Notices

131 -- 281/20

ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 02
09 January 2020
(Published on the ADMIRALTY website 27 December 2019)

CONTENTS

I Explanatory Notes. Publications List

II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services

For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: [email protected]
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: [email protected]
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: [email protected]
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2020. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
[email protected]

For UKHO use only 220402

 I

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS

ON THE UKHO WEBSITE

The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
admiralty.co.uk/msi or the searchable NM Website www.ukho.gov.uk/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.

NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.

Software required:

Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website (www.adobe.com).

SEARCHABLE NOTICES TO MARINERS

Enter the www.ukho.gov.uk/nmwebsearch website and select the search option that you require
following the on screen instructions:

ƒ Search NMs by - Chart Number only

ƒ Search NMs by - Chart Number + Previous NM Number/Year
ƒ Search NMs by - Chart Number + Between Previous and Present Dates
ƒ Search for Single NM by NM Number/Year

To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.

NOTICES TO MARINERS ON-LINE

Enter the admiralty.co.uk/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List

FURTHER GUIDANCE NOTES

For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
ƒ File content and description
ƒ PC and printer specifications

CUSTOMER SERVICE

If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:

Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: [email protected]

Our Singapore team can also be contacted outside of UK hours on:

Tel: +65 6424 4200

Wk02/20 1.2
 ,

ADMIRALTY NOTICES TO MARINERS

7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10% LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH8.+27KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ  RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ 5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\

:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV

7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV

Planning for the future

Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.

Admiralty Way, Taunton, Somerset

TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
[email protected]
gov.uk/ukho

Find out more about our market-leading

ADMIRALTY Maritime Data Solutions:
admiralty.co.uk

and are trademarks of the Secretary of State for Defence

© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.

 Wk02/20
 ,

EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.

Wk02/20 
 ,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV

 Wk02/20
 I
[02/20]
ADMIRALTY Charts affected by the Publication List

ADMIRALTY Charts International Charts

128 INT 1342

246 INT 1452
247 INT 1455
329 INT 1478
330 INT 1778
723 INT 3188
890 INT 3660
1198 INT 3794
1515
1719 ADMIRALTY Publications
1737
2114 NP 62
2202 e-NP 62
2205 NP 131
2212
2922
2945
3034
3035
3928
5146
SC 5605
AUS 65
DE 44
DE 48

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk02/20 1.6
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 09 January 2020

Chart Title, limits and other remarks Scale Folio 2020 Catalogue
page

128 International Chart Series, Netherlands and Belgium, Westerschelde, 9 24

INT1478 Baalhoek to Wintam.
A Baalhoek to Antwerp. 1:30,000
B Antwerp to Hoboken. 1:15,000
C Hoboken to Wintam. 1:10,000

Includes changes to depths and obstructions. (A modified reproduction of

INT1478 published by Belgium.)

Note: On publication of this New Edition former Notice 1288(T)/18 is

cancelled. This chart remains affected by Notices 4360(T)/18, 223(T)/19,
1382(T)/19, 1681(T)19 and 4320(T)/19.

1719 China - Taiwan Strait, Shenhu Wan to Dongding Dao. 1:100,000 50 80

Includes significant safety-related information as follows: changes to depths,

buoyage and coastline.

Note: On publication of this New Edition former Notice 5981(P)/19 is

cancelled. This chart remains affected by Notice 6576(T)/19.

2202 Black Sea – Ukraine, Pivdennyi Port. 1:12,500 31 46

Includes significant safety-related information as follows: changes to depths

and dredged areas. The title has been changed.

Note: On publication of this New Edition former Notices 4241(T)/18 and

6043(P)/19 are cancelled.

2205 Black Sea – Ukraine, Approaches to Odesa and Pivdennyi Port. 1:50,000 31 46

Includes significant safety-related information as follows: a new spoil

ground and changes to depths, wrecks, obstructions and aids to navigation.
The title has been changed.

Note: On publication of this New Edition former Notices 4124(T)/17,

4225(T)/18, 4241(T)/18 and 6043(P)/19 are cancelled.

2212 Black Sea – Ukraine, Dnistrovs'kyy Lyman to Dniprovs'kyy Lyman. 1:100,000 31 46

Includes significant safety-related information as follows: changes to depths,

wrecks, obstructions and aids to navigation.

Note: On publication of this New Edition former Notices 858(T)/16,

4124(T)/17, 4225(T)/18, 4241(T)/18 are 6043(P)/19 are cancelled. This
chart is to be deleted from the list of charts affected by Notice 184(T)/17.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.7 Wk02/20
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 09 January 2020 (continued)

Chart Title, limits and other remarks Scale Folio 2020 Catalogue
page

2945 International Chart Series, Baltic Sea, Germany and Denmark, Waters 1:100,000 10 34
INT1342 between Rügen and Mon.

Includes changes to depths, wrecks, obstructions, restricted areas and

pipelines. (A modified reproduction of INT1342 published by Germany.)

Note: This chart remains affected by Notices 729(T)/19, 2903(T)/19,

3431(T)/19 and 6402(P)/19.

3928 Korea - West Coast, Approaches to Mokpo. 1:100,000 52 82

Includes significant safety-related information as follows: depths, tidal

streams, fish havens, rocks, overhead power cables, wrecks and lights.

Note: On publication of this New Edition former Notices 6025(P)/19,

6235(P)/19 and 6408(P)/19 are cancelled

5146(1) Routeing Chart Mediterranean And Black Seas. (January) 1:5,000,000 - 142

5146(2) Routeing Chart Mediterranean And Black Seas. (February) 1:5,000,000 - 142

5146(3) Routeing Chart Mediterranean And Black Seas. (March) 1:5,000,000 - 142

5146(4) Routeing Chart Mediterranean And Black Seas. (April) 1:5,000,000 - 142

5146(5) Routeing Chart Mediterranean And Black Seas. (May) 1:5,000,000 - 142

5146(6) Routeing Chart Mediterranean And Black Seas. (June) 1:5,000,000 - 142

5146(7) Routeing Chart Mediterranean And Black Seas. (July) 1:5,000,000 - 142

5146(8) Routeing Chart Mediterranean And Black Seas. (August) 1:5,000,000 - 142

5146(9) Routeing Chart Mediterranean And Black Seas. (September) 1:5,000,000 - 142

5146(10) Routeing Chart Mediterranean And Black Seas. (October) 1:5,000,000 - 142

5146(11) Routeing Chart Mediterranean And Black Seas. (November) 1:5,000,000 - 142

5146(12) Routeing Chart Mediterranean And Black Seas. (December) 1:5,000,000 - 142

Meteorological data has been updated throughout these routeing charts.

Principal ports, shipping routes, ocean current flow and load line zones are
also shown on the charts to facilitate trans-oceanic passage planning. (All
twelve monthly versions of the chart are being published simultaneously).

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk02/20 1.8
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

Reproductions of Australian Government Charts

(Publication dates of these charts reflect the dates shown on the Australian Government Charts)

Chart Published Title and other remarks Scale Folio 2020 Catalogue
page

AUS65 13/12/2019 Australia - West Coast, Western Australia, Approaches to Barrow 1:50,000 63 92
Island.

Includes changes to depths and general updating throughout. (A

modified reproduction of chart AUS65 published by Australia.)

Reproductions of German Government Charts

Chart Title and other remarks Scale Folio 2019 Catalogue

page

DE44 International Chart Series, North Sea – Germany, Entrance to River 1:50,000 9 32
INT1452 Elbe.
Cuxhaven. 1:12,500

Includes changes to depths, buoyage and nature reserves. (A

modified reproduction of INT1452 published by Germany.)

Note: On publication of this New Edition former Notice

6667(P)/19 is cancelled.

DE48 International Chart Series, North Sea – Germany, River Elbe, 9 32

INT1455 Lühesand to Hamburg.
A Lühesand to Teufelsbrück. 1:30,000
B Hamburg. 1:12,500

Includes changes to depths, coastline, lights and nature reserves.

(A modified reproduction of INT1455 published by Germany.)

Note: On publication of this New Edition former Notice

6478(P)/19 is cancelled.

ADMIRALTY Publications

NP No. Title and other remarks Date Remarks

NP62 & ADMIRALTY Sailing Directions 09/01/2020 Updated to Week 39/19 (26/09/19)
e-NP62 Pacific Islands Pilot Volume 3 (Fifteenth Edition) 2020. First updated in NM week 02/20
This edition supersedes NP62 (Fourteenth
ISBN Number: 978-0-70-774-5602 Edition 2016) which is cancelled.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.9 Wk02/20
 I

ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 23 JANUARY 2020

New Editions of ADMIRALTY Charts

Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

246 International Chart Series, Turkey - South East Coast, İskenderun 1:100,000 246 30
INT3660 Körfezi. INT3660

Includes significant safety-related information as follows: a new

anchorage area and changes to harbour limit, anchorage areas,
pilot boarding places and aids to navigation.

247 International Chart Series, Turkey - South East Coast. İskenderun 1:25,000 247 30
INT3794 Körfezi Northern Terminals. INT3794

Includes significant safety-related information as follows: new

pilot boarding places and anchorage area and changes to harbour
limit and anchorage areas.

329 Brazil - North Coast, Entrance to Rio Pará. 1:100,000 329 95

Includes significant safety-related information as follows: changes

to depths.

330 Brazil - North Coast , Rio Pará Cabo Maguari to Ilha do 1:100,000 330 95
Mosqueiro.

Includes significant safety-related information as follows: changes

to depths.

723 China - Yellow Sea, Approaches to Lianyungang. 1:45,000 723 52

Includes significant safety-related information as follows: changes

to depths, buoyage, pilot boarding points and coastline.

