is very

important to be learned by the English learners.

As Harmer (2001: 79) states that “By far, the most important

reason for teaching writing, it is a basic language skill, as important as

speaking, listening, and reading students need to know how to write letters,

how to put written repost together, how to replay to advertisements and

increasingly, how to write using electronic media. They need to know

some of special writing conventions (punctuation, paragraph construction,

etc). Just ask they need to know how to pronounce, spoken English

appropriately. Part of our job is to given that skill.”

Writing is considered by language learners as the most difficult

skill science it that requires a lot of lexical a syntactic knowledge as well

as principles of organization. The difficulty is not only due to the need to

generate and organize ideas using an appropriate choice of vocabulary,

sentence, and paragraph organization but also the necessity to turn such

ideas into a readable text (Barli, 1995: 76). There are some reasons why

writing skill is considered difficult for most students. One of them lies in

Indonesian culture, which traditionally uses a lot of spoken language so

that writing is not a way of expressing oneself. Furthermore, the task of

writing will become more difficult when they have to write in foreign

language, like English.

 16

The methods are used by teacher to manage the class also play an

important role to the product of teaching and learning activities. Based on

the observation, the English teacher still used teacher-centered approach

instead of student-centered approach. The teaching and learning activities

are still dominated by the teacher. So, the students usually just copy their

friend‟s answer. The students do not have any intention to do the writing

task, because the students think that writing English is very difficult. It

means that the students‟ motivation in learning English especially in

writing skill is low.

The purpose of teaching English for SMA/MA in IPA/IPS class

students is to develop communicative competence or spoken and written

form to achieve the literacy level which can be realized through four

language skills listening, speaking, reading, and writing (Depdikbud,

2006:367). In writing skill for students the tenth grade High School for the

first semester are given genre text such as only descriptive text. Based on

the research in the tenth grade students of MAN 2 Boyolali, one kind of

writing texts which is still difficult to be mastered by students is

descriptive text. The students thought that to write a descriptive text is still

difficult. The problems experienced by most students in creating

appropriate writing text have encouraged the researcher to conduct this

research.

The research was interested to analyze the worksheets of the

students in composing Descriptive Text at MAN 2 Boyolali. Therefore, the

researcher intends to conduct research entitled “An Analysis of Writing

 17

Ability in Descriptive Texts of the Tenth Grade Students of MAN 2

Boyolali in the Academic Year of 2016/2017. The researcher would check

the students‟ worksheets in writing descriptive text of the tenth grade of

MAN 2 Boyolali.

B. The Problem Statement

In this study, the researcher only focuses on certain problems. The

problem can be formulated as follows:

1. How are the students‟abilities of writing descriptive texts at tenth grade

of MAN 2 Boyolali in the academic year of 2016/2017?

2. What are difficulties the students find in writing descriptive texts at

Tenth grade of MAN 2 Boyolaliin the academic year of 2016/2017?

C. The Objective of the Study

After deciding the research problem, the research states the

objective of the research as mentioned bellow:

1. To know the student‟s abilities in writing descriptive texts at Tenth

grade of MAN 2 Boyolali in the academic year of 2016/2017.

2. To know difficulties did student‟s find in writingdescriptive texts at

Tenth class of MAN 2 Boyolali in the academic year of 2016/2017.

D. Limited of the study

It is nearly impossible for the researcher to study all the problems,

in the limited time and limited chance. Therefore the is study or research
 18

will be limited, as follows: (1) students the object of the study is limited to

only students writing ability skills and difficulties in descriptive texts; (2)

the subject of the study is limited to the first year students of MAN 2

Boyolali.

E. The Benefit of the Study

The results of this research are expected to give significant

contribution to the following people:

1. For Students

By this research the studentsare expected to beable to make

good paragraphs especially on descriptive.

2. For English Teacher

The result of this research hopefully can provide the

information to the teacher, on students‟ abilities in writing

descriptive texts.

3. In Language Research

The procedures and outcomes of the research hopefully can

inspire other researcher to do research concerned with similar

themes.

F. Previous study

There are some previous studies thatis related to this research. The

first research was done byEdyWijanarkoentitled“Descriptive Analysis of

Error on Writing Descriptive Text Based on Surface Strategy Taxonomy

 19

made by the tenth grade studies of MAN 1 Boyolali in academic year

2016”. Inthis research, based on the background, commonly the tenth

grade students of MAN 1 Boyolali had low scores in writing ability. The

students had difficulties in writing such as in creating ideas, translating

from Indonesian to English, using grammar, memorizing vocabulary and

making coherence paragraphs.

The study above has differences and similaritywith the writer‟s.

The differences are on the place, population, and sample, technique of

collecting data, technique (method) of study, and research design. The

similarity with the writer‟s study is on the use of descriptive textsas

material.

G. Definition of Key Terms

In this case, there are some key terms related to the research.

1. Writing Skill

Writing is basically a matter of arrangement, of fitting sentences

and paragraph into prescribed patterns (Kroll, 1993: 14)

Meanwhile, according to Hornby (1995: 1109) skill is the ability to

do something well. To conclude, writing skill is the ability to arrange and

fit sentences and paragraph into prescribed pattern.

2. Analysis

According to Hornby (1995:38) analysis is the study of something

by examining its parts and their relationship, a statement of the result.

3. Descriptive Text
 20

Oshima and Hogue (1977:50) state that descriptive text tells how

something looks, fells, smells, testes and/ or sounds. A good description is

like a “word picture” the reader can imagine the object, place or person in

his or her mind.

 21

CHAPTER II

THEORETICAL REVIEW

This chapter presents the theoretical review which is related to

writing. Therefore, this chapter consists of definition of writing, micro-and

macros skills of writing, the purpose of writing, the reason of teaching

writing teaching writing, the writing process, problem in writing, criteria

for good writing, the scoring of writing, the meaning of descriptive text,

the parts of descriptive text, the social function of descriptive text,

example of descriptive text.

A. The Nature of Writing

1. The Definiton of Writing

Writing is one of important skills that language leaners need to

learn as an essential component not only for their academic practice but

also in their professional life. Writing is an activity to produce

something in written form so that people can read, perform or use it

(Oxford Advanced learner’s Pocket Dictionary, 2008: 516).

Writing can be defined in various ways. There are some definitions

of writing proposed by experts. According to Brookes and Grundy

(2000:1) “writing language was though by some to be spoken language

put into written form. Futhermore, the assumption that writing is

putting the spoken language into writing form is only the true for

activies like taking down dictation or transcribing a tape.

Ghaith in Nur Rahma (2008:12), states that writing is an

intellectual activity in appropriate formats for the rhetorical presentation

 22

of ideas as well as mastery in all areas of language. While Sari

(2007:63) says that writing is a complex process in which the authors

can reveal all in their mind to be something real. In addition, Oshima

and Hogue (1997:2) state writing as a progressive activity. This means

that when the author first writes something down, he have already been

thinking about what you are going to say and how you are going to say

it.

The next definiton is given by Harris (1993:10). He says that

writing is a process that occurs over a period of time, particularly if we

take into account the sometimes extended periods of thinking that

precede creating and an initial draft. While Clay in Browne (2001: 89)

states that writing is a way of communicating which employs regular

features and forms including letter shapes, print direction, consistent

spelling and punctuation marks.

From these statements, the conclusion is that writing is a process of

transferring idea, meaning, feeling, expression and imagination in

written language by using correct features includes grammatical,

punctuation, and meaning. Talking about writing skill will be much

related to developing of the ideas and writing down carefully.

2. Micro- And Macro skills of Writing

According to Brown, H.. Douglas (2004:220) the turn once again to

a taxonomy of micro- and macroskills that assist in defining the

ultimate criterion of an assessment procedure. The earlier microskills

apply more appropriately to imitative and intensive types of writing

 23

tasks, while the macroskills are essential for the successful mastery of

responsive and extensive writing.

The Micro skills if writing are:

a. Produce graphemes and orthographic patterns of english.

b. Produce writing at an efficient rate of speed to suit the purpose.

c. Produce an acceptable core of words and use appropriate word order

patterns.

d. Use acceptable grammatical system (e.g. tense, agreement,

pluralization), patterns, and rules.

e. Express a particular meaning in different grammatical forms.

f. Use cohesive devices in written discourse.

The Macro skills if writing are:

a. Use the rhetorical form and conventions of written discourse.

b. Appropriately accomplish the communicative functions of written

texts according to form and purpose.

c. Convey links and connections between events, and communicate

such relations as main idea, supporting idea, new information, given

information, generalization, and exemplification.

d. Distinguish between literal and implied meanings when writing.

e. Correctly convey culturally specific references in the context on the

written text.

f. Develop and use a battery of writing strategies, such as accurately

assessing the audience‟s interpretation, using prewriting devices,

writing with fluency in the first drafts, using paraphrases and

 24

synonyms, soliciting peer and instructor feedback, and using

feedback for revising and editing.

3. Aspect of Writing

In order to produce a good writing the writer needs to consider

some aspects of writing. Those aspects of writing are content,

organization, grammar, vocabulary, and mechanic:

a. Content

Content is one of the important aspects in writing that should

be noticed by students when they are writing. content in writing

deals with the ability to give clear information related to the topic of

writing. Furthermore, it belongs to the important aspect in writing

because it also refers to the clarity of the paragraph. Brannan (2003:

46) states that clarity is a crucial component in writing as it includes

an explanation about examples, reasons and word choice. To have a

good content in writing, writer need to write clearly by completing

their explanation with the additional information to make the readers

more understand to the idea of writers. For example, if the writers

want to write about herbivores, they need to give the example of the

animal that include to herbivores, explain the reason why the animal

mentioned belong to herbivores‟ category and pay attention to word

choice. To conclude, the content of this reserch refered to the

students‟ writing ability in composing descriptive text which was

relevant to assigned topic. The students were required to write a

descriptive text with a good content in which all sentences of a text

 25

relate to the topic, decribe the topic, and tell about their experiences.

Moreover, they had to write a good content of descriptive text by

giving clear information and explanation of their experiences

relating to the topic that chose by students.

b. Organization

Organization skill refers to the ability to organize the ideas

in logical sequence paragraph (Hartfield et al, 1983: 74). The

sentences in the paragraph should be organized in logical sequence

to make united contribution to whole paragraph. According to Kanar

(1998: 74), a well-organized paragraph should have unity and

coherence. In addition, Oshima and Hongue (1991: 17) state that a

good paragraph also has the elements of unity and coherence.

1) Unity

Unity is an important element of a good paragraph has unity,

which means that in each paragraph, only one main idea is

discusssed. If you start to discuss a new idea, begin a new

paragraph, (Oshima et al, 1981: 18). The unity is synonymous

with oneness. It means oneness to express the ideas in one

paragraph. All sentences in a paragraph should state on the one

thing in the topic sentence. All of the sentences stick together.

2) Coherence

Another requirement of well-organized paragraph is coherence.

Oshima et al, (1981: 77) says that “the sentences must hold

together; that is the movement from one sentence to the next must
 26

be logical and smooth. There must be no sudden jumps. Each

sentence should flow smoothly into the the next.” While Harmer

(2004: 24) states “coherence is elements of text that the phrases

and sentences relate to each other”. In developing a coherence

paragraph, a writer should know some writing skills. According

to Wong (1999: 369), “coherence means that ideas and sentences

flow together smoothly in a logical, organized manner”. In

addition, Wong also says developing coherence in the body of

paragraph requires the following writing skills:

a. Knowing how to organized information chronologically,

spatially, and in order of importance frequency.

b. Knowing how to use sentence variety and how to combine

sentences.

c. Knowing how to connect ideas and sentences by transition

words.

To conclude, the organization of writing descriptive text in

this research meant that the students need to write a descriptive text

in good organization. Their writing had to consist of complete

generic structure of descriptive text.

c. Grammar

Grammar refers to the patterns or rules which are used to

construct the sentences in English correctly and aceptably.

Thornbury (1991: 1) states that grammar is the study of the forms or

structure which are used in language. In addition, he adds that

 27

grammar is the rules which is used as a guidance to form the

language sentences. Harmers (2004: 31) says that when the students

write, they need to focus on the accurate language use. This means

that students cannot ignore using the correct grammar in their

writing. After all, students have to be able to write grammatically

correct in order to produce meaningful sentences. In this research,

the students need to correct the sentences by using Simple Past

Tense. Generally Simple Past Tense indicates an actions that

happens in the past. It is also events or actions in different situations.

Pardiyono (2001: 59-60) explains that the functions of Simple Past

Tense are follows:

1) Describing an activity happened at a specific time in the past.

Example: Rina went to Baron Beach with her family last week.

2) Expresing the past incident or the past even.

Example: David won the competition and he got a special prize.

3) Describing a situation or a condition happened in the past.

Example: it rained very hard last night, so I did not come to my

friend‟s birthday party.

Afterwards, students also need to know the patterns of

Simple Past Tense. The purpose is to guide them in arranging the

words into a good sentence. The following explanations are patterns

used to construct sentences in the form of Simple Past Tense.

 28

1) Pattern of Simple Past Tense with the main verb.

Example:

a. Steffy bought a pair of shoes yesterday.

b. Steffy did not buy a pair of shoes yesterday.

c. Did Steffy buy a pair of shoes yesterday?

2) Patterns of Simple Past Tense with the verb “be”.

Example:

a. Hiro was a singer 3 years ago.

b. Hiro was not a singer 3 years ago.

c. Was Hiro a singer 3 years ago.

d. Vocabulary

In writing, vocabulary deals with the choice of words.

Langan (2008: 439) states that the writer should choose the word

carefully in writing. This statement describes that students need to

pay attention on the words they use when they are writing because

each word may represent a different meaning. For example, the use

of words listen and hear in a sentence is different although both of

them are the same verbs that involve sense of hearing. It can be

illustrated in the following senetence, but the “present verb” it

change into “past verb”. It helps the learner understand the different

meaning of those words in the form of sentence.

1. Diana listened to the music on her iPod last night.

2. Diana suddenly heard a loud sound of music.

 29

The first sentence show that the word listened indicates an activity

done intentionally. The use of word listened in the one hand means that

people consciously pay attention and try to understand the music. On the

other hand, the word heard indicates an activity done unintentionally. The

second sentences shows that Diana does not intend to hear that sound.

Further, it will be inappropriate if writers use the word heard in the first

sentence, because it causes an incorrect meaning. For that reason, students

need to use the appropriate vocabulary in order that meaning of words in

any sentences can be understood.

Considering that vocabulary refers to a set of words, Kennedy

(2003: 59) clarifies words into eight different words that are familiar for

most people. Those words are as follows:

1. Nouns : table, chair, pencil, bag

2. Verbs : work, sleep, swim, study

3. Determiners : this, that, the, any

4. Preppositions : in, on, at, between

5. Adjectives : beautiful, sweet, bad, warm

6. Pronouns : it, they, you, us

7. Conjuctions : and, but, because, or

8. Adverbs : carefully, happily, yesterday, soon

To summarize, this research only focused on the use of nouns,

verbs, adverbs, and, adjectives, pronouns and conjuctions appropriately in

the sentences written by students since the language features of descriptive

text covers those words.

 30

e. Mechanic

Mechanic in this research refers to the correct use of

punctuation, spelling and capitalization enable the reader to

recognize what the writer intends (Bramer and Sedley, 1981: 539).

There are many punctuation commonly used by the writers. Swick

(2010: 127) identifies the punctuation marks in writing including:

period (.), question mark (?), exlamation point (!), comma (,), colon

(:), semi colon (;), parentheses (()), brackets ([]), apostrophe („),

hyphen (-), dash (_), double quotation marks (“ ”), and single

quotation marks („ „). This research only focused on the use of some

of the punctuations such as period or full stop (.), comma (,),

quotation mark (“..”), apostrophe („) and exlamation point (!).

because they are the most common punctuation used in the

descriptive text.