890 International Chart Series, Sweden - East Coast, Grundkallen to 890 11

INT1778 Björn with Northern Approaches to Öregrund. 1:50,000 INT1778
A Öregrund. 1:12,500
B Sunnanö. 1:25,000

Includes changes to depths and buoyage. (A modified

reproduction of INT1778 published by Sweden.)

1198 Turkey, İstanbul Boğazi (The Bosporus). 1:30,000 1198 29

Includes significant safety-related information as follows: changes

to depths in Haydarpaşa Limanı.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk02/20 1.10
 I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 23 JANUARY 2020

New Editions of ADMIRALTY Charts (continued)

Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

1515 Mediterranean Sea, Ports on the East Coast of Spain. 1515 25

A Denia. 1:15,000
B Garrucha. 1:7,500
C Aguilas and El Hornillo. 1:12,500
D Sant Carles De La Rapita and Alcanar. 1:25,000
E Carboneras. 1:15,000

Includes significant safety-related information as follows: changes

to buoyage, depths, lights, coastline and fish haven.

1737 China - Taiwan Strait, Quanzhou Gang and Approaches. 1:20,000 1737 50
Xiaozhui Men. 1:10,000

Includes significant safety-related information as follows: changes

to coastline, depths, buoyage and lights.

2114 International Chart Series, France - South Coast, Ports in the Golfe 2114 25
INT3188 du Lion. INT3188
A Sète. 1:15,000
B Port-La-Nouvelle. 1:10,000
C Port-Vendres and Collioure. 1:10,000

Includes significant safety-related information as follows: changes

to depths, anchorage area, regulated areas and approach
channels. (A modified reproduction of INT3188 published by
France.)

2922 United States - East Coast, Maryland - Delaware, Chesapeake Bay, 2922 81
Chesapeake and Delaware Canal and the Northern Approaches to
Baltimore.
1 1:20,000
2 1:20,000
3 1:20,000
4 1:40,000
5 1:40,000

Includes significant safety-related information as follows: changes

to channel limits and project depths.

3034 Spain - Islas Baleares, Mallorca, Approaches to Palma. 1:25,000 3034 25

Includes significant safety-related information as follows: changes

to anchorages areas and restricted areas. (A modified
reproduction of Chart 421A published by Spain.)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.11 Wk02/20
 I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 23 JANUARY 2020

New Editions of ADMIRALTY Charts (continued)

Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

3035 Spain - Islas Baleares, Mallorca, Palma. 1:10,000 3035 25

Includes significant safety-related information as follows: changes

to anchorage areas and restricted areas. (A modified reproduction
of Chart 4211 published by Spain.)

New Editions of ADMIRALTY Leisure Folios

Charts to be
Chart Title and other remarks Scale WITHDRAWN

SC 5605 Chichester to Ramsgate and Calais to Oostende SC 5605

14th Edition 13th Edition
5605.1 A Western Approaches to Dover Strait. 1:500,000
B Northern Approaches to Dover Strait. 1:250,000
5605.2 Dover to Calais. 1:50,000
5605.3 Chichester to Worthing. 1:75,000
5605.4 A Worthing to Newhaven. 1:75,000
B Shoreham Harbour – Western Arm and River Adur. 1:5,000
5605.5 A Newhaven to Hastings. 1:75,000
B Sovereign Harbour. 1:15,000
5605.6 A Hastings to Dungeness. 1:75,000
B Rye. 1:25,000
5605.7 Dungeness to South Foreland. 1:75,000
5605.8 Dover to Deal. 1:37,500
5605.9 Deal to Ramsgate. 1:37,500
5605.10 Calais to Dunkerque. 1:75,000
5605.11 Dunkerque to Blankenberge. 1:100,000
5605.12 A Calais. 1:15,000
B Gravelines. 1:20,000
C Dunkerque. 1:20,000
D Nieuwpoort. 1:20,000
E Oostende. 1:15,000
5605.13 A Newhaven Harbour. 1:5,000
B Littlehampton Harbour. 1:6,250
C Brighton Marina. 1:5,000
D Folkestone Harbour. 1:5,000
5605.14 A Dover. 1:6,250
B Shoreham Harbour – Eastern Arm. 1:5,000
C Shoreham Harbour – The Canal. 1:5,000
5605.15 A Approaches to Ramsgate. 1:12,500
B Ramsgate. 1:5,000

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk02/20 1.12
 I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

128 International Chart Series, Netherlands and Belgium, Westerschelde, Baalhoek to 128
INT1478 Wintam. INT1478

1719 China - Taiwan Strait, Shenhu Wan to Dongding Dao. 1719

2202 Black Sea – Ukraine, Port Yuzhnyy. 2202

2205 Black Sea – Ukraine, Approaches to Odesa and Port Yuzhnyy. 2205

2212 Black Sea – Ukraine, Dnistrovs'kyy Lyman to Dniprovs'kyy Lyman. 2212

2945 International Chart Series, Baltic Sea, Germany and Denmark, Waters between 2945
INT1342 Rügen and Mon. INT1342

3928 Korea - West Coast, Approaches to Mokpo. 3928

5146(1) Routeing Chart Mediterranean And Black Seas. (January) 5146(1)

5146(2) Routeing Chart Mediterranean And Black Seas. (February) 5146(2)

5146(3) Routeing Chart Mediterranean And Black Seas. (March) 5146(3)

5146(4) Routeing Chart Mediterranean And Black Seas. (April) 5146(4)

5146(5) Routeing Chart Mediterranean And Black Seas. (May) 5146(5)

5146(6) Routeing Chart Mediterranean And Black Seas. (June) 5146(6)

5146(7) Routeing Chart Mediterranean And Black Seas. (July) 5146(7)

5146(8) Routeing Chart Mediterranean And Black Seas. (August) 5146(8)

5146(9) Routeing Chart Mediterranean And Black Seas. (September) 5146(9)

5146(10) Routeing Chart Mediterranean And Black Seas. (October) 5146(10)

5146(11) Routeing Chart Mediterranean And Black Seas. (November) 5146(11)

5146(12) Routeing Chart Mediterranean And Black Seas. (December) 5146(12)

AUS65 Australia - West Coast, Western Australia, Approaches to Barrow Island. AUS65

DE44 International Chart Series, North Sea – Germany, Entrance to River Elbe. DE44
INT1452 INT1452

DE48 International Chart Series, North Sea – Germany, River Elbe, Lühesand to DE48
INT1455 Hamburg. INT1455

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.13 Wk02/20
 I
ADMIRALTY CHART AGENT / DISTRIBUTOR INFORMATION

NP131 – Catalogue of Admiralty Charts (NP131), 2020 Edition

Amendment to Part 1, Admiralty Authorised Chart Agent/Distributor
Page 7, Distributor Section

Amend:

Cornes Singapore Pte Ltd

No. 2 Boon Leat Terrace
#05-02/03/04 Harbourside Building 2
119844
T: +65 6223 8320
F: +65 6223 8321
[email protected]
www.cornes-charts.com
IACA, Paper, Digital, POD

NP131 - Catalogue of Admiralty Charts (NP131), 2020 Edition

Amendments to Part 1, Admiralty Authorised Chart Agents / Distributors
Page 6, Distributors section

Add:

NV Chart Group GmbH

t/a HanseNautic
Carlshoehe 75
Eckernfoerde 24340
Germany
T: +49 (0)4351 460 99
F:
[email protected]
https://www.hansenautic.de
Paper, Digital, POD

NP131 – Catalogue of Admiralty Charts (NP131), 2020 Edition

Amendment to Part 1, Admiralty Authorised Chart Agent/Distributor
Page 7, Distributor Section

Amend:

Tuna Ship Supply Ltd Co.

Tuna Gemi Ikmal San. Tic. Ltd. Sti
Eviya Celebi Mah
Genc Osman Caddesi No.44 A/1
Tuzla, Istanbul 34944
T: +90 216 446 7403
F: +90 216 446 7608
[email protected]
www.tunashipping.com
Paper, Digital, POD

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk02/20 1.14
 I
ADMIRALTY CHART AGENT / DISTRIBUTOR INFORMATION

NP131 – Catalogue of Admiralty Charts (NP131), 2020 Edition (continued)

Amendment to Part 1, Admiralty Authorised Chart Agent/Distributor
Page 8, Sub-Distributor Section

Amend:

Korea Chart Co., Ltd

SUB DISTRIBUTOR OF: Global
Navigation Solutions Ltd
34 Haeyang-ro
Yeongdo-gu
Busan
49000
T: +82 51 710 6154
F: +82 51 710 6155
[email protected]
Paper, Digital, POD

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.15 Wk02/20
 II

GEOGRAPHICAL INDEX

(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7

(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7 – 2.12
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.12
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.12 – 2.14
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.14 – 2.17
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19 – 2.20
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.20 – 2.21
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.22
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.22
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.23
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.30
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.30 – 2.32
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.33 – 2.34
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34 – 2.35
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.36 – 2.38
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.39
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.40
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.40 – 2.41
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.41 – 2.42
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.42 – 2.45
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.46 – 2.68