Spelling refers to the ability to write words into correct

letter. Every writer must write the words in the correct spelling to

avoid having miss understanding of the message that is conveyed in

writing. In summary the students have to write the words in correct

spelling and put correct punctuation to avoid misunderstanding of

the message which is conveyed in their writing.

Another mechanic element in writing is capitalization. It

deals with an act to write with a capital letter. Bailey (2003: 117)

notes that writing by using capital letters include the first word of a

sentence, titles, names of organization, days, months, nationality

 31

words and names of people or places. Besides according to Smith

(2009: 15), another word should be preceded with a capital letter are

pronoun I, names of holidays, names of cities, buildings, institutions,

trains, ships, and others modes of transportation. Therefore, when

students need to write those words, they must begin with a capital

letter.

4. The Purpose of Writing

Writing takes an important part in language learning process.

According to Richards (1997: 100), writing is used both as a means of

learning and as an evidence of successful learning. Meanwhile, Tribble

(1996: 4) said that writing is used to help learners focus on accuracy, to

consolidate the new language being learned into learners‟ selves, and to

develop literacy skill.

Another opinion about the purposes of teaching writing comes

from Harmer (1998: 79) he said that writing is taught for these

following purposes;

a. reinforcement: writing is used as an aid to committing the new

language to memory.

b. language development: writing is a part of on going to learning

experience.

c. learning style: writing helps learners to produce language in slow

way.
 32

d. writing, as a skill, writing is a basic language skill that should be

tought in order that leaners know how to put written reports together,

how to replay to advertisement, etc.

From these notions of the purposes of teaching writing, it can be

concluded that writing is taught as a means of reinforcement and

literacy skill development, as an aid to develop language, and as a

language skill it self.

The teacher need to make sure that students have some writing to

aim.. Efective writers usually have a purpose in mind and construct

their writing with a view to achieving that purpose.

The use of written language is aimed to convey information

accurately, effectively and appropriately (Richards, 1997: 101). A more

specific explanation about the purposes of written language is proposed

by McMahan et al (1996: 8). According to him writen language is used

for these following purposes:

a. to express the writer‟s feelings.

b. to entertain the readers through aesthetical materials.

c. to inform or explain or explain something to the readers

d. to persuade the readers about the writer‟s opinions, concepts, ideas.

The most effective learning of writing skills is likely to take place

when students are writing to real audiences, or at least when they are

performing tasks which they are likely to have to do in their out-of-class

life. The choice of writing tasks will depend, therefore, on why students
 33

are studying English. There are three main categories of learning which

it is worth considering:

d. English as a Second Language (ESL)

This term is normally used to describe students who are

living in the target language community and who need English to

function in that community on a day-to-day basis. Recent

immigrants and refugees, for example, will have specific writing

needs such as the ability to fill in a range of forms, or write

particular kinds of letters (depending upon their exact needs and

circumstances), alongside the need for general English

development

e. English for Specific Purpose (ESP)

Many students study English for a prticular (or specific)

purpose. People who are going to works as nurses in Britain or the

USA, for example, will study medical English. Those who are

going to study at an English-medium university need to

concentrate on the language of management and commerce, and so

on.

The choice of topics and tasks for such students should not

only develop their general language competence but also be

relevants to their reason for study. For example, writing tasks for

business students can have high face validaty if the students can

see that they will be writing in their professional life. Likewise

nurses in training, when asked to write up a simulated patient

 34

record in their English class, will clearly see the value of such a

task.

f. English as a Foreign Language (EFL)

This is generally taken to the students who are studying

general English at schools and institutes in their own country or as

transitory visitors in a target-language country. Their needs are

often not nearly so easy to pin down as the two categories we have

mentioned above.

While it is perfectly possible to ask school students what

their needs are or will be, it is unlikely that it will be easy to make

a list of any but the most general aims. In the case of adult

students, it is often hard to find writing task that are directly

relevant to the varying needs of a class full of students from

differnt backgrounds and occupations. Nevertheless, it may well be

possible to arrive at a set of task that is a useful compromise

between the competing claims of the individuals in a class.

Brookes & Grundy (1991: 3) state that the purposes of writing for

each person are different. The answer may be to get information to

someone. A second answer might be to solve the problem of volume, of

having to store more than the human brain can remember. The third

reason for writing might be to filter and shape our experience. So, based

on this statement, someone in writing activities has a purpose to get

their experience in the real world, from their imagination, to give

information, to solve the problem etc.

 35

The purpose of writing has some thing to do with the goals or aims

of writing. Thinking about the purpose of writing, a writer should think

to motivate people to write. There are four purpose of writing namely:

a. to express ideas

A witer expresses his feeling, espressions, personality,

likes, and disllikes in his writing in order to make readers

understand something within the materials.

b. to provide information

It means to give information and explain it. This purpose is

to focus an the materials being discussed.

c. to persuade readers

It means to convice readers about a matter of an opinion.

This also focuses on the readers‟ point of view.

d. to create literary work

It means that a work which is based on one‟s point of view

(opinion, attitude, and observation) of other matters occurring in

one‟s environment.

When the receiver of the communication does not physically

presents, writing is used. Except professional people like writers,

journalists, lawyer, teachers, etc. Others have very few occasions to

resort to this mode communication. Writing also fulfills a pedagogic

purpose in second language teaching. It is used to fix the structures and

vocabulary already learnt. Varghese (1990: 78) writes that the students

who learn to write English has not only to cope with the mechanical
 36

problems connected with the script of the language but also with the

problems of ease and fluency of expression, of grammatical and lexical

accuracy, and of the appropriateness of the style of writing as demended

by the occasion or situation.

According to Hampton (1989), some writes goals are as follow:

a. writers are independent when they are able to write without much

assistance.

b. writers gain comprehensibility when they can write so that it can be

read and understood by themselves and others.

c. writers are fluen when they are able to write smoothly and easily as

well as understandably.

d. writers gain creativity when they write their own ideas, not copying

what has already been written, so that they can be read and

understood.

In academic purpose, Byrne (1997: 10) states that there are five

pedagogical purpose of writing:

a. the introduction and practice of some form of writing enables us to

provide for different learning styles and needs.

b. written work serves to provide the learners with some tangible

evidence that they are making progress in the language.

c. exposure to the foreign language though more than one medium,

especially if skill are properly integrated, appears to be more

effective than on a single medium alone.

 37

d. writing providesvariety in classroom activities, serving as a break

from oral work.

e. writing is often needed for formal and informal testing.

5. The Reason of Teaching Writing

The most important reason for teaching writing is because writing

is the basic language skill. Byrne (1997: 6-7) gave the reasons of

teaching writing in the early stages. Writing serves a variety of

pedagogical purpose as follows:

a. The introduction and practice of some forms of writing enables the

learners to provide for different learning style and needs. Some

learners, especially those who do not learn easily through oral

practice alone, fell more secure if they are allowed to read and

write in the language. For such students, writing is likely to be an

aid to retention, if omly because they feel more at ease and relaxed.

b. Written work serves to provide the learners with some tangible

evidence that they are making progress in the language. It is not

likely to be a true index of their attainment, but it satisfied a

psychological need.

c. Exposure to the foregn language through more than on medium

appears to more effective than relying on a single medium alone.

d. Writing provides variety in classroom activities. It is increase the

amount of language contact through work that can be set out class.

e. Writing is often needed for formal and informal testing.

 38

6. Teaching Writing

Teaching is “work” of a teacher (Oxford Learner’s Pocket

Dictionary, 2003; 443). writing is “activity of writing” (Oxford

Learner’s Pocket Dictionary, 2003: 502). Based on the expert, Harris

(1993:45) states “writing is full of starts and stops, punctuate, by long

pause for reflection or by the need to regenerate concentration.” It can

be concluded that teaching writing is essentially important for students.

Raimes (1993: 3) gives the reason for teaching writing “we frequently

have to communicate with each other in writing and writing reinforce

grammatical structure, idioms and vocabulary. Teaching writing is a

unique way to reinforce learning”.

From the statement above, it can be concluded that written

exercises will generally be used simply to reinforce the learning of

specific grammatical points and lexical items. The later on, writing will

be treated as an end of a complex skill in involving the simultaneous

practice.

Four categories of written performance that capture the range of

written production are considered here. Each category resembles the

categories defined for the other three skills, but these categories, as

always, reflect the uniquenness of the skill area.

a. Imitative, to produce (based on) written language, the learner must

attain skills in the fundamental, basic tasks of writing letters,

words, punctuation, and very brief sentences. This category

includes the ability to spell correctly and perceive phoneme-

 39

grapheme correspondences in the English spelling system. It is a

level at which learners are typing to master the mechanics of

writing. At this stage, form is the primary if not exclusive focus,

while context and meaning are of secondary concern.

b. Intensive (controlled), beyond the fundamentals of imitative

writing are skills in producing appropriate vocabulary within a

context, collocations and idioms, and correct grammatical features

up to the length of a sentence. Meaning and context are of some

importance in determining correctness and appropriateness, but

most assessment tasks are more concerned with a focus on form,

and are rather strictly controlled by the test design.

c. Responsive, here, assessment tasks require learners to perform at a

limited discourse level, connecting sentences into paragraph and

crating a logically connected secuence of two or three paragraph.

Tasks respond to pendagogical directives, list of criteria, outlines,

and other guidelines. Genres of writing include brief narrative and

description, short reports, lab reports, summaries, brief responses to

reading, and is more focused on the discourse conventions that will

achieve the objectives of the written text. Form-focused attention is

mostly at the discourse level, with a strong emphasis on context

and meaning.

d. Extensive, extensive writing implies successful management of all

the processes and strategies of writing for all purposes, up to the

length of an essay, a term paper, a major research project report, or

 40

even a thesis. Writers focus of achieving a purpose, organizing and

developing ideas logically, using details to support or illustrate

ideas, demonstrating syntactic and lexical variety, and in many

cases, engaging in the process of multiple draft to achieve a final

product. Focus on grammatical form is limited to occasional editing

or proofreading.

7. The Writing Process

According to Harris (1993: 96), three are 4 essential steps of the

writing process namely pre-writing, drafting, revising, and editing.

a. Pre-write

Pre-write is also called planning. In this important first step

learners are given an opportunity to collect their thoughts and ideas

before committing pen to paper. They need time to develop ideas.

They may need time to read or undertake other form of research. In

pre-writing step, the learner begin digging for the basic raw they

need. They are expected to be able to formulate the purpose and

then organize the ideas. If the planning is done properly, it can case

the students to write without hesitation or worry.

b. Drafting

Drafting has aim to translate plans and ideas into a

provisional text. Drafting allows writers the flexibility to explore,

to make discoveries and to change their ideas (Harris 1993: 56).

Drafting allows writer to start producing their writing by

developing their ideas. It is often the cases that as writers proceed

 41

with creating a text, they come to redefine ideas, think of new

ideas, and perceive different and more significant way of

sequencing their ideas. The actual creation of a text is a process

that demands a great deal of concentration and application.

c. Revising

Revising is the process of seeing again, or discovering a

new division for the writing that the students produce during pre-

writing or drafting. Learners should employ various reading

strategies to help them rethink, reorder, and rewrite substantial

portions of what they have been written. Additional, bits of text can

be deleted, added or removed to a different place. Revising occurs

when a writer looks for feedback from a teacher or another student

(Vaca, and Grove, 1995: 107). At this stage, the learners get

revision from other people who have more knowledge on the topic

by adding, removing, rearranging, and replacing the sentences or

words. In this case, a teacher is the appropriate person who `knows

well about the topic has been written in order` that the students‟

work can be more logical and coherent.

d. Editing

When the decision is made and the draft is finished, there

remains the task of editing and publishing. Editing needs to be done

after revision. In this stage the learner know where the in-correct

words or sentences, and then they begin to edit their work. Editing

involves the careful checking of the text to ensure that there are no
 42

errors spelling, punctuation, word choice, and order. Sharing of the

work with other peers will help to keep motivation and

concentration. It encourages the self-help and independence that

attributes of mature and confidence

8. Problem in Writing

For most people, writing is considered as a difficult activity, both

in the mother tongue and in a foreign language. There are three heading

problems which are caused by writing according to Bryrne (1994: 4-5)

a. Psychological problem

Writing is essentially a solitary activity` and the fact that

people are required to write on their own draft, without the

possibility of interaction or the benefit of feedback, in itself makes

the act of writing difficult. Writers have no immediate feedback to

let them know how they are doing and whether they should change

their approach. There is no immediate between thr producer and

the receiver.

b. Linguistics problems

Different from oral communication the language used in

written language is either simplified (list, telegram, note, etc.) or

more elaborate, more formal. In a foreign language this process is

all the more difficult as there may be interference on a cultural

level, not just the linguistics, between mother tongue and the

foreign language.

c. Cognitive problems
 43

Writing is learned through process of instruction. The

written form of the language and certain structures, which are less

used in speech, should be mastered and learned the way to organize

the ideas is also important for effective communication which has

to be learned in writing.

9. Criteria for Good Writing

Fachruddin Ambo (1988:8) in his book Dasar-Dasar Keterampilan

Menulis states about the good writing: “the good writing is that can be

communicated effectively with the reader”.

Enre (1988:9-11) also states the criteria for good writing as follows:

a. Meaningful

Good writing must be able to convey something in which it is

meaningful to someone and can give the evidences about what it‟s

said.

b. Clear

It can be said as a clear writing if the intended reader can

read in constant speed and catch the meaning. Clear writing

shouldn‟t have been simple, but mustn‟t be more difficult than the

situation as it ought to be.

c. Coherent

Other characteristic of good writing is coherent it means

that the information is clearly connected and arranged. It has been

original systematically so the reader can follow the composition

easily.
 44

d. Economic

If the main purpose of the writer is giving information, she

should avoid pleonasm. In a good writing, the words used are

appropriate, and the sentences are clear, concise, emphatic, and

correct. So, it doesn‟t waste time by veering away from focus

without reason.

e. Cohesive

It means that the writing does not contain tons grammatical

patterns, substitution, elliptical construction, preposition,

conjunctions to relate among the clauses within paragraphs.

10. The Scoring Writing

There are many categories to score the students‟ composition text.

They are content, organization, vocabulary, language use, and

mechanics. Then, each of the categories has a rate score. According to

Hughes, A (2003: 101-102), the scoring of each component is as

follows:

Table 2.1 The Scoring of Writing

No Criteria Score

1 Content

- Few (if any) lack of substantive knowledge and 5

relevant to assigned topic.

- Some lack of knowledge and relevant to assigned 4

topic but do not impair communication.

- Frequent or lack of knowledge and assigned topic 3

 45

very frequent.

- Lack of knowledge and assigned topic very frequent, 2

readers own interpretation is needed.

- Lack of knowledge and assigned topic so severe as to 1

make communication impaired.

2 Organization

- Few (if any) organization and link to ideas. 5

- Some lack of ideas but do not impair communication. 4

- Lack of organization and link of ideas frequent; 3

reading is required for clarification ideas.

- Lack of organization and link of ideas frequent; 2

readers own interpretation is needed.

- Lack of organization and link of ideas so severe as to 1

make communication impaired.

3 Vocabulary

- Few (if any) inappropriate words. 5

- Use some inappropriate words but not interfere 4

comprehension.

- Use wrong or inappropriate words frequent, 3

expressing ideas limited.

- Use wrong or inappropriate words very frequent, rears 2

own interpretation is needed.

- Many inappropriate words, so limited as to make 1

comprehension impossible.
 46

4 Grammar

- Few (if many) errors of grammar or word order. 5

- Some errors of grammar or word order but do not 4

interface comprehension.

- Errors of grammar or word order fairly frequent; re- 3

reading is necessary for full comprehension.

- Errors of grammar or word order very frequent; 2

readers own interpretation is in needed.

- errors of grammar or word order so severe as to make 1

comprehension virtually impossible or not enough to

evaluate.

5 Mechanic

- Few (if any) wrong spelling, punctuation, and 5

capitalization.

- Some misspelling, capitalization, and punctuations but 4

do not interfere comprehension.

- Frequent misspelling, punctuation, and capitalization; 3

re-reading is necessary for full comprehension.

- Wrong spelling, capitalization, and punctuation very 2

frequent; readers own interpretation is needed.

- Wrong spelling, capitalization, and punctuation so 1

severe as to make comprehension virtually imposible

or not enough to evaluate.

 47

Formula Score:

Content + Organization + Vocabulary + Grammar + Mechanic =

Total.

Writing Score = Total x 100

25

From the explanation above those score would be classified by

using score level interpretation adapted from Djiwandono (1996: 156),

it concerned:

Table 2.2 The Classificasion of Students’ Composing Writing

Score in Descriptive Text

No Score Criteria Frequency %

1 80-100 Excellent Total Students Presentation

2 61-80 Good Total Students Presentation

3 41-60 Fair Total Students Presentation

4 21-40 Poor Total Students Presentation

5 <20 Failed Total Students Presentation

 48

B. Review on Descriptive text

1. The meaning of Descriptive Text

Oshima and Hogue (1977:50), define that descriptive writing

appeal to the senses, so it tells how something looks, fells, smells, testes

and/ or sounds. A good description is like a “word picture” the reader

can imagine the object, place or person in his or her mind.

According to Kane (2000:352), description is about sensory

experience how something looks, sound, tastes. Mostly, it about visual

experience, but description also deals with other kind of perfection.

From the description above, it can be concluded that descriptive

text that tell something looks like. Because of that, when the reader read

the descriptive text it can be “seen” clearly in the mind of the reader.

2. The Parts of Descriptive Text

Based on Zumakshin and Mufarichah (2004:9), there are some

language features of descriptive text. The language features are as

follows:

a. Communicative purpose: descriptive is a type of written text, which

has the function to give description about a particular person, place

or thing.

b. Generic Structure:

1) Identification : indentifies objects to be described.

2) Description : details description of part, qualities, and

characteristics.
 49

c. Language Focus

1) The writer are found in the topic of description. Example: My

classroom, my cat.

2) Adjective:

The writer are used to describe the characteristics of the

topic and the part. The characteristics of the topic and the part.

The characteristics can be the size, color or the quality.

3) Noun Phrases

The writer are combination of adjectives and nouns.

Example: two brown doors, a big and clean classroom.

4) Verb

The verbs usually used in a description are “have” (have,

has) “to be” (am, is are). The tense is the simple present tense.

3. The Social Function of Descriptive Text

Hartono (2005:206) states that function of descriptive text is to

give information. Contextual factor or social context of this text is

describing things. It can be person, animal or place (specific things like

our friend or person who we know them well). The social function of

description text is to describe particular person, place or things.

4. The Generic Structure of Descriptive Text

The generic structure of descriptive text

1. Identification it is a part of paragraph which introduces or identifies

the character.
 50

2. Description it is a part of paragraph which describes the character.

(Masruri, M. 2010).

The generic structure of descriptive text consists of identification and

description. Identification: Identifies phenomenon to be described.

Description: Describes parts, qualities, characteristics, etc. (Jenny

Hammond in Mursyid, M. PW, 2011)

5. The Example of Descriptive Text

Prambanan Tample

One of the most popular artifacts in Indonesia Is Prambanan, a

complex of temples which was built in 825 A.D. The central parts of

Prambanan complex consists of three main shries dedicated to the gods

of the trimurti.

The Temple of Siva stands in the center, that of Vishnu on the

north, and that of Brahma on the south. In front of each of these main

temples stands another smaller temple, constructed to contain a statue of

the mouth of each god. This ensemble is completed by two annexes, the

Candi Apit or flanking temples, and nine small shrines to shelter the

stones demarcating the compound whitin which the temple complex

stands.
 51

The central shrine rests on a projection from the base of Siva

Temple. This result in the complex‟s layout to be asymmetrical. The

central shrine is set against the south side of the east staircase leading to

the main sanctuary of Siva Temple.

The main terrace of Prambanan is Surrounded by four concentric

square of chapels on the lower.

 52

CHAPTER III

RESEARCH METHODOLOGY

This chapter discusses the method of this study. It covers research

design, research setting and participant, data collection techniques, and

data analysis technique.

A. Research Design.

In order to answer the research questions on howstudents‟ ability is

in writing descriptive texts in terms of schematic structure and linguistic

features, this study employed qualitative method. It was chosen since

qualitative method is used to comprehend social phenomenon from

participant point of view (Alwasilah, 2011). In association with qualitative

method, a qualitative case study is usedto discover meaning, investigate

the processes, and to gain in-depth understanding of an individual, group,

or situation (Lodico, Spaulding, andVoegtle, 2006).According to Cohen

and Manion ( in Nunan, 1992), a case study observes the characteristic of

an individual unit to probe deeply and to analyze the intensity of the

multifarious phenomena that constitute the life cycle of the unit with a few

to establishing the unit belongs. It provides a unique exampleof real people

in real situations, enabling readers to understand ideas more clearly than

simply by presenting them with abstract theories or principles (Cohen,

Manion, and Morrison, 2005)

According to Arikunto (1993:92)“the other terms for document

analysis are content analysis or information analysis”. In this research, the

 53

researcher analyzed student‟s writing ability in descriptive text of the tenth

grade at MAN 2 Boyolali.

B. Setting of the Research

1. Place

This research was conducted atMAN 2 Boyolali. A description, this

school is located in Jl.Simo-Bangak, Boyolali, Jawa Tengah.

2. Time of the Research

Time observation and research used to take data. This research will be

conduct on November-Januari 2016.

C. Subject of the Research

The subject of this study wasthe students class at tenth grade high

schoolinSimoBoyolali. This setting was chosen since this school is one of

favorite high schools in SimoBoyolali. The participants involved in this

study were a teacher and a class (XIPS2) consisted of 26students. All

students‟ writings were collected but only ten texts from five students

from low, and from high achiever from were analyzed in terms of

schematic structure and languages features. Tentexts sample were chosen

since in qualitative design, the quality of the samples is more important

than the number of samples DePaulo (2000).

D. Instrument

Arikunto (2002:160) argues that research instrument is a facility

used by the researcher to collect the data accurately, completely

systematically and easy to be analyzed. From the definition above, it can

be concluded that the instrument in a research is very important in order to

 54

get accurate data. Instruments that were used in this study to measure the

students‟ achievement in writing descriptive text are: observation,

interview and documentation.

E. Technique of Collecting Data

Based on the view Creswell (2009: 178) the techniques of

collecting the data in qualitative research involve four basic types. These

are observation, interview, documentation and audio-visual material

The object of the research is writing ability in descriptive text. In

this research explain how to collect data only one ways:

1. Document Analysis

Document means something either written of film researcher

doesn‟t prepare before or researcher doesn‟t take a role (Moleong,

2004:216-217). In this research the researcher took the main data from

the students‟ worksheets of writing descriptive text fromthe Intensive

class(XIPS2) of MAN 2 Boyolali in Academic Year 2016. The

researcher took 23 students‟ worksheet. The topics of students‟

worksheet above were about person, place, and thing.

2. Interview

Interview needed to get information from informant. Lexy

(2002:135) states that interview is a conservation which is done by two

people as interviewer and interviewee with certain purposes. The

purpose of the interview is to know about the problems that students got
 55

when they writing descriptive text and the teacher solutions for

students.

The researcher informant is Miss RinningS.Pd.I as the English teacher

of the second grade students in MAN 2 Boyolali in order to know how

the teacher teaches writing descriptive text in the class. The researcher

also interviewed some of students, about learning and difficulties

writing descriptive text.

3. Observation

Observation is a method to look something as object seriously and

continuously done by the researcher. This technique depends on the

direct observation and also watches the object doing by researcher

his/herself continually, then takes notes the behavior and the real event

which is happened (Moleong, 2004:174). During the process of

teaching and learning in writing descriptive text, the researcher

observed the process of teaching learning in the class from the

beginning until the end of the lesson. This technique used by researcher

to know how students write descriptive text and support the result of the

writing ability on composing descriptive text.

 56

F. The Technique of Analyzing Data

After collecting the data, data analysis will be done to analyze the

whole data obtained. In this research “qualitative descriptive research” will

be used. A qualitative method is kind of research without using any

calculation or statistic procedure.

Analyzing data refers to a method of treating the data that have

been collected by the researcher. It can ease the reader to understand the

essential meaning and important parts of the data. According to Miles and

Hubermean(in Sutopo 2002:95) stated that analyze the data, researcher

needs to go through some steps that is data reduction, data display,

conclusion, verification.

1. Data Reduction

Miles and Huberman (1992:16) states that the data reducing can be

interpreted as the process of selection, simplification and transformation of

the data to the field note. The data reduction was done during the research

activities. In this case, the researcher reduced the information during the

research activities of the data of the research. The research took the data of

the students worksheet of the students in writing descriptive text.

2. Data Display

Display of the data is a description of the data. As the second

component in analyzing the data, this technique was used in arranging

information, description or narration in order to draw conclusion.

Miles and Hubermean in Sugiyono (2010: 341) stated that, “the most
 57

frequent form of display data for qualitative research data in the past

has been narrative text”.

3. Conclusion and Verification

The researcher draw the data after describing and interpreting the data

continuously and throughout in the course of study as the outcome of

interpretation. The researcher interpreted the data which taken and then

make conclusion. The outcome of the study is the analysis ofthe

students‟ ability of writing descriptive text at tenth grade of MAN 2

Boyolali.

Collecting the Data

Reducing the Data Presenting the data

Conclusion: Drawing/ verifying

Figure 3.1 : Miles and Huberman’s flow mode

 58

Data reducing refers to the process of selecting, focusing,

simplifying, abstracting, and transforming the “raw” data that appear in

written-up field notes. As the researcher sees, data reduction

occurscontinously through-out the life of any qualitatively oriented

project.

The researcher defines a “display” as an organized and action taking

looking at displays helps the researcher to understand what is happening

and going to do based on understanding.

The last stages of analysis activity is conclusion drawing and

verification. It means that the researcher draws the conclusion of the data.

G. The Trustworthiness of Data

To avoid the bias data, the researcher uses the triangulation.

Triangulation is qualitative cross-validation. It assesses the sufficiency to

the data according to convergence of multiple data sources or multiple data

collection procedures, (WiliamWiersa in Sugiyono 2010: 372). It means

that in doing triangulation for getting the credibility there are source

triangulation, the technique of collecting data and time.

Triangulation is the most common way that is used in improving

data validity in qualitative research. Related to this, Patton (1984, in

Sutopo, 2006: 92) states that there are four kinds of triangulation

techniques, those are data triangulation, investigator triangulation, method

triangulation, and theory triangulation. In this research the researcher used

method triangulation.
 59

Method triangulation is a technique that can be done by the

researcher in collecting the same data by using different methods, and

checking the validity of the source data by using different method. So,

method triangulation in this research was done by comparing different data

which were obtained from different methods, namely observation and

interview. Those were used to answer the second problem statement about

the problem and solution in students‟descriptive text.

First, Investigator triangulation means asking to another people

who have bachelor and ninth semester to recheck the data validation. In

this triangulation the researcher asked to expert in writing to check the

students‟ worksheet. Second, Method triangulation means that in checking

the data validation of a problem, the researcher has to compare some

methods of collecting the data (observation interview, and documentation)

in order that the data collection is in the same place of portion. If there is a

different of data validation the researcher must reconfirm to the subject

and informant research. In this triangulation, the researcher compared

between the result of the observation with the result of interview. After the

researcher observed the teaching and learning process, the researcher

compared the result of observation with the result of the interview. The

researcher also compared between the result of interview and the result of

document.
 60

CHAPTER IV

RESEARCH FINDING AND DISCUSSION

In this section, researcher will present two things; research findings

and discussion. In research findings, after collecting the data from XIPS2 students

of MAN 2 Boyolali, researcher analyzed how the students composed descriptive

text. In discussion section, the researcher discusses the findings of the study with

the supporting concepts having been presented previously.

A. Research Findings

1. Analysis of the Student’s Writing Ability in Composing Descriptive

Text

Research findings present and discuss the answer of the research

problemcomposing writing descriptive text in the aspect of writing. Based

on the results of the analysis of 23 students‟ composing writing score in

descriptive text of the XIPS2 MAN 2 Boyolali it was found 15 students or

(65%) were categorized as excellent, 8 students (35%) were categorized

as good, and there was no students were categorized as fair, poor and

failed. The Student‟s writing ability in composing descriptive text was

scored based on the five aspects of writing. The are the contents,

organization, grammar, vocabulary, andmechanics.

Here the analysis of each aspects for each students:

written by A ZM (1)

Borobudur Temple
Borobudu is Hindu Budhist temple was build the nineth century under
sailendre dynasty of anceneamataramkingdome. Borobudur is located in
magelang central Java, Indonesia. Borobudur is well known all over.
The temple is cans tatitedan a hill 4.6mhigh and can sist of eight step like
stane terrace.
 61

1. The student‟s writing abililty in the aspect of Content

In the text, the researcher found that the student wrote a text related to the

topic that. He has chosen. It indicates that the student have known well

about the text and he was be able to deliver the messages of the text to the

readers.

2. The student‟s writing ability in the aspect of Organization

In this aspect, the student showed that his ability in generating idea into

well-organized was good. In indicates that the student have known well

about the text and he was able to deliver the messages of text to the

readers.

3. The student‟s ability in the Aspect of Grammar.

4. The student‟s writing ability in the aspect of Vocabulary

From the next worksheet, the researcher found that there were some

inappropriate words in the sentences did not refer to the meaning. There

were the some examples of inappropriate words used and the examples of

incorrect word spelling written by the students in the sentences “the temple

is cans tatitedan a hill 4.6 m high and can sist of eight step like stone

terrace”.

5. The student‟s writing ability in the aspect of Mechanic

In general, the Student‟s writing ability in this aspect was good enough. It

means the student has known well about the use punctuation,

capitalization and spelling. Although, he was able to used the correct

mechanic, he still made mistakes in using punctuation correctly. The

 62

following sentences are the examples of the students‟ mistakes in the

aspect of mechanics.

a. Borobudur is Hindu Budhist temple was build the nineth century under

sailendre dynasty of anceneamataramkingdome Borobudur is located in

magelang central Java, Indonesia Borobudur is well known all over.

b. the temple is cans tatitedan a hill 4.6 m high and can sist of eight step

like stone terrace

Written by A F

My friend
I have a girl friend. Her name is may Dhimas. She is a student in SMK BK
Simo.
The girl was born in Boyolali on 6 May 2001.she is tall. She has long hair,
flat nose and nice smile. She is beautiful.
She has Characteristics. Care, humorous, humble, loyal and Friendly. She
resides in pulerejo, kedunglengkang, Simo, Boyolali.
1) The student‟s writing ability in the aspect of content

In the text above, the researcher found that the student wrote the text

related to a genre of texts. That is descriptive text. He could make a

sequence event starting from the introduction to the depicted person to

general information about the person. Thus, he could deliver the point of

what he wanted to tell.