2.1
Wk02/20
 II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
131(P)/20 2.62 95 188 2.15 9
132 2.34 48 189(T)/20 2.46 1
133 2.7 41 190 2.15 9
134(T)/20 2.47 14, 15 191(T)/20 2.49 9
135 2.12 10 192 2.19 18
136* 2.7 3 193 2.39 89
137* 2.7 8 194 2.33 52, 53
138(T)/20 2.55 47 195 2.20 18
139 2.35 48 196* 2.11 16
140* 2.14 6 197(T)/20 2.46 3
141* 2.8 3 198 2.16 9
142 2.12 14 199 2.21 25
143 2.24 47, 50 200 2.39 98
144(P)/20 2.50 27 201* 2.11 7
145* 2.15 7 202(T)/20 2.67 87
146 2.25 47 203(T)/20 2.67 83
147* 2.8 3 204(P)/20 2.63 95
148 2.19 16 205 2.33 52
149 2.40 95 206 2.16 9
150(P)/20 2.48 10 207(T)/20 2.67 83, 85
151* 2.8 6, 7 208(T)/20 2.68 83
152(T)/20 2.56 45 209(P)/20 2.56 52
153 2.41 83, 86 210(P)/20 2.50 30
154 2.10 7 211 2.21 25
155 2.25 50 212* 2.20 16
156(P)/20 2.65 86 213 2.16 9
157* 2.10 1 214 2.29 47
158 2.26 47 215 2.41 95
159 2.26 47 216 2.29 47
160 2.26 52 217 2.17 7, 9
161(P)/20 2.46 3 218(T)/20 2.56 47
162* 2.23 40 219 2.17 9
163(P)/20 2.52 40 220* 2.11 7
164* 2.10 7 221 2.29 47
165* 2.10 2 222 2.41 95
166 2.26 47 223(P)/20 2.56 50
167 2.23 40 224 2.29 50
168 2.27 47 225(P)/20 2.53 40
169 2.30 54 226(T)/20 2.49 9
170 2.31 53 227 2.34 52, 53
171 2.31 53 228 2.30 50
172 2.31 54 229 2.13 11
173 2.31 54 230(P)/20 2.61 98
174 2.20 30 231(T)/20 2.54 42, 43, 45
175 2.32 54 232* 2.12 1
176 2.32 54 233 2.24 41, 42
177 2.32 54 234 2.42 80
178(P)/20 2.57 55 235 2.13 11
179(T)/20 2.57 53 236 2.42 79
180(T)/20 2.57 53 237 2.42 78
181(P)/20 2.58 54 238 2.43 79
182(T)/20 2.61 53, 57 239* 2.12 7
183 2.20 31 240 2.42 84
184 2.27 47 241 2.17 9
185 2.28 50 242(P)/20 2.49 17
186 2.15 9 243 2.43 80, 81
187 2.19 16 244(P)/20 2.54 40

2.2
Wk02/20
 II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
245(T)/20 2.52 35
246 2.24 43
247 2.35 47, 48
248 2.22 35
249 2.43 81
250 2.43 80
251 2.13 10
252 2.34 52, 53
253(T)/20 2.55 32, 41, 42
254 2.36 66
255 2.22 34
256(P)/20 2.64 95
257 2.34 52
258 2.36 65, 66
259 2.40 97
260 2.42 83
261 2.42 83
262 2.39 89
263 2.36 64
264(P)/20 2.58 46
265(P)/20 2.59 60
266 2.37 65
267 2.44 78
268 2.37 63
269 2.17 7, 9
270 2.44 81
271 2.37 67
272 2.35 58, 60, 63
273 2.38 63
274(P)/20 2.49 9
275 2.38 64
276 2.44 79
277 2.45 79
278 2.14 11
279(P)/20 2.47 6
280 2.38 65
281 2.22 35, 36

2.3
Wk02/20
 II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices

Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

2 151 1534 239

26 157 1535 164
86 195 1546 191T
105 151 1568 159
125 217 1605 223P
126 191T 1607 137
127 194, 227, 252 1609 137
148 232 1613 189T
207 188 1631 217
220 144P 1633 186
246 210P 1648 170
247 210P 1730 192
266 145 1752 197T
292 140 1753 197T
317 231T 1759 185
341 143 1774 259
343 166 1776 259
344 184 1826 136
348 214 1872 269
359 203T 1873 269
375 208T 1874 269
420 241 1900 189T
444 240 1975 154
446 259 2002 131P
483 202T 2013 147
509 230P 2026 148, 187
526 149 2027 187
551 222 2056 264P
586 230P 2069 231T
707 233, 253T 2093 136
709 253T 2094 136
728 201 2104 174
734 220 2115 251
735 220 2167 278
736 201 2182A 145
828 231T 2182B 145
830 231T 2182C 140
896 227 2189 204P, 256P
913 205, 257 2198 197T
1039 138T 2199 141
1105 193 2237 183
1106 262 2241 135
1121 161P 2276 150P
1123 165 2321 142
1126 185 2327 142
1165 165 2347 182T
1179 165 2349 148
1187 151 2350 148
1199 155, 224 2395 229
1214 163P 2401 228
1236 245T, 248 2403 152T
1258 205 2412 182T
1267 189T, 232 2413 228
1272 183 2419 228
1286 160 2449 269
1287 160 2472 272
1303 224 2492 243
1304 224 2523 244P
1305 155 2594 251
1346 147 2605 270
1398 231T 2614 235
1406 269 2648 187
1408 151, 217 2666 237, 267
1422 219 2683 134T
1441 156P 2738 253T
1444 144P 2751 207T
1450 156P 2762 199
1503 151 2785 264P
1514 211 2837 244P

2.4
Wk02/20
 II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices

Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

2847 244P 4508 168

2858 244P 4509 182T
2862 264P 4703 253T
2874 272 4705 253T
2875 265P 4706 231T, 253T
2876 265P 4707 231T, 253T
2884 163P 4721 272
2886 167, 244P 4722 272
2887 244P 4734 267
2903 272 4746 243
2908 272 4747 250
2909 272 4748 250
2910 272 4749 234
2915 265P 4751 250
2919 249 4765 276
2943 153 4766 236
2974 259 4770 276
2986 242P 4775 277
3026 143 4792 238
3136 134T 5523 144P
3137 134T 8118 225P
3184 260 8167 209P
3213 259 8195 207T
3278 196 8276 279P
3296 272
3300 281 Australian
3365 205 Notices
3382 261 Chart No.
3391 194, 252
3482 168, 247 Aus 64 273
3483 247 Aus 69 273
3488 168 Aus 115 275
3566 259 Aus 151 266
3656 212 Aus 249 254
3666 227 Aus 251 254
3706 265P Aus 309 268
3750 154 Aus 316 268
3772 244P Aus 357 280
3773 162 Aus 387 271
3783 225P Aus 487 280
3787 225P Aus 722 268
3789 225P Aus 753 263
3829 278 Aus 807 258
3859 255 Aus 808 258
3874 158, 216
3879 146, 221 German
3882 218T Notices
Chart No.
3898 235
3950 225P, 244P DE 4 213
3959 215, 256P DE 20 190
3962 215, 256P DE 42 198
3985 146 DE 44 274P
3987 168, 216 DE 46 206, 226T
3988 216
4010 134T
4100 134T Indian
Notices
4140 151 Chart No.
4142 245T
4171 281 IN 22 233, 253T
4172 281 IN 31 231T
4175 255 IN 33 231T
4176 255 IN 203 133
4179 281 IN 255 233
4249 200 IN 292 233, 253T
4400 153 IN 293 233
4401 153 IN 2083 133
4402 153 IN 3001 231T
4412 132 IN 3004 231T
4427 139 IN 3012 246

2.5
Wk02/20
 II

INDEX OF CHARTS AFFECTED

Indian
Admiralty Chart No. Notices International
Admiralty Chart No. Notices
Notices
Chart No. Chart No.
INT 1465 188
Japanese INT 1468 191T
Notices INT 1470 191T
Chart No. INT 1474 269
INT 1480 269
JP 67 180T INT 1509 151
JP 101A 176, 177, 181P INT 1544 220
JP 101B 177 INT 1545 220
JP 106 181P INT 1546 201
JP 108 170, 171 INT 1558 239
JP 112 172, 173 INT 1559 164
JP 135 169 INT 1562 137
JP 150C 172 INT 1607 136
JP 150A 181P INT 1610 165
JP 1030 178P INT 1661 197T
JP 1033A 178P INT 1664 197T
JP 1034 178P INT 1707 187
JP 1036 178P INT 1724 157
JP 1061 180T INT 1840 242P
JP 1062 180T INT 2051 255
JP 1088 179T INT 2052 255
JP 1103 181P INT 2610 255
JP 1110 175 INT 2672 245T
JP 1263 169 INT 2673 245T, 248
INT 3176 211
International INT 3660 210P
Notices INT 3661 174
Chart No.
INT 3794 210P
INT 10 134T INT 5251 227
INT 100 134T INT 5252 205
INT 140 151 INT 5254 205, 257
INT 160 151 INT 5355 227
INT 400 153 INT 5360 194, 252
INT 401 153 INT 7017 244P
INT 402 153 INT 7018 244P
INT 508 168 INT 7021 233, 253T
INT 509 182T INT 7022 233
INT 550 168, 247 INT 7051 281
INT 551 247 INT 7232 244P
INT 552 168 INT 7243 167, 244P
INT 703 253T INT 7244 225P, 244P
INT 705 253T INT 7245 225P
INT 706 231T, 253T INT 7249 244P
INT 707 231T, 253T INT 7250 244P
INT 721 272 INT 7278 163P
INT 722 272 INT 7319 133
INT 750 244P INT 7334 233
INT 752 233, 253T INT 7339 133
INT 755 231T INT 7400 231T
INT 756 231T INT 7402 231T
INT 1041 140 INT 7403 231T
INT 1042 145 INT 7411 246
INT 1043 145 INT 7560 281
INT 1044 219 INT 7570 281
INT 1062 161P INT 9158 259
INT 1132 278 INT 9163 259
INT 1156 235 INT 9311 134T
INT 1195 235 INT 9313 134T
INT 1331 251 INT 11321 278
INT 1366 198
INT 1417 186
INT 1418 217
INT 1422 217
INT 1424 190
INT 1451 241
INT 1452 274P
INT 1453 206, 226T
INT 1457 213

2.6
Wk02/20
 II
133 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

IN 203 5775/19 Effective from 26/12/19

INT 7319 Insert magenta limit and chart reference, IN2060 (see Note – POSITIONS), as follows:

22° 38´·97N., 69° 44´·02E.