2) The student‟s writing ability in the aspect of organization

In this aspect, the student showed that her ability in this aspect was good

enough. The generic structures of descriptive text are identification and

description. In the text above, the student had elaborated the generic

structure into well-organized text. It started to the identification what the

student would describe then it was narrowed down into detailed

description.
 63

3) The student‟s writing ability in the aspect of grammar

In this case, the researcher focused on grammar structure aspect and tense

that is required in descriptive texts and the student had some grammar

mistakes in this text. The grammar mistakes are as follows:

a) On 6 May 2001, should be “on 6th May 2001”

b) She has characteristic, should be “She has the characteristics”

4) Student‟s writing ability in the aspect of vocabulary

From the text above, the researcher focused on diction or vocabulary and

the researcher found that the student had written some inappropriate

vocabularies as follows:

a) She has characteristic, care, humorous…, should be “She has

characteristics that she is care, humorous …”

b) She has long hair, flat nose and nice smile, should be “She has a long

hair, a flat nose and a nice smile.

5) The student‟s ability in the aspect of mechanic

These aspects are about capitalization, punctuation and spelling. In

general, the student‟s ability in this aspect was good enough. However,

there were some mistakes as follows:

a) The first sentence should be in capital like “her name is, should be “Her

name is”

b) A letter in words cannot be in capital if the words are in the middle of

sentence like “she is a Student, Loyal and Friendly”, should be “she is a

student, loyal and friendly”

 64

Written by AH

Prambanan Temple
Prambanan temple or CandiRoroJonggrang is a ninth-century hindu temple
located in centaral Java, Indonesia. And dedicated to the trimurti, the
expression of god as the creator (brahma) the preserver (Vishnu) and the
destroyer (shive). The temple compound is aproximately 17 kilometers
(11mil) north east of the city of Yogyakarta.
It is characterized by its height and pointed architecture, and the towering 47-
meter high (154ft) central buildira inside a large complex of individual
temples.

1.) The student‟s writing ability in the aspect of content

In the text above, the researcher found that the student wrote a text related

to the topic that he had chosen. It indicates that the student had known

well about the text and he was be able to deliver the messages of the text

to the readers.

2.) The student‟s writing ability in the aspect of organization

In this aspect, the student showed that his ability in generating idea into

well-organized was good. It indicates that the student have known well-

organized was good. It indicates that the student had known well about the

text and he was able to deliver the messages of the text to the readers.

3.) The student‟s writing ability in the aspect of grammar

In this aspect, the researcher focused on the Student‟s writing ability in

composing grammatically with the correct simple presenttenses,

adjectives, and complements. The researcher did not find any mistakes in

the sentences.

4.) The student‟s writing ability in the aspect of vocabulary

Fromthe text above, the researcher did not find that inappropriate words in

the sentences.
 65

5) The student‟s writing ability in the aspect of mechanic

In general, the Student‟s writing ability in this aspect was good. It means

the student had known well about the use punctuation, capitalization and

spelling.

Written by AEW

Younger brother
I have a younger brother, akbar. He was born in banjarnegara 25 agustus
2007.
He white skin. Hobby hem playing station. He like eat Bakso. He tall and he
cute he easy Angry but he gasy smile.
I not know printed cotton‟s but I‟m always love my younger brother. I‟m and
younger brother always quara but we now day will not agree because I‟m
cange to uncle home in boyolali.
1) The student‟s writing ability in the aspect of content

In the text above, the researcher found that the student wrote the text

related to the genre of the text. That is descriptive text. He could make a

sequence of events starting from the introduction to the depicted person to

general information about the person. Thus, he could deliver the point of

what he wanted to tell.

2) The student‟s writing ability in the aspect of organization

In this aspect, the student showed that her ability in this aspect was good

enough. The generic structures of descriptive text are identification and

description. In the text above, the student had elaborated the generic

structure into well-organized text. It started to the identification what the

student would describe. Then it was narrowed down into a detailed

description.
 66

3) The student‟s writing ability in the aspect of grammar.

In this case, the researcher focused on grammar structure aspect and tense

that required are in descriptive text and the student had some grammar

mistakes in this text. The grammar mistakes are as follows:

a) 25 agustus 2007. Should be “On 25th August 2007”

b) He white skin. Should be “He has a white skin.

c) hobby hem playing station, should be “His hobby is play station”

d) he like eat Bakso, should be “He likes eating Bakso”

e) He tall and he cute, should be “He is tall and he is cute”

f) he easy angry but he easy smile, should be “ He is easy to be angry, but

he is easy to smile”

g) I not know printed cotton‟s, but i‟m always loveshould be “I don‟t

know printed cotton’s, but I always love…”

h) i‟m and younger brother always quarrel, should be “My younger

brother and I always have quarrel.

i) My uncle home, should be “My uncle‟s home”

4) Student‟s writing ability in the aspect of vocabulary

From the text above, the researcher focused on diction or vocabulary and

the researcher found that the student had written some inappropriate

vocabularies as follows:

a) I‟m came to my uncle home, should be “I went to my uncle‟s home”

b) We nowaday will not agree because, should be “Nowadays, he did not

agree with me because”

 67

5) The student‟s ability in the aspect of mechanic.

These aspects are about capitalization, punctuation and spelling.In general,

the student‟s ability in this aspect was good enough. However, there were

some mistakes as follows:

a) Tittle requires capital each word or the rest of the word. The phrase my

younger brother, “ should be written My Younger Brother”

b) Name must be in capital. akbar, should be “Akbar”

c) The first sentence should be in capital. “he was born, he white skin,

hobby hem playing, he like eat, I‟m younger brother”, should be “He

was born, His skin is white, His hobby is playing, He likes eating, My

younger brother and I”

d) The name of regency must be in capital. “boyolali”, should be

“Boyolali”

Written by D SS

YOUNGER SISTER
I have a younger sister. Latifa. She was bron in Surakarta, 26 July 2009
She white skin, pointed nose, and straight hair.
hobby She‟s playing.
She like eat Bakso. She tall and she cute
She easy angry but easy smile.
her Father‟s is = agussriyanto
her mother‟s is = LastriHidayati
Her younger brother = Hammam
Latifa resides in south Terikwarung, Surakarta. She is a student of TK aisyiah
Surakarta.
1. In the text above, the researcher found that the student wrote a text related

to the descriptive text. She told about her young sister named Dina Septika

Sari

2. The student‟s writing ability in the aspect of Organization.

-
 68

3. The student‟s writing ability in the aspect of Grammar

a. She white skin should be She has white skin

b. hobby She‟s playing should be Her hobby is playing

c. She like eatBakso should be She likes to eat Bakso

d. She easy angry but easy smil should be She easy to angry but easy to

smile

e. her Father‟s is = agussriyanto should be her Father‟s name is

agussriyanto

f. her mother‟s is =LastriHidayati should beher mother‟s name is

LastriHidayati

g. Her younger brother = Hammam should be Her younger brother is

Hammam

4. The student‟s writing ability in the aspect of Vocabulary

5. The student‟s writing ability in the aspect of Mechanic

a. I have a younger sister. Latifa. Shoul be I have a younger sister, Latifa

b. her Father‟s is = agussriyantoShoul be Her Father‟s is AgusSriyanto

c. her mother‟s is = LastriHidayati. Shoul be Her mother‟s is

LastriHidayati.

d. Her younger brother =HammamShoul be Her younger brother

Hammam

Written by IN

My Sister n‟my eider brother favorite

I have a sister, shofinurchofifah, she was born in 25 december 1995,
semarang, central java, Indonesia. Now she university UIN Walisongo, I‟m
 69

pround have a sister as she. I want become as she, to be success. She body
tall, beauty, nose pointed, diligent. Now she become teacher in semarang.
And I‟m have a elder brother too, Ahmad wantoha he ever unevercity in
UGM Yogyakarta. He very smart and diligent. I pround have two sister n
elder brother as she he.

1) The student‟s writing ability in the aspect of content

In the text above, the researcher found that the student wrote the text

related to a genre of texts. That is descriptive text. He could make a

sequence of events starting from the introduction to the depicted person to

general information about the person. Thus, he could deliver the point of

what he wanted to tell.

2) The student‟s writing ability in the aspect of organization

In this aspect, the student showed that her ability in this aspect was good

enough. The generic structures of descriptive text are identification and

description. In the text above, the student had elaborated the generic

structure into well-organized text. It started to the identification what the

student would describe then it was narrowed down into detailed

description.

3) The student‟s writing ability in the aspect of grammar

In this case, the researcher focused on grammar structure aspect and tense

that required in descriptive text and the student had some grammar

mistakes in this text. The grammar mistakes as follows:

a) now she university, should be “now her university”

b) I‟m proud have a sister as she, should be “I‟m proud of having a sister

like her”

c) I want become as she, should be “I want to be like her”

 70

d) She body tall, beauty, nose pointed, should be “Her body is tall. She is

beautiful. She has a pointed nose”

e) Now she become, should be “She have become a teacher now”

f) I‟m have, should be “I have”

g) He ever university, should be “he has ever studied at university”

h) He very smart, should be “he is very smart”

i) I proud have two sister n‟ elder brother as she he, should be “I proud of

having two sister and brother like them.

j) I have a elder brother, it must be “I have an elder brother”

k) I pround have, should be “I am proud of you”

4) Student‟s writing ability in the aspect of vocabulary

From the text above, the researcher focused on diction or vocabulary and

the researcher found that the student had written some inappropriate

vocabularies as follows:

a) Sister n‟ elder brother, should be “sister and elder brother”

b) The first letter of the word in sentence must be in capital. The mistakes

as follows: “she was born, he ever university, he very smart”. They

must be corrected into “She was born, He had ever studied at university,

He is very smart”.

c) The tittle My sister n‟ my elder brother favorite, should be “My sister

and My elder brother”

d) To be success, should be “to be successful”

 71

5) The student‟s ability in the aspect of mechanic

These aspects are about capitalization, punctuation and spelling. In

general, the student‟s ability in this aspect was good enough. However,

there were some mistakes as follows:

a. The first paragraph cannot be conjunction like “and I‟m have”, should

be just “I have”

b. “elder Brother”, should be “elder brother”

Written by JR

My friend
I Have friend. She‟s name is NovitaMawarni. She is school in SMA N 1
KLEGO. Now She‟s Class X IPS 2 with Me But I am school in MAN 2
BOYOLALI. Adreee Home‟s in Pancuran, Sempulur, Karanggede.
She‟s was born in Boyolali 30 november 2001.
I with She Past be friend near four Years, I with She very near.
that‟snovita like eat SOTO, MIE AYAM, AND BAKSO.
Physical appearance novita is Beautiful, Wavy Hair, Black eyes, oval face,
flat nose, fussy Big Body.
Personality Characteristic novita Active, Humorous, agresive.
1. In the text above, the researcher found that the student wrote a text about

her closefriend. Her name is NovitaMawarni.

2. The student‟s writing ability in the aspect of organization

3. The student‟s writing ability in the aspect of grammar.

a. I have friend should be I have a friend

b. She‟s name is NovitaMawarni should be She is NovitaMawarni or her

name is NovitaMawarni.

c. Now She‟s Class X IPS 2 with Me But I am school in MAN 2

BOYOLALI should be Now she is in Class X IPS 2 with me, but I am

school in MAN 2 BOYOLALI

 72

d. Adreee Home‟sinPancuran, Sempulur, Karanggede should be Her

address is in Pancuran, Sempulur, Karanggede.

e. She‟s was born in Boyolali 30 november 2001 should be She was born

in Boyolali 30 november 2001

f. I with She Past be friend near four Years, I with She very near should

be, We were being friend for four years, I‟m closed with her.

g. that‟snovita like eat SOTO, MIE AYAM, AND BAKSO should be She

likes to eat SOTO, MIE AYAM, AND BAKSO.

h. Physical appearance novita is Beautiful, Wavy Hair, Black eyes, oval

face, flat nose, fussy Big Body should be Her physical appearance is

Beautiful, Wavy Hair, Black eyes, oval face, flat nose, fussy Big Body.

i. Personality Characteristic novita Active, Humorous, aggressive should

be Her Personality Characteristic is Active, Humorous, and aggressive.

4. The student‟s writing ability in the aspect of Vocabulary

a. I with She Past be friend near four Years, I with She very near should

be “We were being friend for four years, I‟m closed with her”

b. Physical appearance novita is Beautiful should be “She is Beautiful”.

c. Personality Characteristic novita Active, Humorous, aggressive should

be “She also Active, Humorous, aggressive”.

5. The student‟s writing ability in the aspect of mechanic

a. My friend should be My Friend

b. I Have friend should be I have a friend.

 73

c. Now She‟s Class X IPS 2 with Me But I am school in MAN 2

BOYOLALI should be Now she is in Class X IPS 2 with me, but I am

school in MAN 2 Boyolali.

d. that‟snovita like eat SOTO, MIE AYAM, AND BAKSO should be

That‟s Novita like eat Soto, Mie Ayam, And Bakso.

e. Physical appearance novita is Beautiful, Wavy Hair, Black eyes, oval

face, flat nose, fussy Big Body should be Physical appearance Novita is

beautiful, wavy hair, black eyes, oval face, flat nose, fussy big body.

f. Personality Characteristic novita Active, Humorous, agresive should be

Personality characteristic Novita active, humorous, agresive.

Written by LRD

Dina Septika Sari

Dina Septika Sari is a student. She clever. The Little lady was born in
Boyolali on 20 September 2001. She is short but good looking.
She always to depart school with motorcycle. She has brown Skin Pointed
nose, and wary hair. Her Father‟s name is Sartono. Her mother‟s name is Sri
Lestari. Her younger brother name is Hanafi.
Dina resides in South tlogo, Demangan, Sambi, Boyolali. She is a Student of
MA Negeri 2 Boyolali.
1. In the text above, the researcher found that the student wrote a text about

her friend, named Dina Septika Sari.

2. The student‟s writing ability in the aspect of organization

3. The student‟s writing ability in the aspect of grammar

a. She clever.

b. She always to depart school with motorcycle.

In this aspect, the student ability in grammar was good. It can be seen

from her writing. There were just two mistakes. In the first point, she
 74

should insert is (to be) after “She” (Noun). In the second point was the

use of „always‟ or „adverb of frequency‟. If there was a verb in the

sentence, the use of adverb of frequency is written before the verb. The

form is: Subject + adv of frequency + verb. So, the correct sentence is

„She always departs to school‟.

4. The student‟s writing ability in the aspect of vocabulary

She always to depart school with motorcycle.In the sentence above, the

word „to depart‟ would be better by using „go to‟.

5. The student‟s writing ability in the aspect of mechanic

a. The Little lady was born in Boyolali on 20 September 2001shoul be

The little lady was born in Boyolali, on 20 September 2001..

b. She has brown Skin Pointed nose, and wary hairshoul be She has brown

skin pointed nose and wary hair..

Written by NM S

My Father
My father name is Juwarna. The was born in Boyolali on 17 Agustus 1985.
He is short but good looking. He have brown skin, nose pointed, and general
aspect a handsome. Her father‟s name is Bader, her mother‟s name is Aisyah.
My father is a buruhblagung. He to work buruh same buruh-buruhother.He to
work in morning.
My father like is a food vegetable. He like is a drink copy
1. The student‟s writing ability in the aspect of content

In the worksheet, the researcher found that the student wrote a text related

to the topic family that she had chosen. She told her family about her

father. She explained the content sequentially. From the text, she explained

the identification and the description.

 75

2. The student‟s writing ability in the aspect of organization.

In this aspect, the student showed that her ability in generating idea into

well-organized composition was good. It indicates that the students had

known well about the descriptive text. She was able to deliver the

messages to the readers. But, in the description of the text she decreased

some sentences.

3. The student‟s writing ability in the aspect of the grammar.

In this aspect, the researcher focused on the Student‟s writing ability in

composing grammatically with the correct simple present tenses,

prepositions, and auxiliary verbs because those grammatical errors were

often made by the students in writing. The researcher found some

following mistakes in the sentences:

a. The was born in Boyolali on 17 Agustus 1985 should be, he was born in

Boyolali on 17 august 1985.

b. He have brown skin should be he has brown skin.

c. Nose pointed and general aspect a handsome.her father‟s name is bader.

d. He to work buruh same buruhburuhother should be he goes to work

place like another worker.

4. The student‟s writing ability in the aspect of vocabulary.

From the text, the researcher found that the vocabulary was inappropriate.

It can be seen in the following sentence:

a. Nose pointed and general aspect a handsome.her father‟s name is bader

should be nose pointed and general aspect handsome should be he has

nose pointed and handsome.

 76

b. He to work buruh same buruhburuhother should be he goes to work

place like another worker.

c. He to work in the morning should be he goes to work.

5. The student‟s writing ability in the aspect of mechanic.

In general, the Student‟s writing ability in this aspect was good. It means

the student had known well about the use punctuation, capitalization and

spelling. The common mistakes, the students commonly made

werecapitalization in each sentence.

Written by SJK

My Friend
My friend name is Tiara, Tiara aulia. She‟s and I old friend from Junior High
School.I happy together you everyday.
She‟s short but good looking, and beautiful, best liver, patient. Straight hair
and round face. born in Boyolali November29 2000. She‟s very smart
student.
She‟s to stay in Jayan, Senting, Sambi, Boyolali. She school in Senior high
school 1 Sambi. I very love you.
1. In the text above, the researcher found that the student wrote a text about

Tiara Aulia. Tiara Aulia is her friend since they were in Junior High School.

2. The student‟s writing ability in the aspect of organization

3. The student‟s writing ability in the aspect of grammar

a. My friend name is Tiara, Tiara aulia should beMy friend‟s name is

Tiara, Tiara Aulia

b. She‟s and I old friend from Junior High School should be We were

being friend from Junior High School

c. I happy together you everyday should be I‟m happy together with her

every day
 77

d. born inBoyolali November29 2000 should be She was born in Boyolali

November29 2000

e. She‟s to stay inJayan, Senting, Sambi, Boyolal should beShe lives in

Jayan, Senting, Sambi, Boyolali

f. She school in Senior high school 1 Sambi should be She is school in

Senior high school 1 Sambi

g. I very love you should be I love her very much

According to statements above, The student‟s writing ability in the

aspect of grammar was still low. There was a mistake in every sentence.

4. The student‟s writing ability in the aspect of vocabulary.

She‟s to stay in Jayan, Senting, Sambi, Boyolali.It better if the word „to

say‟ changed with „lives‟.

5. The student‟s writing ability in the aspect of mechanic

“born in Boyolali November29 2000. She‟s very smart student”.In this

aspect, the student ability was god. There was a mistake about

capitalization. The use of letter “B” in the word born should be capitalized.

Written by S

MY Friend
ZAINAL MA‟ARIF
ZAINAL MA‟ARIF is a student. She smart
The little dog was born in Boyolali on 21 Desember 2000. She is hair long,
flat nose, Chubby Cheek, Skin Black
She always to depart school with Motorcycle
Her father‟s name is Nururudin
Her mother‟s name is Tukiyem
Her younger sister‟s name is Aldi
Zainal resides in South Plugo, Karanggede,Boyolali She is a Student of SMK
6 Muhammadiyah
1. In the text above, the researcher found that the student wrote a descriptive

text. She told about his friend, named ZainalMa‟arif who lives in Plugo.
 78

2. The student‟s writing ability in the aspect of Organization

3. The student‟s writing ability in the aspect of Grammar

a. He smartshoul be She is smart

b. He is hair long, should be She haslong hair

c. He always to depart school should be She always depart to school

4. The student‟s writing ability in the aspect of Vocabulary

a. She always to depart school with Motorcycle should be She always go

toschool by Motorcycle

b. Zainalresides in South Plugo, Karanggede, Boyolalishoul be Zainal

lives in South Plugo, Karanggede, Boyolali

5. The student‟s writing ability in the aspect of mechanic

a. MY Friend should beMy Friend

b. ZAINAL MA‟ARIFis a student should be ZainalMa‟arif is a student

c. He is hair long, flat nose, Chubby Cheek, Skin Black should be He is

hair long, flat nose, chubby cheek, black skin

d. He always to depart school with Motorcycle should be She always to

depart school with motorcycle.

Written by ON

My Friend
My friend name is via, via puspitasari. She is started my friend when class
one SMP. She born in Boyolali on 29 July 2001. She is she is good looking.
She has brown skin. Pointed nose and nice smile.
Her father‟s name is sopyan. Her mother‟s is SitiNurjanah. She has two
brothers. Her old brother‟s name Rizki. Her young brother‟s name is M.
Rizal.
She like playing musical instrument, and singing.She favorite food is
NasiGoreng and favorite drink is Strawberies juice.
 79

1) The student‟s writing ability in the aspect of content

In the text above, the researcher found that the student wrote the text

related a genre of texts. That is descriptive text. She could make a

sequence of events starting from the introduction to the depicted person to

general information about her. Thus, she could deliver the point of what

she was disposed for telling.

2) The student‟s writing ability in the aspect of organization

In this aspect, the student showed that her ability was good enough. The

generic structures of descriptive text are identification and description. In

the text above, the student had elaborated the generic structure into well-

organized text. It started from the identification what the student would

describe then it was narrowed down into a detailed description.

3) The student‟s writing ability in the aspect of grammar

In this case, the researcher focused on grammar structure aspect and tense

that are required in descriptive text and the student had some grammar

mistakes in this text. The grammar mistakes are as follows:

a) My friend name, should be “my friend‟s name”

b) She is started, should be “started”

c) She born, should be “she was born”

d) On 29 July 2001, should be “on 29th July 2001”

e) She is she is good looking, should be “she is good looking”

f) She like playing, should be “she likes playing”

g) She favorite food, should be “her favorite food”

h) Favorite drink, should be “her favorite”

 80

i) She has brown skin, pointed nose and nice smile, should be “She has a

brown skin, a pointed nose and a nice smile

j) Her brother‟s name Rizki, should be “Her brother‟s name is Rizki”

k) Strawberies juice, should be “Strawberry Juice”

4) Student‟s writing ability in the aspect of vocabulary

From the text above, the researcher focused on diction or vocabulary and

the researcher found that the student had written some inappropriate

vocabularies as follows:

a) “When class one SMP”, should be when “my friend was at the first

grade in junior high school”

b) “Nasi goring”, should be “fried rice”

5) The student‟s ability in the aspect of mechanic

In general, the student‟s ability in this aspect was good enough. However,

there were some mistakes as follows:

a) My friend name is Via, ViaPuspita Sari, should be just “my friend‟s

name is Via Puspita Sari”

b) Her father‟s name is Sopyan, Her mother‟s… ,should be “Her father‟s

name is Sopyan. Her mother‟s…

c) Favorite Drink, should be “favorite drink”

d) Strawberies Juice, should be “strawberry juice”

Written by UP L

My Sister
FebrianaSurviatin
Febrianasurviatin is a young talented singer, cooking.
The little lady was born in Boyolali on 27 february 1999. She is short but
good looking. She has brown skin, flat nose and nice smile. Her chuby cheek
makes her face is easy to remember.
 81

Her father‟s is Suradi. Her mother‟s name is supriahatin.

Febri resides in Boyolali. She is a Student of SMA TarunatamSalatiga.
1) The student‟s writing ability in the aspect of content

In the text above, the researcher found that the student wrote the text

related to a genre of texts. That is descriptive text. He could make a

sequence of events starting from the introduction to the depicted person to

general information about the person. Thus, he could deliver the point of

what he wanted to tell.

2) The student‟s writing ability in the aspect of organization

In this aspect, the student showed that her ability in this aspect was good

enough. The generic structures of descriptive text are identification and

description. In the text above, the student had elaborated the generic

structure into well-organized text. It started from to the identification what

the student would describe then it was narrowed down into a detailed

description.

3) The student‟s writing ability in the aspect of grammar

In this case, the researcher focused on grammar structure aspect and tense

that are required in descriptive text and the student had some grammar

mistakes in this text. The grammar mistakes are as follows:

a) “On 27 February 1999”, should be “on 27th February 1999”

b) Her chubby makes her face is easy to remember, should be “Her

chubby makes her face easy to remember”

c) “She has long hair”, flat nose and nice smile, should be “She has a long

hair, a flat nose and a nice smile.

 82

4) Student‟s writing ability in the aspect of vocabulary

From the text above, the researcher focused on diction or vocabulary and

the researcher found that the student had written some inappropriate

vocabularies as follows:

a) FebrianaSurviatin is a young talented singer, cooking, should be

“FebrianaSurviatin is a young talented singer and cooker”

b) SMA Taruma tama Salatiga, should be “The Senior High School of

Taruma Tama in Salatiga”

5) The student‟s ability in the aspect of mechanic

These aspects are about capitalization, punctuation and spelling. In

general, the student‟s ability in this aspect was good enough. However,

there were some mistakes as follows:

a) The first sentence should be in capital like “her chubby cheek, her

parent‟s name, her mother‟s name”, wichshould be “Her chubby cheek,

Her parent‟s name, Her mother‟s name”

b) A letter in words cannot be in capital if the words are in the middle of

sentence like “she is a Student, Loyal and Friendly”, should be “she is a

student, loyal and friendly”

c) Febri resides in boyolali, she is a student, should be “Febri resides in

Boyolali. She is a student…”

 83

2. The Difficulties Faced by the Student’s in Composing Descriptive Text.

From the research findings above itis found that the students had

difficulties in many aspects descriptive text that is:

a. The students still difficulties in arranging the sentences. In the document

it can be seen on Andriya‟s text on the sentence “Andriya‟s”. It can be

concluded that she could not arrange the sentence correctly. On the

sentence, the word “hobby hem” should be deleted, after the word “day”

should be changed His hobby.

It can be seen from the Jovika‟s in the text above, the researcher found that

the student wrote a text about her close friend. Her name is Novita

Mawarni.

b. The students were still lack of vocabulary It can be seen from the

Andriya‟s text in the sentence “I‟m cange to my uncle home, should be “I

went to my uncle‟s home”. The word “cange” should be that changed into

“went”.

It can be seen from the Jovika‟s “I with She Past be friend near four Years,

I with She very near” should be “We were being friend for four years, I‟m

closed with her”

c. The students did not master the grammar well It can be seen on the

Andriya‟s text in the sentence “He white skin” which should be “He

has a white skin”.

It can be seen from the Jovika‟s “She‟s name is Novita Mawarni should be

She is Novita Mawarni or her name is Novita Mawarni”.

 84

B. Discussion

1. Analyzing the Student’s writing ability in Composing Descriptive Text.

The following discussion explain about the research findings covering

XIPS2 MAN 2 Boyolali students‟ composing writing descriptive text in the

aspect of writing, and the discussion of the results of this research based on some

related theories. The researcher observed the teaching and learning process in

writing descriptive text. XIPS2 class consisted of 27 students, but when the

researcher did the observation 4 students did not join the class. In the teaching

and learning process, the teacher told the students about descriptive text, but as the

researcher observed the teacher did not teach about the theory of the writing

process. Based on the observation of the researcher the students wrote the text by

using free writing process. The teacher asked the students to write descriptive text

about vacation. The researcher analyzed the students‟ worksheets from the

teacher. To encourage the observation, the researcher showed and analyzed the

students worksheets of writing descriptive texts by using Hughes theory. The

researcher found the research finding, as follows:

Table 4.1 of Student‟s Composing Writing Score

No Name Assessor Assessor Score Criteria

I II
1 A ZainalMa‟ruf 80 82 81 Excellent
2 Ainunnisa Farah 76 76 76 Good
3 AldiHidayat 92 92 92 Excellent
4 Andriya Elisa Warda 72 72 72 Good
5 ArvianAdi s 64 64 64 Good
6 Dina Septika Sari 88 84 86 Excellent
7 HappytaQurrota A 96 92 94 Excellent
8 IinNurSafrina 64 68 66 Good
9 JovikaRamadhani 92 88 90 Excellent
10 LiaRatnaDewi 96 92 94 Excellent
11 Muh. Nurrodin 84 80 82 Excellent
12 Muhammad Anang M 88 92 90 Excellent
 85

13 Muhammad Yoga A 88 84 86 Excellent

14 M FahrurRohman F 92 96 94 Excellent
15 NisaMaulianaJari 88 88 88 Excellent
16 OktaviaNingrum 76 72 74 Good
17 PutriRahmawati 88 84 86 Excellent
18 SyafiraJihanKamila 84 92 88 Excellent
19 Syaifullah 84 84 84 Excellent
20 UnikPuji L 76 76 76 Good
21 UswatunChasanah 80 84 82 Excellent
22 Wahyuana A. M 76 76 76 Good
23 Yudistira 64 64 64 Good

Table 4.2 The Classification of Student‟s writing ability in

Composing Descriptive Texts on Score

No Score Criteria Frequency %

1 80-100 Excellent 15 Students 65%
2 61-80 Good 8 Students 35%
3 41-60 Fair - -
4 21-40 Poor - -
5 <20 Failed - -
Total 100%

From the tables above it can be reported that 15 students or

(65%) were categorized as excellent, 8 students (35%) were categorized

as good, and there was no studentwho were categorized as fair, poor and

failed. Most students got Excellent scores. It means that the half of

students got the score between 81 to 100. It can be considered that the

MAN 2 Boyolali students ‟composing writing were Excellent in the result

of students‟ descriptive text writing showed the range of percentage were

mostly in excellent category.

 86

2. The Difficulties by the Students in Composing Descriptive Text.

Based on the research finding above, the researcher finds that there

are some causes of students‟ difficulties in descriptive text in XIPS2 class

MAN 2 Boyolali. The result of the observation and interview shows the

difficulties that most of the students do not completely the three element of

writing:

a. The students still faced difficult in arranging the sentences.

b. The students were lack of vocabulary.

c. The students did not master grammar the tenses well.

Based on the interview to the students, the students tried to solve their

problems by asking to the teacher about their difficulties, opening the

dictionary, and joining private course.

 87

CHAPTER V

CONCLUSIONS AND SUGGESTIONS

A. Conclusions

In this chapter, the researcher comes to conclude this research. Based on

the result of the students‟ worksheet in writing descriptive text and the discussion

presented in the previous chapter, it can be concluded that the XIPS2 students‟

writing ability in composing descriptive text at MAN 2 Boyolali in the academic

year 2016/2017.

The students wrote the text used free writing. Based on the result of the

analysis 23 students writing scores in the XIPS2 of MAN 2 Boyolali, it was found

that15 students or (65%) was categorized as excellent, 8 students (35%) were

categorized as good, there was no students were categorized as fair, poor and

failed. It showed that the ability of the XIPS2 students of MAN 2 Boyolali was

generally Excellent.

The difficulties in writing descriptive text faced by the students ware in

arranging the sentences, lackin vocabulary, low mastery of grammar well.To solve

their problems above the students asking the teacher, opening the dictionaries, and

joining the private courses.

 88

B.Suggestions

After analyzing the data and making conclusion, the researcher has some

suggestions for teacher, students, and the next researchers, as follows:

1. For the English Teacher

a. The English teacher is suggested to give the students more practice in

writing in order to improve the students‟ writing ability.

b. The teacher should be more creative in teaching, and using media when

He teach.

c. The teacher also should teach about the theory of writing process in

order that the students will be able to produce a good writing.

2. For the Students

a.They need to improve their ability in grammar, mechanic, and

vocabulary andalways try to improve their abilities, especially in

writing skill by starting to write. Students may write everything, it may

be short stories.

b. Students shouldalso read books, magazines or anything else. After

reading, they should write down the new vocabularies they have fond,

then develop them into sentences, and paragraphs. Or when the teacher

have given the students the theory of writing process, they should use it

in order to make a good writing.