22° 38´·97N., 69° 30´·42E.
22° 25´·97N., 69° 30´·42E.
22° 25´·97N., 69° 38´·67E.
22° 25´·54N., 69° 38´·67E.
22° 25´·54N., 69° 43´·62E.
22° 25´·97N., 69° 43´·62E.
22° 25´·97N., 69° 44´·02E.
Replace existing note, CHARTS IN2018, IN2051, IN2059, IN2080 AND IN2083:
POSITIONS, with the accompanying note, CHARTS IN2018, IN2051, IN2059, IN2060,
IN2080 AND IN2083: POSITIONS, centred on 23° 02´·75N., 69° 41´·56E.

IN 2083 5142/19 Effective from 26/12/19

INT 7339 Amend reference in W border at latitude 22° 26´·6N. to read, Adjoining Chart IN2060

136* ISLE OF MAN - Wreck.

Source: Isle of Man Harbours Notice 16/19

Chart 1826 (INT 1607) [ previous update 5902/19 ] ETRS89 DATUM

Insert
27, Wk 54° 07´·26N., 4° 51´·61W.

Chart 2093 [ previous update 117/20 ] ETRS89 DATUM

Insert
27, Wk 54° 07´·26N., 4° 51´·61W.

Chart 2094 [ previous update 122/20 ] ETRS89 DATUM

Insert
27, Wk 54° 07´·26N., 4° 51´·61W.

137* ENGLAND - East Coast - Depths. Obstruction. Foul.

Source: Port of London Authority

Chart 1607 (INT 1562) [ previous update 6600/19 ] ETRS89 DATUM

Insert depth, 63 (a) 51° 31´·77N., 0° 59´·84E.
Delete depth, 72, close SW of: (a) above
Replace
10&, Obstn with « 51° 32´·51N., 1° 01´·76E.

Chart 1609 [ previous update 90/20 ] ETRS89 DATUM

Insert depth, 63 (a) 51° 31´·77N., 0° 59´·84E.
Delete depth, 72, close SW of: (a) above
Replace
10&, Obstn with « 51° 32´·51N., 1° 01´·76E.

2.7
Wk02/20
 II

141* SCOTLAND - West Coast - Depths.

Source: ms Lode

Chart 2199 [ previous update 117/20 ] ETRS89 DATUM

Insert depth, 45, enclosed by 5m contour (a) 55° 06´·72N., 5° 00´·54W.
Delete depth, 76, close NE of: (a) above

147* ENGLAND - West Coast - Legends. Wind turbines. Pile. Buoy. Lights.
Source: RWE Renewables

Chart 1346 [ previous update 4299/19 ] ETRS89 DATUM

Insert symbol, wind turbine, AeroF.R (a) 54° 45´·76N., 3° 44´·21W.
Delete symbol, wind turbine, AeroF.R, close NE of: (a) above
Insert symbol, wind turbine, AeroF.R 54° 46´·04N., 3° 43´·13W.

Chart 2013 [ previous update 4299/19 ] ETRS89 DATUM

Insert legend, E1 (F.R.Lts), at wind turbine 54° 45´·76N., 3° 44´·21W.
legend, C1 (F.R.Lts), at wind turbine 54° 46´·04N., 3° 43´·13W.
Replace symbol, wind turbine with pile, ã (a) 54° 46´·15N., 3° 42´·56W.
Delete
EfFl.Y.5s, close NE of: (a) above
legend, D1 (F.R.Lts), at wind turbine 54° 45´·91N., 3° 43´·70W.

151* ENGLAND - East Coast - Platforms. Automatic Identification Systems. Fouls.

Source: Chrysaor

Chart 2 (INT 160) [ previous update 6538/19 ] WGS84 DATUM

Delete
¼{ 53° 15´·4N., 1° 58´·1E.
53° 19´·5N., 2° 22´·1E.

Chart 105 [ previous update 54/20 ] ETRS89 DATUM

Replace
¼{49/17-HD and associated Automatic Identification System,
AIS with «
53° 29´·80N., 2° 19´·46E.

¼{ 49/17-LD with « 53° 28´·49N., 2° 13´·82E.

¼{ 49/17-GD and associated Automatic Identification System,

AIS with «
53° 26´·85N., 2° 15´·29E.

¼{ 49/16-ED and associated Automatic Identification System,

AIS with «
53° 25´·99N., 2° 09´·19E.

¼{ 49/22-JD with « 53° 19´·64N., 2° 21´·74E.

¼{ 48/25-PUR with « 53° 15´·44N., 1° 58´·22E.

2.8
Wk02/20
 II
151* ENGLAND - East Coast - Platforms. Automatic Identification Systems. Fouls. (continued)

Chart 1187 [ previous update 5255/19 ] ETRS89 DATUM

Replace
¼{ 49/12-KD with « 53° 31´·69N., 2° 13´·30E.

Chart 1408 [ previous update 54/20 ] WGS84 DATUM

Delete
¼{ 48/25-PUR 53° 15´·4N., 1° 58´·2E.

¼{ 49/16-ED and associated Automatic Identification System,

AIS 53° 26´·0N., 2° 09´·1E.

¼{ 49/17-GD and associated Automatic Identification System,

AIS 53° 26´·9N., 2° 15´·3E.

¼{ 49/17-LD 53° 28´·5N., 2° 13´·8E.

¼{ 49/12-KD 53° 31´·7N., 2° 13´·3E.

¼{ 49/17-HD and associated Automatic Identification System,

AIS 53° 29´·8N., 2° 19´·4E.

¼{ 49/17-DD and associated Automatic Identification System,

AIS 53° 26´·4N., 2° 23´·6E.

¼{ 49/17-CD and associated Automatic Identification System,

AIS 53° 25´·4N., 2° 22´·4E.

¼{ 49/22-JD
53° 19´·7N., 2° 21´·7E.

Chart 1503 (INT 1509) [ previous update 54/20 ] ETRS89 DATUM

Replace
¼{ 49/16-ED AIS with « 53° 25´·99N., 2° 09´·19E.

¼{ 49/17-GD V-AIS with « 53° 26´·85N., 2° 15´·29E.

¼{ 49/17-LD with « 53° 28´·49N., 2° 13´·82E.

¼{ 49/12-KD with « 53° 31´·69N., 2° 13´·30E.

¼{ 49/17-HD V-AIS with « 53° 29´·80N., 2° 19´·46E.

¼{ 49/17-DD V-AIS with « 53° 26´·44N., 2° 23´·62E.

¼{ 49/17-CD V-AIS with « 53° 25´·36N., 2° 22´·51E.

¼{ 49/22-JD with « 53° 19´·64N., 2° 21´·74E.

¼{ 48/25-PUR with « 53° 15´·44N., 1° 58´·22E.

Chart 4140 (INT 140) [ previous update 6668/19 ] WGS84 DATUM

Delete
¼{ 53° 19´·5N., 2° 22´·4E.

2.9
Wk02/20
 II

154 ENGLAND - East Coast - Buoyage.

Source: Crouch Harbour Authority

Chart 1975 [ previous update 6651/19 ] ETRS89 DATUM

Move
HZRaysand
p Middle, from:
51° 39´·96N., 0° 59´·47E.
to: 51° 40´·00N., 0° 59´·00E.

Chart 3750 [ previous update 5614/19 ] ETRS89 DATUM

Insert
HZRaysand
p Middle
51° 40´·00N., 0° 59´·00E.
Delete
HZRaysand
p Middle
51° 40´·00N., 0° 59´·50E.

157* ENGLAND - South Coast - Lights.

Source: Tor Bay Harbour Authority

Chart 26 (INT 1724) (Panel B, Brixham Harbour) [ previous update New Edition 21/11/2019 ] ETRS89 DATUM
Amend light to, 2F.R(vert) 50° 23´·958N., 3° 30´·604W.
light to, 2F.G(vert) 50° 24´·075N., 3° 30´·443W.

164* ENGLAND - East Coast - Wreck.

Source: British Government Survey

Chart 1535 (INT 1559) [ previous update 6314/19 ] ETRS89 DATUM

Insert
4)+ Wk 52° 27´·31N., 1° 44´·59E.

165* WALES - South Coast - Depths.

Source: ms Northern Wind

Chart 1123 [ previous update 5999/19 ] ETRS89 DATUM

Replace depth 204, with depth, 177, enclosed by 20m contour 51° 24´·4N., 3° 59´·9W.

Chart 1165 [ previous update New Edition 22/08/2019 ] ETRS89 DATUM

Insert depth, 177, enclosed by 20m contour 51° 24´·44N., 3° 59´·88W.
depth, 189, enclosed by 20m contour (a) 51° 24´·23N., 4° 01´·76W.
Delete depth, 215, close S of: (a) above
Replace depth, 25, with depth, 235 51° 27´·29N., 4° 05´·48W.

Chart 1179 (INT 1610) [ previous update 4516/19 ] ETRS89 DATUM

Insert depth, 177, enclosed by 20m contour (a) 51° 24´·44N., 3° 59´·88W.
Delete depth, 204, close W of: (a) above
Insert depth, 189, enclosed by 20m contour 51° 24´·23N., 4° 01´·76W.
Replace depth, 25, with depth, 235, and extend 30m contour W to
enclose 51° 27´·29N., 4° 05´·48W.

2.10
Wk02/20
 II

196* CHANNEL ISLANDS - Jersey - Depths.

Source: Ports of Jersey survey

Chart 3278 [ previous update 1609/19 ] WGS84 DATUM

Insert depth, 1, enclosed by 2m contour (a) 49° 10´·138N., 2° 07´·175W.
Delete depth, 25, close SW of: (a) above

201* SCOTLAND - East Coast - Lights.