3. For the Next Researcher. The result of this research can be used as

additonal reference for the research. They are able to conduct other

research relating to the students‟ability its in writingdescriptive

textsinorder that the students” ability in writing descriptive text can be

 89

improved. Further, they also able to apply certain teaching techniques,

media in teaching writing, or teaching methods in order to know the

effectiveness in the process of the teaching-learning in writing skill.

 90

Bibliography
Al-Khasawneh, Fadi Maher. 2008. Error Analysis of Written English Paragraphs
by Jordanian Undergraduate Students: A Case Study. International
Journal on Studies in English Language, Literature and Humanities.
Ajloun National University: Jordan.

Anderson, mark and Anderson, Cathy, Text Types in English.(new

york)Maimillan, 1997)

Arikunto, Suharsini.2006. Procedure Penelitian Suatu Pendekatan Praktek, PT.

Rineka Cipta, Jakarta.

Brown, H. Douglas1980. Principles of Language Learning and Teaching. New

Jersey: Prentice-Hall, Inc.

Brown, H. D, 2001. Teaching by principles: An Interactive Approuch to

Language Pedagogy. Second Edition, San Francisco State University.

Brown, H. Douglass. 2004. Language Assessment Principle And Classroom

Practice . San Frasisco: Longman.

Byrne, donn. 1997. Teaching Writing skills. New York: longman, Inc.

Byrne, Donn.1997. Teaching Writing Skill. London: Longman Group UK.

Derewianka, B.Exploring How Texts Work.1990. Sydney: Primery Teaching.

Association.

Depdiknas. 2006. Permendinas RI No 22 Tahun 2006 Tetang Standar Isi. Jakarta:

BSNP

Djiwandono, M. S. 1996. Tes Bahasa Dalam Pengajaran. Bandung: ITB.

 91

Fauziati, Endang. 2009. Reading on Applied Linguistics: A Handbook for

Language Teacher and Teacher Researcher. Surakarta: Era Pustaka.

Gerot, linda and Wignell, Peter. 1994. Making Sense of functional Grammar.
Sydney: GerdStabler.

Harmer, Jeremy. 1998.How to Teach English: an introduction to the practice of

English Language Teaching. England: addison Weslay longman limited.

Harmer. 2004. How to Teach Writing. England: Addison Wesley Longman

Limited.

Harris, John. 1993. Introduction Writing London: Allen and Unwinx.

Hornby, A. S.1995.oxford advanced Learners’ Dictionary of Current English,

Huberman, A. M. Miles M. B. 1984. Data Management and analysis Method. In

Prof. Dr Emzir, M.Pd. Methode Penelitian Kualitatif : Analysis Data.
Jakarta: PT Rajagrafindo Persada.

Hughes, A. 2003. Testing For Language Teacher. (Second Edition). New York:
Cambridge University.

Hyland, Ken, Genre and Second Language Writing, (London: University of

Michigan Press,2004).

Mark, Joy, Cathy, Ann. 1997. Text, Role and Context. Australia: Cambridge
University Press.

Moleong, Lexy J. 1990. Metodology Penelitian Kualitatif. Bandung:PT Remaja

Rosdakarya.
 92

Nunan, David. 1998. Designing Task for the Communicative Classroom. Boston:
Heile & Heinle Publishers.

(Oxford : Oxford Uneversity Press, 1974).

Oxford Learner’s Pocket Dictionarry : third Editing.2003, Oxford: Oxford

University Press.

Oxford Advanced learner’s Pocket Dictionary.2008, Oxford: Oxford University

Press.

Oshima, A. and A.Hogue.1977.Introduction to Academic Writing (2nd Ed). New

York: Pearson Education.

Ricards, J.C., and W.A. Renandya. 2002. Methodology in Language Teaching:

Anthology of Current Practice Cambridge: Cambridge Uneversity Press.

Sugiyono, Memahami Penelitian Kualitatif, (Bandung:Alfabeta,2008)4th Ed.

 93

APPENDICES
 94

SILABUS PEMBELAJARAN

Sekola :MTsNegeriBekonang

Kelas : VIII ( Delapan )

Mata Pelajaran : BAHASA INGGRIS

Semester : Gasal

StandarKompetensi : 6. Menulis

Mengungkapkanmaknadalamtekstulisfungsionaldaneseipendeksederhanaberbentuk descriptive texts.

KompetisDasar MateriDasar
Pembelajaran Penilaian AlokasiWaktu SumberBelajar
1.1 Mensyukuri Teks deskriptif
Mengamati Kriteria penilaian:  Audio CD/
kesempatan lisan dan tulis, VCD/DVD
dapat sederhana,  Siswa memperhatikan /  Pencapaian fungsi 9 x 2 JP
mempelajari tentang orang, menonton beberapa contoh sosial  SUARA GURU
bahasa Inggris tempat wisata,
teks/ filmtentang  Kelengkapan dan  Koran/ majalah
penggambaran orang, keruntutan struktur
sebagai bahasa dan bangunan berbahasa Inggris
tempat wisata, dan teksdeskriptif
pengantar bersejarah bangunan bersejarah.  Ketepatan unsur  www.dailyenglish.
 95

komunikasi terkenal  Siswa menirukan contoh kebahasaan: tata com

internasional secara terbimbing. bahasa, kosa kata,
Fungsi sosial  http://americaneng
yang ucapan, tekanan
 Siswa belajar menemukan kata, intonasi,
lish.state.gov/files/
diwujudkan Membanggakan gagasan pokok, informasi ae/resource_files
ejaan, dan tulisan
dalam semangat , mengenalkan, rinci dan informasi tertentu tangan  http://learnenglish.
belajar dari teks
mengidentifikas  Kesesuaian format britishcouncil.org/
i, memuji, Mempertanyakan penulisan/ en/
2.3 penyampaian
mengritik, (questioning)
Menunjukkanka
mempromosika
n perilaku  Dengan bimbingan dan Unjuk kerja
n, dsb.
tanggung jawab, arahan guru, siswa
Struktur text mempertanyakan antara lain  Melakukan
peduli, monolog tentang
perbedaan antar berbagai
kerjasama, dan (1) Penyebutan deskripsi orang,
teks deskripsi yang ada
cinta damai, nama orang, dalam bahasa Inggris, tempatwisata,
dalam tempat perbedaan teks dalam bahasa bangunanbersejara
melaksanakan wisata, dan Inggris dengan yang ada hterkenaldidepan
komunikasi bangunan dalam bahasa Indonesia kelas / berpasangan
bersejarah
 Ketepatan dan
terkenal dan  Siswa mempertanyakan
fungsional
3.7. Menganalisis nama gagasan pokok, informasi kesesuaian
fungsi sosial, rinci dan informasi tertentu dalammenggunaka
bagian-
struktur teks, dari teks deskriptif n strukturteks dan
bagiannya
dan unsur unsur kebahasaan
yang dipilih Mengeksplorasi
kebahasaan pada dalam membuat
untuk
teks deskriptif
teks deskriptif dideskripsika  Siswa secara kelompok
sederhana n membacakan teks deskriptif Pengamatan
tentang orang, (2) Penyebutan lain dari berbagai sumber (observations):
tempat wisata, sifat orang, dengan pengucapan, tekanan
dan bangunan tempat kata dan intonasi yang tepat Bukan penilaian
 96

bersejarah wisata, dan  Siswa berpasangan formal seperti tes,

terkenal, sesuai bangunan menemukan gagasan pokok, tetapi untuk tujuan
dengan konteks bersejarah informasi rinci dan memberi
penggunaannya. terkenal dan informasi tertentu balikan.Sasaranpenilai
bagiannya, sertafungsisosial dari teks
4.8. Menangkap an
dan deskripsi yang
makna dalam  Perilaku tanggung
(3) Penyebutan dibaca/didengar.
teks deskriptif jawab, peduli,
tindakan dari
lisan dan tulis
atau terkait  Siswamenyuntingteksdeskri kerjasama, dan
sederhana. psi yang diberikan guru cinta damai, dalam
dengan
4.9. Menyunting teks orang, darisegistrukturdankebahasa melaksanakan
deskriptif lisan tempat an Komunikasi
dan tulis, wisata, dan  Berkelompok, siswa  Ketepatan dan
sederhana, bangunan menggambarkan tempat kesesuaian dalam
tentang orang, bersejarah wisata lain dalam konteks menyampaikan dan
tempatwisata, terkenal. penyampaian informasi yang menulis teks
danbangunanber wajar terkait dengan tujuan deskriptif
yang semuanya
sejarahterkenal, yang hendak dicapai dari
dengan sesuai dengan
model yang dipelajari  Kesungguhan
memperhatikan fungsi sosial siswa dalam proses
fungsi sosial, yang hendak Mengasosiasi pembelajaran
struktur teks, dicapai.  Dalam kerja kelompok dalam setiap
dan unsur terbimbing siswa tahapan
kebahasaan yang Unsur menganalisis dengan  Ketepatan dan
benar dan sesuai kebahasaan membandingkan berbagai kesesuaian
konteks. teks yang menggambarkan
(1) Kata benda menggunakan
4.10. Menyusun yang terkait orang, tempat wisata, strategi dalam
teks deskriptif dengan bangunanan bersejarah membaca
lisan dan tulis orang, terkenal dengan fokus pada
struktur teks, dan unsur Portofolio
sederhana tempat
 97

tentang orang, wisata, dan kebahasaan.  Kumpulan catatan

tempat wisata, bangunan kemajuan belajar
 Siswa mengelompokkan
dan bangunan bersejarah berupa catatan
teksdeskripsisesuaidenganf
bersejarah terkenal atau rekaman
ungsisosialnya.
terkenal, (2) Kata sifat monologteksdeskri
dengan yang terkait  Siswa memperoleh balikan ptif.
memperhatikan dengan (feedback) dari guru dan
tujuan, struktur orang,  Kumpulan karya
teman tentang setiap yang
teks, dan unsur tempat siswa yang
dia sampaikan dalam kerja
kebahasaan, wisata, dan mendukung proses
kelompok.
secara benar bangunan penulisan teks
dan sesuai bersejarah diskriptif berupa:
dengan terkenal draft, revisi,
Mengkomunikasikan editing sampai
konteks. (3) Ejaan dan
tulisan  Berkelompok, siswa hasil terbaik untuk
. menyusun teks deskripsi dipublikasi
tangan dan c
etak yang tentang orang/ tempat  Kumpulan hasil
jelas dan rapi wisata/ bangunan bersejarah tes dan latihan.
(4) Ucapan, sesuai dengan fungsi sosial
tekanan kata, tujuan, struktur dan unsur  Catatan atau
intonasi, kebahasaannya rekaman penilaian
ketika diri dan penilaian
 Siswamenyuntingdeskripsi sejawat, berupa
mempresenta yang dibuatteman.
sikan secara komentar atau cara
lisan.  Siswa penilaian lainnya
(5) Rujukan kata menyampaikandeskripsinya Penilaian Diri dan
didepan guru dan teman Penilaian Sejawat
Topik
danmempublikasikannya di
Keteladanan mading.  Bentuk: diary,
jurnal, format
tentang perilaku  Siswa membuat kliping
khusus, komentar,
 98

toleran, deskripsitentang orang, atau bentuk

kewirausahaan, tempat wisata atau penilaian lain
nasionalisme, bangunan bersejarah yang
mereka sukai.
percaya diri.
 Siswa membuat laporan
evaluasi diri secara tertulis
tentang pengalaman dalam
menggambarkan tempat
wisata dan bangunan
termasuk menyebutkan
dukungan dan kendala yang
dialami.
 Siswa dapat menggunakan
„learning journal‟
 99

RENCANA PELAKSANAAN PEMBELAJARAN

(RPP)

NamaSekolah : MAN 2 Boyolali

Mata Pelajaran : BahasaInggris
Kelas / Semester :X/1

MateriPembelajaran : Descriptive

Tema : Descriptive Thing, Person, Place

Skill : Writing

AlokasiWaktu : 2 X 45Menit

A. KompetensiInti :
KI 1: Menghayati dan mengamalkan ajaran agama yang dianutnya.
KI 2: Menghayati dan mengamalkan perilaku jujur, disiplin, tanggung jawab,
peduli (gotong royong, kerjasama, toleran, damai), santun, responsif dan
pro-aktif dan menunjukan sikap sebagai bagian dari solusi atas berbagai
permasalahan dalam berinteraksi secara efektif dengan lingkungan sosial dan
alam serta dalam menempatkan diri sebagai cerminan bangsa dalam
pergaulan dunia.
KI 3: Memahami, menerapkan, menganalisis pengetahuan faktual, konseptual,
prosedural dan metakognitif berdasarkan rasa ingin tahunya tentang ilmu
pengetahuan, teknologi, seni, budaya, dan humaniora dengan wawasan
kemanusiaan, kebangsaan, kenegaraan, dan peradaban terkait penyebab
fenomena dan kejadian, serta menerapkan pengetahuan prosedural pada
bidang kajian yang spesifik sesuai dengan bakat dan minatnya untuk
memecahkan masalah.
KI 4: Mengolah, menalar, dan menyaji dalam ranah konkret dan ranah abstrak
terkait dengan pengembangan dari yang dipelajarinya di sekolah secara
mandiri, bertindak secara efektif dan kreatif, serta mampu menggunakan
metoda sesuai kaidah keilmuan.

B. Kompetensi Dasar :

KompetensiDasar Indikator Pencapaian

Kompetensi
1.1. Mensyukuri kesempatan dapat mempelajari
bahasa Inggris sebagai bahasa pengantar
komunikasi internasional yang diwujudkan
dalam semangat belajar
 100

2.2 Menunjukkan perilaku jujur, disiplin,

percaya diri, dan bertanggung jawab
dalam melaksanakan komunikasi
transaksional dengan guru dan teman.
3.3 Menganalisisfungsisosial, strukturteks, 3.3.1 Mengidentifikasitujuant
danunsurkebahasaanpadaDescriptiveText,s eks padaDescriptive
esuaidengankontekspenggunaannya. Textsecara kontekstual.
3.3.2 Mengidentifikasistruktur
teks padaDescriptive
Text.
3.3.3 Mengidentifikasiunsurke
bahasaanDescriptive
Text.
3.3.4 Menjawabpertanyaanten
tang Descriptive Text
dari audio yang di
dengarkan.
4.3 Mendengarkan dan Menjawab 4.3.1 Menjawabpertanyaante
pertanyaantentangDescriptive ntang Descriptive Text
Text,sesuaidengankontekspenggunaannya. dari sebuah teks
denganmemperhatikanfungsisosial, monologue atau short
strukturteks, danunsurkebahasaan, yang conversation dari audio
benardansesuaikontekspenggunaannya. yang di dengarkan
sesuaikontekspengguna
annya.

C. Tujuan Pembelajaran
Setelah mengikuti serangkaian kegiatan pembelajaran peserta didik dapat:

1. Mengidentifikasi tujuan teks Descriptive Text.

2. Mengidentifikasi struktur teks Descriptive Text.
3. Mengidentifikasi unsur kebahasaanDescriptive Text.
4. Mendengar dan menjawab pertanyaan tentang teksDescriptive Text dari audio
yang didengarkan.
5. Mendengar dan menjawab pertanyaan tentang teksDescriptive Text dari sebuah
teks monologue atau short conversation dari audio yang didengarkan.

D. Materi Pembelajaran
Teks tulis menunjukkanDescriptive Text.
a) Definition of Descriptive Text:
Descriptive Text
Descriptive text or description is a kind of text functions to describe a
particular person, place, animal or thing.
Generic Structure
- Identification, identifying the phenomenon to be described
 101

- Description, Describing the phenomenon in parts, Qualities, or/and

Characteristics.

The Laguage of Features

 Use of simple present tense.

(S + am/is/are + P) or (S + V1(+s/es))
 Use of linking verb (kata kerjapenghubung) like ; is, are, appear,
feel, grow, look, prove, remain, smell, sound, taste, and turn. Ex:
He is handsome; It smell nice; The song sounds beautiful; etc.
To describe things or noun, we use adjective can be in the form of
adjective clauses.