Source: Forth Ports Limited Notice 3/19

Chart 728 [ previous update 1290/19 ] ETRS89 DATUM

Delete
¶ Fl.3s5m9M and associated sectors 56° 00´·306N., 3° 24´·769W.
56° 00´·275N., 3° 24´·730W.

Chart 736 (INT 1546) [ previous update 2306/19 ] ETRS89 DATUM

Delete
¶ Fl.3s9M 56° 00´·306N., 3° 24´·769W.
56° 00´·275N., 3° 24´·730W.

220* SCOTLAND - East Coast - Depths.

Source: Forth Ports Ltd

Chart 734 (INT 1544) [ previous update 6314/19 ] ETRS89 DATUM

Replace depth, 129, with depth, 116 56° 00´·38N., 3° 08´·59W.

Chart 735 (INT 1545) (Panel, Leith) [ previous update 4736/19 ] ETRS89 DATUM
Insert depth, 47, and extend 5m contour NE to enclose (a) 56° 00´·086N., 3° 09´·746W.
Delete depth, 53, close NW of: (a) above

Chart 735 (INT 1545) [ previous update 4736/19 ] ETRS89 DATUM

Insert depth, 47, and extend 5m contour N to enclose (a) 56° 00´·09N., 3° 09´·75W.
Delete depth, 53, close NW of: (a) above
Insert depth, 116 (b) 56° 00´·38N., 3° 08´·59W.
Delete depth, 129, close NW of: (b) above

2.11
Wk02/20
 II

232* ENGLAND - South Coast - Depths.

Source: ms Northern Wind

Chart 148 [ previous update 4458/19 ] ETRS89 DATUM

Insert depth, 16 50° 18´·44N., 4° 42´·74W.
depth, 101 (a) 50° 18´·83N., 4° 42´·02W.
Delete depth, 146, close NW of: (a) above
Insert depth, 122 (b) 50° 17´·79N., 4° 40´·90W.
Delete depth, 152, close SE of: (b) above
Insert depth, 115, and extend 15m contour NE to enclose (c) 50° 17´·38N., 4° 41´·16W.
Delete depth, 131, close SW of: (c) above

Chart 1267 [ previous update 5050/19 ] ETRS89 DATUM

Insert depth, 101 50° 18´·83N., 4° 42´·02W.
depth, 16 (a) 50° 18´·44N., 4° 42´·74W.
Delete depth, 186, close NE of: (a) above
Insert depth, 115 (b) 50° 17´·38N., 4° 41´·16W.
Delete depth, 131, close SW of: (b) above
Replace depth, 152, with depth, 122 50° 17´·79N., 4° 40´·90W.

239* ENGLAND - East Coast - Depths.

Source: British Government Survey

Chart 1534 (INT 1558) [ previous update 6314/19 ] ETRS89 DATUM

Insert depth, 41, and extend 5m contour NE to enclose (a) 52° 41´·44N., 1° 45´·51E.
Delete depth, 71, close SE of: (a) above
Insert depth, 57 52° 41´·19N., 1° 45´·77E.
Replace depth, 12, with depth, 73, and extend 10m contour NE to
enclose 52° 41´·33N., 1° 45´·74E.

142 NORWAY - West Coast - NM Block.

Source: Norwegian Notices 22/60847/19, 22/60849/19, 22/60852/19 and Norwegian Lights List

Chart 2321 [ previous update 75/20 ] WGS84 DATUM

Insert the accompanying block, centred on: 67° 50´·6N., 12° 53´·1E.

Chart 2327 [ previous update 75/20 ] WGS84 DATUM

Insert the accompanying block, centred on: 67° 50´·6N., 12° 52´·6E.

135 ESTONIA - Wreck.

Source: Estonian Notice 12/189/19

Chart 2241 [ previous update 6654/19 ] WGS84 DATUM

Insert
´ 59° 14´·48N., 23° 27´·16E.

2.12
Wk02/20
 II

229 RUSSIA - Baltic Sea Coast - Lights. Leading lines.

Source: Russian Notice 50/5814/19

Chart 2395 [ previous update 5412/19 ] WGS84 DATUM

Insert
¶ 2 Dir.Al.Fl.WRG.5s4M (a) 60° 01´·56N., 29° 50´·02E.
leading line, firm line for 6940m, extending in direction
344·9°, from: (b) (a) above
legend, 164·9°-344·9°, seaward end of: (b) above

¶{ (c) 60° 01´·54N., 29° 50´·03E.

leading line, firm line for 9120m, extending in direction
164·9°, from: (d) (c) above
legend, 164·9°-344·9°, seaward end of: (d) above

235 FINLAND - Saaristomeri - NM Blocks.

Source: Finnish Notice 33/277/19

Chart 2614 (INT 1156) [ previous update 3720/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 60° 05´·7N., 19° 55´·3E.

Chart 3898 (INT 1195) [ previous update 3720/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 60° 05´·7N., 19° 55´·0E.

251 SWEDEN - West Coast - Virtual aid to navigation.

Source: Swedish Notice 785/14571/19

Chart 2115 [ previous update 5731/19 ] WGS84 DATUM

Insert symbol, Virtual aid to navigation, safe water topmark, V-AIS 55° 54´·6N., 12° 44´·5E.

Chart 2594 (INT 1331) [ previous update 6374/19 ] WGS84 DATUM

Insert symbol, Virtual aid to navigation, safe water topmark, V-AIS 55° 54´·6N., 12° 44´·5E.

2.13
Wk02/20
 II

278 FINLAND - West Coast - Maritime limits. Recommended track. Buoy.

Source: Finnish Notice 33/279/19

Chart 2167 (INT 11321) (Panel, Rauma) [ previous update 5971/19 ] WGS84 DATUM
Insert maritime limit, pecked line, joining: (a) 61° 07´·900N., 21° 25´·340E.
(b) 61° 08´·260N., 21° 25´·460E.
61° 08´·220N., 21° 25´·890E.
(c) 61° 08´·140N., 21° 26´·130E.
Move
JUfrom: (d) 61° 08´·225N., 21° 25´·615E.
to: (b) above
Delete former maritime limit, pecked line, joining: (a) above
(d) above
61° 08´·197N., 21° 25´·939E.
(c) above
recommended track, firm line, with maximum authorised
draught, <5·9m>, joining: 61° 08´·253N., 21° 25´·630E.
61° 07´·910N., 21° 25´·120E.

Chart 2167 (INT 11321) [ previous update 5971/19 ] WGS84 DATUM

Move
JUfrom: 61° 08´·23N., 21° 25´·61E.
to: 61° 08´·26N., 21° 25´·46E.
Delete recommended track, firm line, with maximum authorised
draught, <5·9m>, joining: 61° 08´·25N., 21° 25´·63E.
61° 07´·91N., 21° 25´·11E.

Chart 3829 (INT 1132) [ previous update 5971/19 ] WGS84 DATUM

Move
JUfrom: 61° 08´·23N., 21° 25´·61E.
to: 61° 08´·26N., 21° 25´·46E.
Delete recommended track, firm line, with maximum authorised
draught, <5·9m>, joining: 61° 08´·26N., 21° 25´·59E.
61° 07´·92N., 21° 25´·10E.

140* NORTH SEA - United Kingdom Sector - Legend. Buoy.

Source: UKHO

Chart 292 [ previous update 5644/19 ] WGS84 DATUM

Delete legend, Under Const (2015), centred on: 59° 35´·91N., 1° 02´·06E.

EFl.Y 59° 35´·38N., 1° 02´·25E.

Chart 2182C (INT 1041) [ previous update 6538/19 ] WGS84 DATUM

Delete legend, Under const (2015), centred on: 59° 35´·1N., 0° 58´·0E.

2.14
Wk02/20
 II

145* NORTH SEA - United Kingdom Sector - Automatic Identification Systems.

Source: Trinity House

Chart 266 [ previous update 105/20 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at CYGNUS BWH
platform 54° 35´·88N., 2° 11´·69E.
Automatic Identification System, AIS, at CYGNUS APU
platform 54° 34´·12N., 2° 17´·38E.

Chart 2182A (INT 1043) [ previous update 105/20 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at platform 54° 35´·9N., 2° 11´·7E.
54° 34´·1N., 2° 17´·4E.

Chart 2182B (INT 1042) [ previous update 105/20 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at platform 54° 35´·9N., 2° 11´·7E.
54° 34´·1N., 2° 17´·4E.

186 NETHERLANDS - Submarine power cable.

Source: Netherlands Notice 49/422/19
Note: Chart 1633 is to be deleted from the list of charts affected by Notice 3627(P)/19.

Chart 1633 (INT 1417) [ previous update 5377/19 ] WGS84 DATUM

Insert submarine power cable, ÉÊÉ, joining: 54° 13´·00N., 6° 25´·08E.
53° 57´·91N., 6° 24´·78E.
53° 54´·85N., 6° 28´·81E.
53° 42´·65N., 6° 33´·10E.
53° 40´·21N., 6° 32´·66E.
53° 37´·79N., 6° 28´·87E.
53° 36´·48N., 6° 28´·76E.
53° 36´·22N., 6° 33´·38E.
53° 29´·76N., 6° 42´·90E.

188 NETHERLANDS - Light.

Source: Netherlands Notice 49/424/19

Chart 207 (INT 1465) [ previous update New Edition 29/08/2019 ] WGS84 DATUM
Delete
·Fl.Y.5s17m6M 51° 59´·53N., 4° 00´·50E.