Adjective is used to describe noun (things and people)

For example:

 An old car
 A beautiful girl
 A rich businesswoman
 A red chair
 A flowery shirt

Adjective clauses ORDER:

DETER OPINION SIZE AGE SHAPE COLOR ORIGIN MATE NOUN

MINER RIAL

The wonderful small old Round green German wooden vase

A Beautiful large new red Indonesian cotton skirt

 SIZE : big, small, little, huge, midle,

 SHAPE : round, oval, regtangular, square
 CONDITION : smooth, hard
 AGE : old, modern, ancient
 COLOR : red, yellow, blue, green
 ORIGIN : germany, american
 MATERIAL : wooden, metal, iron, paper
 PATTERN : checked, flowery, spotted, striped, etc.
 OPINION : beautiful, wonderful,expensive, cheap,etc
 102

Contoh Descriptive Text

 Example of Describing Things

My Doll

My favorite toy is a doll. I named my doll Becky. I got in in my 12th

birthday. My dad bought it for me when he was in England.

Becky is 16 cm tall doll with plastic head, arms, and legs and a white cloth
stuffed body. Her body is covered with yellow, orange, and green flower bud
prints. She has a long auburn-red brush-able hair, blue eye. There are freckles on
her cheek. There are also two dimples near her mouth on the left and on the right.
They make her more beautiful. I put her at my side when I sleep at night.

I like my doll very much. I sometimes ask my friends to come to my house

and play with Becky. They like Becky too.

EXERCISE

LISTENING SECTION

In this section of the test, you will have an opportunity to demonstrate

your ability to understand conversations and talks in English. There isone part to
this section. Answer all the questions on the basis of what is stated by the
speakers you hear. Do not take notes or write in your test book at any time. Do not
turn the pages until you are told to do so.

PART A

Directions: In this part A you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
 103

test book, so you must listen carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.

The dialogue to answer question number 1 until 5.

Dialog 1

Umma : Hello Fuad. You look great? What is wrong?

Fuad : My uncle bought me a new bag yesterday, when I win the speech contest.
The color is blue. Can for a place to books, laptop, and writting tools.
Umma : Wow.congratulations Fuad.

Fuad : Thank you.

1. What is the dialogue about?

a. Narative Text
b. Recount Tex
c. Describtive Text
d. Report Text
2. Why Fuad bought a new bag?
a. Get a good mark
b. Happy birthday
c. Happy wedding
d. The win of speech contest
3. Who is bought Fuad‟s new bag?
a. Umma
b. Umi
c. Father
d. uncle
4. What is the color Fuad‟s new bag?
a. black
b. blue
c. with
d. red
5. What is the function those bag?
a. Place a books, laptop, and raiting tools.
b. Place a books
c. Place a laptop
d. Place a raiting tools.
Funsisosial :
Menjagahubungan interpersonal dengan guru, teman, dan orang lain.

UnsurKebahasaan :

a. Kosa kata terkaittempat, barang, orang.

b. Frasa nominal denganadjective:Adjective is used to describe noun (things and
people)
 104

For example:
 An old car
 A beautiful girl
 A rich businesswoman
 A red chair
 A flowery shirt
c. Ucapan, tekanan kata, intonasi
d. Ejaandantandabaca
e. Tulisantangan

Topik :
Descriptive Thingsyang seringdigunakandalamkehidupansehari – hari.

Fakta :

Descriptive Textadalah ungkapan yang sering digunankan dalam kehidupan

sehari hari.

Konsep:

Descriptive
Textmerupakanperwujudanperhatianuntukfungsisosialmenjagahubungan
interpersonal dengan guru, temandan orang lain

Prinsip

 Struktur teks
Use of simple present tense.

(S + am/is/are + P) or (S + V1(+s/es))

 Unsur kebahasaan
1. Kata terkaitdenganhubungankekeluargaandankekerabatan.
2. Ucapan, tekanan kata, intonasi, ejaan, tulisantangan yang rapi.
3. Rujukan kata
Prosedur:

Descriptive
Textdisusundenganmemperhatikanstrukturdanbentukbahasasesuaidengankonte
ksnya.
 105

E. MetodePembelajaran:
Pendekatan : Scientifik approach

Metode : Communicative Language Teaching

F. Media, Sumber Pembelajaran:

1. Media : Laptop, LCD, Loudspeaker, Picture, Power Point, whiteboar and
boardmarker
2. Sumber :
Buku Guru B. Inggris SMA/SMK Kls X
G. Langkah-langkahPembelajaran :
1. KegiatanPendahuluan
a. Guru memberi salam
b. Berdoa bersama-sama sebelum pelajaran dimulai
c. Guru memeriksa kehadiran siswanya.
d. Guru memberi motivasi belajar siswa sesuai manfaat dan aplikasi materi ajar
dalam kehidupan sehari-hari.
e. Guru mengajukan pertanyaan antara pengetahuan sebelumnya dengan materi
yang akan di pelajari.
f. Guru menjelaskantujuanpembelajaranataukompetensidasar yang
akandicapai.
g. Guru menyampaikan cakupan materi dan uraian kegiatan.

2. Kegiatan Inti
a.) Mengamati (Observing)
1) Peserta didik Mengamati Gambar yang disajikan oleh guru
2) Dengan bimbingan dan arahan guru,peserta didik mengidentifikasi isi
Gambar dan menghubungkannya dengan Descriptive Things
b.) Menanya (Questioning)
1.) Dengan pengarahan guru, peserta didik menanyakan tetang fungsi sosial,
struktur teks, dan unsur kebahasaan dari Descriptive Things
2.) Peserta didik memperoleh pengetahuan tambahan tentang Descriptive
Things, fungsi sosial, struktur teks, dan unsur kebahasaan.

c.) Mencoba (Eksploring)

1.) Peserta didik menjawab pertanyaan dari teks Descriptive Things.
2.) Peserta didik juga diharapkan bisa membuat kalimat Descriptive Things
d.) Menalar (associating)
1.) Dengan bimbingan guru, peserta didik menjawab pertanyaan terkait isi
teks Descriptive Things.
2.) Peserta didik mendapat balikan (feedback) dari guru atau teman yang
lainya tentang setiap yang dia sampaikan dalam diskusi.

e.) Mengkomunikasikan (communicating)

1.) Peserta didik mempresentasikan hasil dari pekerjaan menjawab teks
Descriptive Thingstersebut.
2.) Peserta didik memperoleh balikan (feedback) dari guru dan teman
tentang hasil pekerjaan yang telah dipresentasikan.
3. Penutup
a. Guru memberikanumpanbalikterhadap proses danhasilpembelajaran;
b. Guru bersama –samadenganpesertadidikmenyimpulkanpembelajaran
c. Berdoa bersama-sama membaca hamdallah selesai pelajaran
 106

d. Guru memberi salam penutup.

e.
H. Evaluasi

LISTENING SECTION

In this section of the test, you will have an opportunity to demonstrate

your ability to understand conversations and talks in English. There are four parts
to this section. Answer all the questions on the basis of what is stated by the
speakers you hear. Do not take notes or write in your test book at any time. Do not
turn the pages until you are told to do so.

PART A

Directions: In this part A you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
test book, so you must listen be carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.

The dialogue to answer number 1 until 5.

Dialogue 1

Qoyyimah : Hendra. What is your favorite toys?

Hendra : My favorite toy is a doll. I named my doll Juwita. I got in my

eighth birthday. My dad bought it for me when he was in England. Becky is 16
cm tall doll with plastic head, arms, and legs and a white cloth stuffed body. Her
body is covered with yellow, orange, and green flower bud prints. She has a long
auburn-red brush-able hair, blue eye. I like my doll.

1. What is the dialogue about?

a. Narrative Text
b. Recount Tex
c. Describtive Text
d. Report Text

2. What is favorite toy‟s Hendra?

a. Car
b. Robot
c. Doll
d. Play station
3. What is color hendra‟s doll?
a. Yellow
b. Red
c. Pink
 107

d. Blue
4. What is color hendra‟s eye doll?
a. Yellow eye
b. Red eye
c. Pink eye
d. Blue eye
5. Does Hendra love his doll?
a. Yes, he do
b. Yes, he does
c. No, he do not
d. No, he does not

PART B

Directions: In this part B you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
test book, so you must listen be carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.

The dialogue to answer number 6 until 8.

Ainun : Fadhil. What‟s wrong? You look like sad.

Fadhil : my wallet is lost. The color is pink. It Has two pockets.

Ainun : I‟m sorry to hear that.

6. Why fadhil look like sad?

a. His wallet was lost
b. His wallet were lost
c. His wallet are lost
d. His wallet is lost
7. What is the color Fadhil‟s wallet?
a. Brown
b. Black
c. Blue
d. Pink
8. Who lost his wallet?
a. Fuad
b. Hainun
c. Fadhil
d. Hendra
PART C

Directions: In this part C you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
 108

test book, so you must listen be carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.

The Dialogue to answer number 9 until 13.

Muhajir: Can you describe your necklace?

Zuzun : I got my necklace from my boyfriend. Silver colors. There is a love-
shaped pendant. I always wear it.

Muhajir : it‟s wonderfull.

9. What the dialogue tells about?

a. Describing things
b. Describing people
c. Describing animal
d. Describing place
10. What the dialogue discribe about?
a. Bracelate
b. Necklace
c. Diamond
d. Ring
11. Who has own the necklace?
a. Niken
b. Ninda
c. Zuzun
d. Sri

12. Does she always wear it?

a. No, She does not
b. No, She do not
c. Yes, She does
d. Yes, She do
13. What color of Zuzun‟s necklace?
a. Gold
b. White
c. Blue
d. Silver

PART D

Directions: In this part D you will hear a Text about Descriptive Text. Each a
Text about Descritive Things will be sopken two times. They will not be printed
in your test book, so you must listen be carefully to understand what the speakers
say. After you hear a Text about Descritive Things and please answer fill in the
blank in the text.

The text to answer number 14 until 20.

 109

Guitar

My most valuable possession is (14)......, slightly warped blond guitar--the

first (15)........taught me how to play.

It's nothing fancy, just a Madeira folk guitar, all scuffed and scratched and
finger-printed. At the top is a bramble of copper-wound strings, each one hooked
through the eye of a (16)........ tuning key.

The body of the Madeira is shaped like an enormous

(17)......... pear, one that was slightly damaged in shipping. The blond
wood has been (18).....

No, it's not (19)......... instrument, but it still lets me make music, and for
that I will always (20).......... it.

1. Aspek – aspek Penilaian SikapSosial, Pengetahuan,dan Ketrampilan.

a. AspekSikap Sosial
1.) Teknik Penilaian : Pengamatan
2.) Bentuk Instrument : Uraian bebas
3.) Indikator
a.) Indikator Sikap Sosial JUJUR.
 Tidak menyontek dalam mengerjakan ujian/ulangan
 Tidak menjadi plagiat (mengambil/menyalin karya orang lain tanpa
menyebutkan sumber)
 Mengungkapkan perasaan apa adanya
b.) Indikator sikap sosial PERCAYA DIRI;
 Berpendapat atau melakukan kegiatan tanpa ragu-ragu
 Berani presentasidideoan kelas
 Berani berpendapat, bertanya, atau menjawab pertanyaan.
c.) Indikator sikap sosial BERTANGGUNG JAWAB:
 Melaksanakan tugas individu dengan baik
 Melaksanakan kerja sama(kelompok dengan baik)
 Menerima resiko dan tindakan yang dilakukan
 110

d.) Indikator sikap DISIPLIN:

 Datang tepat waktu
 Patuh pada tata tertib atau peraturan bersama/sekolah.
 Menegrjakan atau mengumpulkan tugas sesuai dengan waktu yang
ditentukan
4.) Pedoman Penskoran
Skor perolehan
NA = x4
Skor maksimal
Konvesri Kompetensi Pengetahuan, Ketrampilan dan Sikap
Predikat NilaiKompetensi
Pengetahuan Ketrampilan Sikap
A 4 4 SB
A- 3.66 3.66
B+ 3.66 3.66 B
B 3 3
B- 2.66 2.66
C+ 2.33 2.33 C
C 2 2
C- 1.66 1.66
D+ 1.33 1.33 K
D- 1 1

b. Pengetahuan
1.) Tehnik Penilaian : Tes Tertulis
2.) Bentuk Instrument :
 Mengidentifikasi isi Teks Descriptive Things
 Menjawab pertanyaan dari teks Descriptive Things
3.) Kisi-kisi
No Indikator ButirInstrumen
1 SiswaterampilMengidentifikasi dan menjawab 2
pertanyaan dariteksDescriptive Things

4.) Pedoman Penskoran

Skor perolehan
NA = x4
Skor maksimal
 111

Konvesri Kompetensi Pengetahuan, Ketrampilan dan Sikap

Predikat NilaiKompetensi
Pengetahuan Ketrampilan Sikap
A 4 4 SB
A- 3.66 3.66
B+ 3.66 3.66 B
B 3 3
B- 2.66 2.66
C+ 2.33 2.33 C
C 2 2
C- 1.66 1.66
D+ 1.33 1.33 K
D- 1 1

c. Ketrampilan
1.) Tehnik Penilaian : Unjuk Kerja
2.) Bentuk Instrumen :
3.) Tes Ketrampilan membuat teks Descriptive Things
4.) Kisi-kisi
No Indikator ButirInstrumen
1.  Siswaterampilmembuat teks Descriptive 1
Things.