190 GERMANY - North Sea Coast - Depths.

Source: German Notice 49/20/19

Chart DE 20 (INT 1424) [ previous update 6183/19 ] WGS84 DATUM

Insert depth, 136 (a) 53° 45´·09N., 8° 12´·03E.
Delete depth, 145, close SE of: (a) above

2.15
Wk02/20
 II

198 GERMANY - North Sea Coast - NM Block.

Source: German Notice 49/42/19

Chart DE 42 (INT 1366) (Panel C, Brunsbüttel) [ previous update 6695/19 ] WGS84 DATUM
Insert the accompanying block, centred on: 53° 53´·0N., 9° 09´·8E.

206 GERMANY - North Sea Coast - NM Block. Dredged area. Dredged depth. Depths.
Source: German Notice 49/46/19

Chart DE 46 (INT 1453) (Panel, Brunsbüttel) [ previous update 6695/19 ] WGS84 DATUM
Insert the accompanying block, centred on: 53° 53´·0N., 9° 09´·7E.

Chart DE 46 (INT 1453) [ previous update 6695/19 ] WGS84 DATUM

Insert limit of dredged area, pecked line, joining: (a) 53° 52´·91N., 9° 08´·77E.
(b) 53° 53´·15N., 9° 10´·00E.
(c) 53° 53´·15N., 9° 10´·70E.
(d) 53° 52´·92N., 9° 10´·24E.
dredged depth, 16·1m, within: (a)-(d) above
Delete depth, 15 53° 53´·13N., 9° 10´·32E.
depth, 136 53° 52´·99N., 9° 09´·98E.
depth, 129 53° 53´·01N., 9° 09´·53E.
depth, 144 53° 52´·91N., 9° 09´·27E.
Insert depth, 105 (e) 53° 52´·61N., 9° 15´·35E.
Delete depth, 115, close S of: (e) above
Replace depth, 113, with depth, 105 53° 52´·15N., 9° 16´·99E.

213 GERMANY - North Sea Coast - Depth.

Source: German Notice 49/4/19

Chart DE 4 (INT 1457) (Panel B, Bremerhaven) [ previous update 2593/19 ] WGS84 DATUM
Insert depth, 99, enclosed by 10m contour 53° 33´·034N., 8° 33´·670E.

Chart DE 4 (INT 1457) [ previous update 2593/19 ] WGS84 DATUM

Insert depth, 99, enclosed by 10m contour 53° 33´·03N., 8° 33´·67E.

2.16
Wk02/20
 II

217 NETHERLANDS - Depths.

Source: Netherlands Notice 49/418/19

Chart 125 (INT 1422) [ previous update 3756/19 ] WGS84 DATUM

Insert depth, 88, enclosed by 10m contour 52° 30´·19N., 4° 28´·14E.

Chart 1408 [ previous update 151/20 ] WGS84 DATUM

Insert depth, 88, and extend 10m contour W to enclose (a) 52° 30´·2N., 4° 28´·1E.
Delete depth, 125, close W of: (a) above
depth, 95, close E of: (a) above

Chart 1631 (INT 1418) [ previous update 6668/19 ] WGS84 DATUM

Insert depth, 88, enclosed by 10m contour 52° 30´·19N., 4° 28´·14E.

219 DENMARK - North Sea Coast - Harbour limits. Legend.

Source: Danish Chart Correction 48/589/19

Chart 1422 (INT 1044) (Panel B, Hvide Sande) [ previous update 5221/19 ] WGS84 DATUM
Insert harbour limit, pecked line, joining: 55° 59´·909N., 8° 06´·499E.
55° 59´·909N., 8° 06´·300E.
and
(a) 55° 59´·823N., 8° 06´·537E.
(b) 55° 59´·726N., 8° 06´·300E.
legend, Harbour Limit, along N side of: (a)-(b) above

241 DENMARK - North Sea Coast - NM Block.

Source: Danish Chart Correction 48/591/19

Chart 420 (INT 1451) [ previous update 3481/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 55° 29´·0N., 8° 24´·6E.

269 BELGIUM - Depths.

Source: Belgian Notice 25/303/19

Chart 1406 [ previous update 6570/19 ] WGS84 DATUM

Insert depth, 77 (a) 51° 20´·82N., 2° 42´·21E.
Delete depth, 88, close N of: (a) above

2.17
Wk02/20
 II
269 BELGIUM - Depths. (continued)

Chart 1872 [ previous update New Edition 19/12/2019 ] WGS84 DATUM

Insert depth, 77 and extend 10m contour SE to enclose (a) 51° 20´·82N., 2° 42´·21E.
Delete depth, 89, close NW of: (a) above
Insert depth, 52 (b) 51° 18´·58N., 2° 40´·46E.
Delete depth, 7, close SW of: (b) above
Insert depth, 84 (c) 51° 17´·60N., 2° 40´·19E.
Delete depth, 92, close N of: (c) above
Insert depth, 47, enclosed by 5m contour (d) 51° 16´·97N., 2° 38´·75E.
Delete depth, 53, close N of: (d) above
Insert depth, 69 (e) 51° 13´·84N., 2° 35´·14E.
Delete depth, 76, close S of: (e) above

Chart 1873 (INT 1480) [ previous update 6297/19 ] WGS84 DATUM

Insert depth, 77, and extend 10m contour SE to enclose (a) 51° 20´·82N., 2° 42´·21E.
Delete depth, 89, close N of: (a) above
Insert depth, 52 (b) 51° 18´·58N., 2° 40´·46E.
Delete depth, 7, close SW of: (b) above
Insert depth, 83 (c) 51° 18´·32N., 2° 40´·88E.
Delete depth, 9, close NW of: (c) above
depth,126 (d) 51° 17´·88N., 2° 39´·77E.
Insert depth, 82 and extend 10m contour SW to enclose (d) above 51° 18´·15N., 2° 40´·04E.
depth, 84 (e) 51° 17´·60N., 2° 40´·19E.
Delete depth, 92, close NE of: (e) above
Insert depth, 47, enclosed by 5m contour (f) 51° 16´·97N., 2° 38´·75E.
Delete depth, 53, close NE of: (f) above
Insert depth, 69 (g) 51° 13´·84N., 2° 35´·14E.
Delete depth, 76, close SE of: (g) above

Chart 1874 (INT 1474) [ previous update New Edition 19/12/2019 ] WGS84 DATUM
Insert depth, 77, and extend 10m contour SE to enclose (a) 51° 20´·82N., 2° 42´·21E.
Delete depth, 89, close NW of: (a) above
Insert depth, 83 (b) 51° 18´·32N., 2° 40´·88E.
Delete depth, 9, close NW of: (b) above

Chart 2449 [ previous update 5961/19 ] WGS84 DATUM

Insert depth, 77, and extend 10m contour SE to enclose (a) 51° 20´·82N., 2° 42´·21E.
Delete depth, 89, close N of: (a) above
Insert depth, 52 (b) 51° 18´·58N., 2° 40´·46E.
Delete depth, 7, close SW of: (b) above
Insert depth, 84 (c) 51° 17´·60N., 2° 40´·19E.
Delete depth, 92, close N of: (c) above
Replace depth, 53, with depth, 47, enclosed by 5m contour 51° 16´·97N., 2° 38´·75E.
depth, 76, with depth, 69 51° 13´·84N., 2° 35´·14E.

2.18
Wk02/20
 II

148 FRANCE - West Coast - Marine farms.

Source: French Notice 49/40/19

Chart 2026 [ previous update 3197/19 ] WGS84 DATUM

Insert
Ë 48° 42´·40N., 3° 55´·25W.
48° 44´·00N., 3° 52´·50W.
48° 45´·57N., 3° 44´·14W.

Ì 48° 46´·33N., 3° 46´·34W.

Chart 2349 [ previous update 1768/19 ] WGS84 DATUM

Insert
Ë 48° 14´·55N., 4° 37´·43W.

Ì 48° 05´·12N., 4° 34´·49W.

Chart 2350 [ previous update 6670/19 ] WGS84 DATUM

Insert
Ì 48° 14´·52N., 4° 37´·43W.
48° 05´·14N., 4° 34´·49W.

187 FRANCE - North Coast - Lights. Legend.

Source: French Notice 49/37/19

Chart 2026 [ previous update 148/20 ] WGS84 DATUM

Amend legend to, 121°, centred on: 48° 43´·98N., 3° 35´·78W.
light to, Dir Q.WRG.39m12/8M (a) 48° 43´·28N., 3° 34´·11W.
Delete
¶ Q.R.21m7M, close NW of: (a) above

Chart 2027 [ previous update 5099/18 ] WGS84 DATUM

Amend legend to, 121°, centred on: 48° 43´·98N., 3° 35´·78W.
light to, Dir Q.WRG.39m12/8M (a) 48° 43´·28N., 3° 34´·11W.
Delete
¶ Q.R.21m7M, close NW of: (a) above

Chart 2648 (INT 1707) [ previous update 4110/19 ] WGS84 DATUM

Amend light to, Dir Q.WRG (a) 48° 43´·27N., 3° 34´·10W.
Delete
¶ Q.R, close NW of: (a) above

192 SPAIN - West Coast - Buoyage.

Source: Spanish Notice 49/391/19

Chart 1730 [ previous update 5582/19 ] WGS84 DATUM

Insert
G;Fl(5)Y.20s2M
f ODAS
42° 10´·68N., 8° 53´·80W.
Delete
PfFl(5)Y.20s2M ODAS 42° 10´·07N., 8° 54´·76W.

2.19
Wk02/20
 II

195 SPAIN - South West Coast - Automatic Identification Systems.

Source: Spanish Notice 49/393/19

Chart 86 [ previous update 605/19 ] WGS84 DATUM

Delete Automatic Identification System, AIS, at light-buoy 36° 35´·99N., 6° 23´·86W.
Automatic Identification System, AIS, at Las Cabezuelas
light-buoy 36° 35´·21N., 6° 19´·95W.

212* FRANCE - North Coast - Less water.

Source: SHOM

Chart 3656 [ previous update 4241/19 ] WGS84 DATUM

Insert legend, Less water reported (2019), centred on: 48° 58´·43N., 2° 04´·34W.

174 TURKEY - South Coast - NM Block. Pilot boarding places.

Source: Turkish Notices 49/229/19 and 49/232/19

Chart 2104 (INT 3661) [ previous update 2679/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 36° 43´·8N., 36° 11´·1E.
Replace
 with  İskenderun 1
36° 37´·20N., 36° 10´·00E.

 with  İskenderun 2
36° 40´·70N., 36° 10´·50E.
Delete
 36° 44´·00N., 36° 09´·50E.

183 TURKEY - Black Sea Coast - Light. Automatic Identification System.

Source: Turkish Notice 48/226/19

Chart 1272 (Panel E, Approaches to Sinop) [ previous update 4933/19 ] WGS84 DATUM
Amend light to, Fl.G.5s20m5M (a) 42° 03´·14N., 35° 02´·88E.
Delete Automatic Identification System, AIS, at light (a) above

Chart 2237 [ previous update 2537/19 ] WGS84 DATUM

Amend light to, Fl.G.5s5M (a) 42° 03´·2N., 35° 02´·9E.
Delete Automatic Identification System, AIS, at light (a) above

2.20
Wk02/20
 II

199 SPAIN - Islas Baleares - Depths.

Source: Spanish Notice 49/396/19

Chart 2762 [ previous update 3560/19 ] WGS84 DATUM

Insert depth, 94 (a) 39° 53´·650N., 4° 15´·620E.
Delete depth, 57, close SW of: (a) above
Insert depth, 89 (b) 39° 53´·618N., 4° 15´·712E.
Delete depth, 64, close W of: (b) above
Insert depth, 95 (c) 39° 53´·585N., 4° 15´·775E.
Delete depth, 62, close N of: (c) above
Insert depth, 9 (d) 39° 53´·624N., 4° 15´·838E.
Delete depth, 53, close S of: (d) above
Insert depth, 9 (e) 39° 53´·551N., 4° 15´·863E.
Delete depth, 72, close S of: (e) above

211 SPAIN - Mediterranean Sea Coast - NM Blocks. Anchorage areas.

Source: Spanish Notice 48/382/19

Chart 1514 (INT 3176) [ previous update 3542/19 ] WGS84 DATUM

Insert the accompanying block A, centred on: 39° 55´·8N., 0° 03´·6E.
the accompanying block B, centred on: 39° 55´·8N., 0° 04´·8E.
limit of anchorage area, pecked line, joining: 39° 57´·530N., 0° 05´·950E.
39° 57´·530N., 0° 03´·070E.
39° 59´·350N., 0° 04´·120E.
and
39° 59´·350N., 0° 05´·515E.
39° 57´·530N., 0° 04´·454E.
Delete former limit of anchorage area, pecked line, joining: 39° 59´·090N., 0° 03´·970E.
39° 59´·090N., 0° 05´·730E.
39° 57´·530N., 0° 05´·730E.
39° 57´·580N., 0° 03´·110E.
39° 58´·113N., 0° 03´·414E.
and
39° 57´·560N., 0° 04´·450E.
39° 59´·090N., 0° 04´·451E.

2.21
Wk02/20
 II

255 NAMIBIA - Pilot boarding places. Radar beacons.

Source: South African Chart 1004

Chart 3859 (INT 2610) [ previous update 998/17 ] CAPE DATUM

Insert
 22° 50´·1S., 14° 28´·8E.
(a) 22° 50´·8S., 14° 28´·7E.
Delete former Â, close SE of:
(a) above
Insert radar beacon, Racon(N), at light-buoy 22° 51´·6S., 14° 27´·0E.
Replace radar beacon, Racon(D) with radar beacon, Racon(P) 22° 53´·5S., 14° 26´·2E.

Chart 4175 (INT 2051) [ previous update New Chart 23/02/2017 ] WGS84 DATUM
Replace radar beacon, Racon(D) with radar beacon, Racon(P) 22° 52´·9S., 14° 26´·2E.

Chart 4176 (INT 2052) [ previous update New Chart 23/02/2017 ] WGS84 DATUM
Replace radar beacon, Racon(D) with radar beacon, Racon(P) 22° 52´·9S., 14° 26´·1E.

248 SOUTH AFRICA - West Coast - Buoyage.

Source: South African Notice 11/70/19

Chart 1236 (INT 2673) [ previous update 6558/19 ] WGS84 DATUM

Replace
Ef with Ed 33° 05´·45S., 18° 01´·74E.
33° 05´·56S., 18° 01´·79E.

281 SOUTH AFRICA - East Coast - Submarine cable.

Source: South African Notice 11/71/19

Chart 3300 [ previous update 2432/18 ] UNDETERMINED DATUM

Insert submarine cable, É, joining: 28° 57´·8S., 31° 46´·2E.
29° 10´·4S., 31° 54´·7E.
29° 13´·5S., 32° 03´·8E.
29° 09´·7S., 32° 19´·8E.

Chart 4171 (INT 7560) [ previous update 4476/18 ] WGS84 DATUM

Insert submarine cable, É, joining: 29° 05´·0S., 31° 51´·2E.
29° 10´·4S., 31° 54´·7E.
29° 13´·5S., 32° 03´·8E.
29° 13´·5S., 32° 05´·1E.
29° 11´·6S., 32° 13´·5E.
29° 09´·7S., 32° 19´·8E.

2.22
Wk02/20
 II
281 SOUTH AFRICA - East Coast - Submarine cable. (continued)

Chart 4172 (INT 7570) [ previous update 2398/18 ] WGS84 DATUM

Insert submarine cable, É, joining: 28° 57´·7S., 31° 46´·1E.
29° 05´·0S., 31° 51´·2E.
29° 10´·4S., 31° 54´·7E.
29° 13´·5S., 32° 03´·8E.
29° 13´·5S., 32° 05´·1E.
29° 11´·6S., 32° 13´·5E.
29° 09´·7S., 32° 19´·8E.

Chart 4179 (INT 7051) [ previous update New Chart 24/05/2018 ] WGS84 DATUM
Insert submarine cable, É, joining: 28° 57´·9S., 31° 46´·3E.
29° 10´·4S., 31° 54´·7E.
29° 13´·5S., 32° 03´·8E.
29° 09´·7S., 32° 19´·8E.

162* KUWAIT - Legend.

Source: UKHO

Chart 3773 [ previous update 4660/19 ] WGS84 DATUM

Delete legend, Causeway under construction (2019), centred on: 29° 31´·12N., 48° 04´·10E.

167 QATAR - Recommended track.

Source: Qatar Petroleum

Chart 2886 (INT 7243) [ previous update 6532/19 ] WGS84 DATUM

Insert two-way recommended track, pecked line, joining: 25° 06´·0N., 51° 43´·5E.
25° 09´·5N., 51° 44´·0E.
25° 10´·0N., 51° 44´·2E.
25° 11´·0N., 51° 44´·3E.
25° 12´·7N., 51° 44´·3E.

2.23
Wk02/20
 II

233 INDIA - West Coast - Wreck. Depth.

Source: Indian Notice 23/245/19

Chart IN 22 (INT 752) [ previous update 6711/19 ] INDIAN DATUM

Replace depth, 78, with ´PA 18° 40´·0N., 70° 58´·0E.

Chart IN 255 (INT 7334) [ previous update 6170/19 ] WGS84 DATUM

Insert
´PA (a) 18° 40´·0N., 70° 58´·0E.
Delete depth, 78, close N of: (a) above

Chart IN 292 (INT 7021) [ previous update 6631/19 ] INDIAN DATUM

Insert
´PA (a) 18° 40´·0N., 70° 58´·0E.
Delete depth, 78, close N of: (a) above

Chart IN 293 (INT 7022) [ previous update 6711/19 ] INDIAN DATUM

Insert
´PA (a) 18° 40´·0N., 70° 58´·0E.
Delete depth, 78, close N of: (a) above

Chart 707 [ previous update 6191/19 ] WGS84 DATUM

Replace depth, 78, with ´PA 18° 40´·0N., 70° 58´·0E.

246 INDIA - East Coast - Legends.

Source: Indian Notice 23/247/19

Chart IN 3012 (INT 7411) [ previous update New Chart 15/09/2015 ] WGS84 DATUM
Amend maintainted depth to, 16,1m, centred on: 17° 42´·622N., 83° 16´·945E.
17° 42´·288N., 83° 16´·963E.
17° 41´·564N., 83° 16´·932E.
17° 41´·270N., 83° 17´·194E.
maintainted depth to, 21,0m, centred on: 17° 41´·287N., 83° 18´·120E.

143 CHINA - South Coast - NM Block. Anchorage areas.

Source: UKHO and ENC C1415440

Chart 341 [ previous update New Edition 12/12/2019 ] WGS84 DATUM

Insert the accompanying block, centred on: 22° 09´·0N., 113° 36´·4E.

2.24
Wk02/20
 II
143 CHINA - South Coast - NM Block. Anchorage areas. (continued)

Chart 3026 [ previous update 5784/19 ] WGS84 DATUM

Insert limit of anchorage area, pecked line, joining: (a) 22° 09´·15N., 113° 36´·18E.
(b) 22° 09´·15N., 113° 37´·68E.
(c) 22° 08´·23N., 113° 37´·68E.
(d) 22° 08´·23N., 113° 36´·18E.
legend, No 20HW, within: (a)-(d) above
Delete former limit of anchorage area, pecked line, and associated
legend, No 20HW, joining: 22° 09´·62N., 113° 36´·19E.
22° 09´·62N., 113° 37´·19E.
22° 08´·21N., 113° 37´·19E.
22° 08´·21N., 113° 36´·19E.