5.) Pedoman Penskoran

Skor perolehan
NA = x4
Skor maksimal
 112

Konvesri Kompetensi Pengetahuan, Ketrampilan dan Sikap

Predikat NilaiKompetensi
Pengetahuan Ketrampilan Sikap
A 4 4 SB
A- 3.66 3.66
B+ 3.66 3.66 B
B 3 3
B- 2.66 2.66
C+ 2.33 2.33 C
C 2 2
C- 1.66 1.66
D+ 1.33 1.33 K
D- 1 1

2. Kolom Penilaian
a.) Rubik Penilaian Sikap

No Nama Aspek Penilaian Sikap Total

Siswa Jujur Percaya Tanggung Disiplin Skor
Diri Jawab
1
2
3
4
5

b.) Rubik Penilaian Pengetahuan

No Nama AspekPenilaian Ketrampilan Total Skor

Siswa Benar Salah
1
2
3
4
5
 113

c.) Rubik Penilaian Ketrampilan

No Nama AspekPenilaian Ketrampilan Total Skor

Siswa Benar Salah
1
2
3
4
5

Simo, 3 Desember2016

Kepala Sekolah MAN 2 Boyolali Guru Mata Pelajaran

Drs. H. Mahsun Alwa’id, M.Ag Rining Pangastuti,S.Pd.I

NIP : 19661103 199203 1 006
 114

The Students Data of XIPS2 Class of MAN 2 Boyolali in the Academic Year

2016/2017

No Name Class
1 A ZainalMa‟ruf XIPS2
2 Ainunnisa Farah XIPS2
3 AldiHidayat XIPS2
4 Andriya Elisa Warda XIPS2
5 ArvianAdi s XIPS2
6 Dina Septika Sari XIPS2
7 Febri Dian Mayasari XIPS2
8 HappytaQurrota A XIPS2
9 Hastutik XIPS2
10 IinNurSafrina XIPS2
11 JovikaRamadhani XIPS2
12 LailatulMukarromah XIPS2
13 LiaRatnaDewi XIPS2
14 M. FahrurRohmanFauzi XIPS2
15 Muh. Nurrodin XIPS2
16 Muhammad Anang M XIPS2
17 Muhammad Yoga A XIPS2
18 NihayatulKhusna XIPS2
19 NisaMaulianaJari XIPS2
20 OktaviaNingrum XIPS2
21 PutriRahmawati XIPS2
22 SyafiraJihanKamila XIPS2
23 Syaifullah XIPS2
24 UnikPuji L XIPS2
25 UswatunChasanah XIPS2
26 Wahyuana A. M XIPS2
27 Yudistira XIPS2
 115

INTERVIEW WITH TEACHER

Judul : Wawancaramengenaipembelajaranbahasainggris
Tempat : Ruang Guru MAN 2 Boyolali
Waktu : 18 Januari 2016

Researcher :“beberapapekaninikansayasudah di kelas XIPS2 yabu,

bagaimanaibumengajar writing/
menulisdalammatapelajaranbahasaInggrisbu?”
IbuRinning :“Yakalaumengajar writing di siniituagakkesulitanya mas,
makanyabiasanyasayapakai mapping, mapping
itusepertiklu;kludalam writing, andaikankitamengajar writing
contohnyadescriptivekan? Andaikan di situ Prambana Temple
jenengansudahadamappingnya, kalau place berarti kata kataini
yang di gunakanharusada, kalau person jugabegitu, kalukelas 10
itumenulismemangcukupsulitgitu, berartisayapakai mapping.”
Researcher :“kalau mapping ituapakahcara-caramenulisataulangkah-
langkah?”
IbuRinning :“Kalau mapping itulangkah-langkahnya,
kalaucaramenulisitukanCumakaludescriptiitupakau past tense
tapikalaulangkah- langkahkanlangsungjelas, semumpama
descriptiveituadaidentivikationnya,
setelahitudescriptivicationnya, berartitinggalcarikira-kira kata-
kata mana yang digunakanuntukidentivicatin, mana yang
buatmendescripsikan, itusudah di mappiingkansecarajelasdulu,
karenainimasihkelassepuluh,
kecualisudahkelasebelasataunantikelas du
belasmungkinbisalangsungtanpa mapping.
Researcher :“owyaibu, hlakemarinkansiswasudahmenulis descriptive
mengenai orang, barang, maupuntempatyabu, beberapasiswa
yang
sayawawancaraiitukesulitandalammenulisbahasainggrisituadala
 116

hmenyusunkalimatdan kata-kata yang susah,

caraibuuntukmengatasihaltersebutdenganapa?
IbuRinning :“hlaw yam as, makanyasayamengajarkannyadengancara
mapping itu, jadi kaya tinggalmenggabungkan kata
inidenganinidanseterusnya, karenamasihkelassepuluh.”
Researcher :“kalauibumewajibkandalampelajaranmemakaikamustidakibu?”
IbuRinning :”yaharus, kalaubahasainggrisharuspakaikamus, rencanamulai
semester depanitudarisiswasetiappekannyahafalan5 kosa-kata,
karenabiarlebihbanyaktautentangvocabularynya.”
Researcher : “berartisetiapsiswawajibbawakamuyaibu?”
IbuRinning :”ya mas,
setidaknyasatumejaadasatukamuskalutidaksyasuruhkeluar mas,
biarbawakamusitusebagaikewajiban.
Researcher : “mungkincukupitubudari interview saya,
terimakasihsebelumnya”
IbuRinning : “yam as, sama-sama.”
 117

INTERVIEW WITH THE STUDENTS

Judul : Wawancara mengenai kesulitan siswa

Tempat : Ruang kelas XIPS2 MAN 2 Boyolali

Waktu : 18 Januari 2016

Name: Aldi

Researcher : “menurutmu bahasa inggris itu gimana dek?”

Student : “gampang-gampang susah”

Researcher : “gampangnya bahasa inggris dimana dek?”

Student :”kalau tau artinya”

Researcher : “kalau pengajaran bu Rinnging Sepertiapa”

Student :”ceramah”

Researcher : “kalau menulis descriptive text kemarin gimana?

Student :”agaksusah”

Researcher : “susahnya dimana?”

Student :”mengartikan”

Researcher : “caramengatasi kesulitannya dengan apa?”

Student :”melihat kamus dan Tanya guru”

Researcher : “apa bu Rinning mewajibkan pakai kamus?”

Student : “wajib, kalu tidak ada hukuman”

Nama :Jovika

Researcher : menurutmu bahasa inggris itu gimana dek?

Student :”seru”
 118

Researcher : “Serunya dimana ini?”

Student :”yak arena bahasa Asing”

Researcher : “kalau menulis descriptive texs kemarin gimana?”

Student :”gampang”

Researcher : “gampangnya gimana?”

Student :”ya karena bisa”

Researcher : “kalau pengajaran bu Rinning bagaimana?”

Student :””enak”

Researcher : “kalau kesulitan dalam bahasa inggris biasanya ngapain?”

Student : “buka kamus”

Nama :Lia

Researcher : “menurutmu bahasa inggris itu gimana dek?”

Student : “gak enak, Sulit”

Researcher : “kesulitannya dimana bahasa inggris itu?”

Student : “mengartikan, menyusun kalimatnya.”

Researcher : “cara mengatasi kesulitan itu biasanya ngapain dek?”

Student : “belajar, buka kamus, Tanya teman-teman.”

Researcher : “tapi nilai menulis descriptive kemarin bagus, gimana caranya?”

Student :”Belajar, kan itu dah pernah di ajarkan jadi tau. Cuma hafalin

saja.”

Researcher : “kalau pengajaran bu Rinning dalam bahasa inggris gimana dek?”

Student :”bu Rinning, enak sih, tapi susah di mengerti”

 119

Nama :Yoga

Researcher : menurutmu bahasa inggris itu gimana dek?

Student :”menyenangkan tapi sulit”

Researcher : “kalau pembelajaran bu Rinning bagaimana menurutmu?”

Student :”jelas kurang seru”

Researcher : “kalau menulis descriptive text kemarin gimana?”

Student : “Susah-susah gampang”

Researcher : “Susahnya dimana?”

Student :dalam mengartikan”

Researcher : “hlaw kalau susah mengartikan biasanya biar tau bagaimana?”

Student :buka kamus, Tanya teman dan guru”

Nama :Hapyta

Researcher : menurutmu bahasa inggris itu gimana dek?

Student :”asyik, soalnya bahasa asing tapi agak sulit”

Researcher : “susahnya dimana ini?”

Student :”menyusun kalimat”

Researcher : “kalau menulis descriptive texts kemarin gimana?”

Student :”gampang-gampang susah”

Researcher : “susahnya dimana?”

Student :”kalimat yang jarang di baca”

Researcher : “cara mengatasinya gmana?”

Student :”Tanya temandan guru”

Researcher : “kalau pengajaran bur inning gimana?”

Student :”sebenere enak tapi agak tegang”

 120

Nama :Iin

Researcher : “menurutmu bahasa inggris itu gimana dek?”

Student :”enak, mudah”

Researcher : “Enaknya dimana dek?

Student :”bahasa asing mudah di cermati”

Researcher : “kalau pembelajaran bu Rinning Bagaimana?

Student :”jelas, enak, menyenangkan”

Researcher : “kalau menulis kemarin ada kesulitan tidak?”

Student :”sedikit”

Researcher : “kesulitannya dimana dek?”

Student :”mengartikannya”

Researcher : “cara mengatasi hal tersebut dengan apa?”

Student :”buka kamus”

Nama :Unik

Researcher : menurutmu bahasa inggris itu gimana dek?

Student :”senang, bikin happy, tidak membosankan, lucu”

Researcher : “ada kesuliatan tidak dek?”

Student :”ada, di cara menulis dan mengartikan”

Researcher : “cara mengatasinya gmana?”

Student :”lebih giat dalam belajar”

Researcher : “kalau pembelajaran Bu Rinning gimana dek?”

Student :lebih rincidan dapat di pahami

Researcher : kalau menulis descriptive texts kemarin gimana?”

Student :“biasa saja tidak begitu sulit”

 121

Nama :Oktavia

Researcher : “menurutmu bahasa inggris itu gimana dek?”

Student :”menyenangkan, bikins enang”

Researcher : “kalau menulis descriptive texts gimana dek?”

Student :”sulit, pengetahuan belum banyak”

Researcher : “kesulitannya dimana dek?”

Student :cara menulis dan mengartikan”

Researcher : “kalau pengajaran bu Rinning Gimana?”

Student :”mudah di mengerti dan di pahami”

Researcher : “cara mengatasi kesulitannya dalam bahasa inggris biasanya

ngapain?”

Student :“mencari di kamusdan Tanya-tanya”

Researcher : “apa pada saat pembelajaran bu Rinning, bawa KamusWajib?”

Student : “iya”

Nama :Andriya

Researcher : “menurutmu bahasa inggris itu gimana dek?”

Student :”susah”

Researcher : “susahnya dimna?”

Student :”mengartikan”

Researcher : “kalau menulis descriptive texs kemarin?”

Student :”susah”

Researcher : “susahnya sama dalam mengartikan?

 122

”Student :“iya, mengartikan bahasa Indonesia kebahasa inggris dan

menyusun kalimatnya”

Researcher : “kalau pengajarannya bu rinning gimana?”

Student : “menyenangkan”

Researcher : “dalam pembelajarannya apa wajib bawa kamu?”

Student : “wajib pakai kamus”

Nama :Yudistira

Researcher : menurutmu bahasa inggris itu gimana dek?

Student :lumayan susah, lumayan gampang”

Researcher : “pembelajarannya bu Rinning gimana?”

Student : Bisa masuk”

Researcher : “kalau menulis Descriptive kemarin gimana?

Student :lumayan pusing bisa dikit”

Researcher : “kesulitannya dimana?”

Student :”mengartikan, menyusun kalimat”

Researcher : “hlaw nilai kamu pas menulis kemari jelek kenapa?”

Student :sudah bingung gak bisa mikir

Researcher : “cara mengatasi kesulitan gimana?”

Student : cari di kamusatau Tanya teman”

 123

FIELD NOTE OBSERVATION

Day/Date : Wednesday, 16th November 2016

Time : 09.30 – 10.40

Teacher : Miss. Rinning

Description :
First observation here was pre-observation. It was done on16th November 2016.
The researcher observed the condition of class XIPS2 class. The material in the
first observation was descriptive text. The students‟ condition inXIPS2 class was
good. The students were serious in teaching learning process. In the teaching and
learning process, Miss. Rinning explained the material to the students. Then,
Miss. Rinning asked to the students active in teaching learning process. In
teaching learning process Miss. Rinning used opening, main activity and closing
as the agenda of teaching learning process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good morning.
After that Miss. Rinning with the students pray by saying Basmallah together and
Miss. Rinning checked students‟ attendance list.

b. Main activities
The teacher gave a material to the students. It was about descriptive text. Miss.
Rinning told the students about the materials. The students learned about reading
skill. In making the condition in the classroom more life, the teacher asked some
question to the students to make the students active in the class. Then, the teacher
asked to the students to read a story on their handbook. The students read the
text and translating the text. In translating the text the teacher asked the students
one by one. One students translated one sentence. The teacher also asked to
the students to underline the difficult word. This technique used to increasing
the students in vocabulary. In translating the text, the XIPS2 students was
enthusiasm, the students was immediately looking for the meaning of the
underline word in that text in dictionary. The students‟ response in teaching
learning process that day was good. There was feedback between teacher and
students.

c. Closing
The teacher reviewed some material that had discussed in the meeting, after
that the teacher gave a task to the students. After that, the teacher say
Hamdallah with the students as the sign the time in teaching learning
process was done.
 124

FIELD NOTE OBSERVATION

Day/Date : Wednesday, 23th November 2016

Time : 09.30 – 10.40

Teacher : Miss. Rinning

Description :
Second observation was done on 23th November 2016. The researcher observed
the condition of class XIPS2 class. The material is descriptive text. The
students‟ condition in XIPS2 class was very good. The students were
serious in teaching learning process. In the teaching and learning process, Miss.
Rinning explained the material to the students. Then, Miss. Rinning asked to
the students active in teaching learning process. In teaching learning process
Miss. Rinning used opening, main activity and closing as the agenda of teaching
learning process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good
morning. After that Miss. Rinning with the students pray by saying Basmallah
together and Miss. Rinningchecked students‟ attendance list.

b. Main activities
The teacher gave a material to the students. It was about descriptive text.
Miss. Rinning told the students about the materials. The students learned about
the organization of the descriptive text. In making the condition in the
classroom more life, the teacher asked some question to the students to
make the students active in the class. Then, the teacher asked to the
students to read a story on their handbook. The students read the text and
translating the text. In translating the text the teacher asked the students
one by one. One students translated one sentence. The teacher also asked to the
students to underline the difficult word. This technique used to increasing
the students in vocabulary. In translating the text, the XIPS2 students was
enthusiasm, the students was immediately looking for the meaning of the
underline wor in that text in dictionary. The students‟ response in teaching
learning process that day was good. There was feedback between teacher and
students.
c. Closing
The teacher reviewed some material that had discussed in the meeting, after
that the teacher gave a task to the students. After that, the teacher say
Hamdallah with the students as the sign the time in teaching learning
process was done.
 125

FIELD NOTE OBSERVATION

Day/Date : Wednesday, 30th November 2016

Time : 09.30 – 10.40

Teacher : Miss. Rinning

Description:
Third observation was done on 30th November 2016. The researcher observed the
condition of class XIPS2 class. The material was still descriptive text. The
students‟ condition inXIPS2 class was very good. The students were serious in
teaching learning process. In the teaching and learning process, Miss. Rinning
explained the material to the students. Then, Miss. Rinning asked to the students
active in teaching learning process. In teaching learning process Miss. Rinning
used opening, main activity and closing as the agenda of teaching learning
process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good morning.
After that Miss. Rinning with the students pray by saying Basmallah together and
Miss. Rinning checked students‟ attendance list.

b. Main activities
The teacher reviewed a material yesterday to the students. It was about
descriptive text. Then in this meeting Miss. Rinning told about using of Simple
Past Tense. In making the condition in the classroom more life, the teacher asked
some question to the students to make the students active in the class. Then the
teacher asked to the students to read a story on their handbook. The students read
the text and translating the text. In translating the text the teacher asked the
students about miss understanding sentence on the text. This technique used to
increasing the students in tenses. After that the teacher asked the students to make
some sentences in the form of Simple Past Tense, and asked the students to write
one by one on the whiteboard. The students‟ response in teaching learning
process that day was good. There was feedback between teacher and students.

c. Closing
The teacher reviewed some material that had discussed in the meeting,
then, the teacher gave a task to the students. After that, the teacher say
Hamdallah with the students as the sign the time in teaching learning
process was done.
 126

FIELD NOTE OBSERVATION

Day/Date : Wednesday, 18thJanuary 2016

Time : 09.30 – 10.40

Teacher : Miss. Rinning

Description:
Fourth observation was done on15th January 2016. The researcher observed the
condition of class XIPS2 class. The material was still descriptive text. The
students‟ condition in XIPS2 class was very good. The students were serious in
teaching learning process. In the teaching and learning process, Miss. Rinning
explained the material to the students. Then, Miss. Rinning asked to the
students active in teaching learning process. In teaching learning process Miss.
Rinning used opening, main activity and closing as the agenda of teaching
learning process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good morning.
After that Miss. Rinningwith the students pray by saying Basmallah together and
Miss. Rinning checked students‟ attendance list.

b. Main activities
The teacher reviewed a material yesterday to the students. It was about
descriptive text. Then, in this meeting Miss. Rinning teach in writing skill. In
making the condition in the classroom more life, the teacher asked some
question to the students to make the students active in the class. He asked about
the material yesterday. After that, Miss. Rinning asked the students to write
about descriptive text. He gave the topic about vacation.

c. Closing
The teacher asked the students to collect the text. The teacher reviewed some
material that had discussed in the meeting. After that, the teacher say Hamdallah
with the students as the sign the time in teaching learning process was done.
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147