146 VIETNAM - Wreck.

Source: Hydropac 3999/19

Chart 3879 [ previous update 6542/19 ] WGS84 DATUM

Insert
´PA 10° 06´·4N., 104° 13´·8E.

Chart 3985 [ previous update 6542/19 ] WGS84 DATUM

Insert
´ 10° 06´·4N., 104° 13´·8E.

155 CHINA - East Coast - Buoyage. Virtual aid to navigation.

Source: Chinese Notice 47/1518/19

Chart 1199 [ previous update 6693/19 ] CGCS 2000 DATUM

Delete symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s (2 buoys) (a) 30° 21´·9N., 122° 34´·5E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, close NW of: (a) above

Chart 1305 [ previous update 6693/19 ] CGCS 2000 DATUM

Delete symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 3 30° 22´·25N., 122° 34´·25E.
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 4 30° 21´·86N., 122° 34´·45E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 30° 22´·10N., 122° 34´·34E.

2.25
Wk02/20
 II

158 VIETNAM - Buoyage. Lights.

Source: VMS-South Notice 266/19

Chart 3874 (Panel, Quy Nhon) [ previous update 113/20 ] WGS84 DATUM
Amend No 6 light-buoy to, Fl(2+1)R.10s 13° 45´·42N., 109° 14´·74E.
No 8 light-buoy to, Fl(2+1)R.10s 13° 45´·77N., 109° 14´·84E.
No 9 light-buoy to, Fl(2+1)G.10s 13° 45´·96N., 109° 15´·31E.
No 11 light-buoy to, Fl(2+1)G.10s 13° 46´·24N., 109° 15´·38E.
range of light to, 10M 13° 46´·29N., 109° 14´·65E.
13° 46´·07N., 109° 14´·69E.

159 CHINA - South Coast - Radio reporting lines. Legends.

Source: Chinese Notice 47/1530/19

Chart 1568 [ previous update New Edition 05/12/2019 ] CGCS 2000 DATUM
Insert radio reporting line, inbound and outbound, pecked line,
joining: 21° 54´·32N., 113° 16´·73E.
(a) 21° 59´·00N., 113° 27´·00E.
(b) 21° 44´·99N., 113° 27´·00E.
(c) 21° 44´·99N., 113° 23´·74E.
legend, Zhuhai VTS, along: (a)-(b) above
Delete former semi-circular limit of radio reporting line, pecked line,
and associated legend, Zhuhai VTS, joining: 22° 01´·50N., 113° 25´·39E.
21° 54´·04N., 113° 28´·36E.
(c) above

160 CHINA - Bo Hai - Virtual aids to navigation.

Source: Chinese Notice 47/1517/19

Chart 1286 [ previous update 6145/19 ] CGCS 2000 DATUM

Insert symbol, virtual aid to navigation, port lateral topmark, V-AIS 40° 33´·15N., 122° 04´·20E.
symbol, virtual aid to navigation, starboard lateral topmark, V-
AIS 40° 33´·09N., 122° 04´·26E.

Chart 1287 [ previous update 6579/19 ] CGCS 2000 DATUM

Insert symbol, virtual aid to navigation, port lateral topmark, V-AIS 40° 33´·15N., 122° 04´·20E.
symbol, virtual aid to navigation, starboard lateral topmark, V-
AIS 40° 33´·09N., 122° 04´·26E.

166 CHINA - South Coast - Beacon.

Source: Chinese Notice 47/1529/19

Chart 343 [ previous update 126/20 ] CGCS 2000 DATUM

Delete
ThFl(2)G.6s5m9M
¨ No 20
22° 40´·51N., 113° 45´·38E.

2.26
Wk02/20
 II

168 VIETNAM - Wreck.

Source: VMS-S Notice 271/19

Chart 3482 (INT 550) [ previous update 6533/19 ] WGS84 DATUM

Insert
´ 10° 45´·4N., 109° 21´·7E.

Chart 3488 (INT 552) [ previous update 6218/19 ] WGS84 DATUM

Insert
´ 10° 45´·4N., 109° 21´·7E.

Chart 3987 [ previous update 6492/19 ] WGS84 DATUM

Insert
´ 10° 45´·4N., 109° 21´·7E.

Chart 4508 (INT 508) [ previous update 5890/19 ] WGS84 DATUM

Insert
´ 10° 45´·4N., 109° 21´·7E.

184 CHINA - South Coast - Buoy. Lights.

Source: Chinese Notice 47/1527/19

Chart 344 [ previous update 6058/19 ] CGCS 2000 DATUM

Insert
DfMo(K)Y.12s
; Y4
22° 47´·03N., 113° 36´·26E.

¶ Fl.4s 22° 46´·80N., 113° 36´·06E.

22° 46´·49N., 113° 36´·36E.

2.27
Wk02/20
 II

185 CHINA - East Coast - Buoyage. Virtual aids to navigation.

Source: Chinese Notice 47/1523-1525/19

Chart 1126 [ previous update 6526/19 ] CGCS 2000 DATUM

Delete symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 1 (a) 29° 47´·96N., 122° 32´·32E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close S of: (a) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 2, close S of: (a) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 13 (b) 29° 44´·74N., 122° 29´·15E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close S of: (b) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 14, close S of: (b) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 9 (c) 29° 44´·13N., 122° 27´·18E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close W of: (c) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 10 , close W of: (c) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 5 (d) 29° 38´·16N., 122° 26´·45E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close S of: (d) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 6, close S of: (d) above

Chart 1759 [ previous update 6621/19 ] CGCS 2000 DATUM

Delete symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s (2 buoys) (a) 29° 48´·0N., 122° 32´·3E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close S of: (a) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s (2 buoys) (b) 29° 44´·7N., 122° 29´·1E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close S of: (b) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s (2 buoys) (c) 29° 44´·1N., 122° 26´·1E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, close E of: (c) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s (2 buoys) (d) 29° 38´·2N., 122° 26´·4E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close S of: (d) above

2.28
Wk02/20
 II

214 CHINA - South Coast - Buoyage.

Source: Chinese Notice 48/1570/19

Chart 348 [ previous update 130/20 ] CGCS 2000 DATUM

Insert
IbFl.G.4s
] No 1-1
22° 31´·232N., 113° 50´·835E.
Move
GqQ(6)+LFl.15s
V No 1, from:
22° 31´·146N., 113° 50´·994E.
to: 22° 31´·108N., 113° 51´·079E.

216 VIETNAM - Wreck.

Source: VMS-N Notice 282/19

Chart 3874 [ previous update 158/20 ] WGS84 DATUM

Insert
´ 13° 45´·37N., 109° 21´·68E.

Chart 3987 [ previous update 168/20 ] WGS84 DATUM

Insert
´ 13° 45´·4N., 109° 21´·7E.

Chart 3988 [ previous update 6499/19 ] WGS84 DATUM

Insert
´ 13° 45´·4N., 109° 21´·7E.

221 VIETNAM - NM Block.

Source: VMS-North Notice 288/19

Chart 3879 [ previous update 146/20 ] WGS84 DATUM

Insert the accompanying block, centred on: 10° 19´·5N., 104° 24´·8E.

224 CHINA - East Coast - Virtual aids to navigation. Buoyage.

Source: Chinese Notice 47/1519/19

Chart 1199 [ previous update 155/20 ] CGCS 2000 DATUM

Delete symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 30° 17´·1N., 121° 49´·4E.

2.29
Wk02/20
 II
224 CHINA - East Coast - Virtual aids to navigation. Buoyage. (continued)

Chart 1303 [ previous update 6693/19 ] CGCS 2000 DATUM

Insert
G;Mo(C)Y.12s
f 30° 17´·63N., 121° 49´·65E.
30° 20´·76N., 121° 49´·68E.
30° 22´·75N., 121° 50´·84E.
Delete symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS (a) 30° 17´·08N., 121° 49´·42E.
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s close N of: (a) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s close S of: (a) above

Chart 1304 [ previous update 6503/19 ] CGCS 2000 DATUM

Insert
G;Mo(C)Y.12s
f 30° 17´·63N., 121° 49´·65E.
30° 20´·76N., 121° 49´·68E.
Delete symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS (a) 30° 17´·08N., 121° 49´·42E.
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s close N of: (a) above
symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s close S of: (a) above

228 CHINA - East Coast - Buoy. Virtual aid to navigation.

Source: Chinese Notice 48/1556/19

Chart 2401 [ previous update 104/20 ] CGCS 2000 DATUM

Delete symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 25° 47´·35N., 119° 43´·59E.

Chart 2413 [ previous update 672/19 ] CGCS 2000 DATUM

Delete symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 1 (a) 25° 47´·25N., 119° 43´·59E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, close N of: (a) above

Chart 2419 [ previous update 6446/19 ] CGCS 2000 DATUM

Delete symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.BuY.3s No 1 (a) 25° 47´·25N., 119° 43´·59E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position, close N of: (a) above

169 JAPAN - Seto Naikai - NM Blocks.

Source: Japanese Notice 49/996/19

Chart JP 135 [ previous update 5994/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 33° 55´ 06"N., 130° 54´ 24"E.

Chart JP 1263 [ previous update 5994/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 33° 55´ 21"N., 130° 54´ 22"E.

2.30
Wk02/20
 II

170 JAPAN - Shikoku - Buoyage.

Source: Japanese Notice 49/998/19

Chart JP 108 [ previous update 4601/19 ] WGS84 DATUM

Replace
J¿Mo
f (U) 8s No 14 with ê¿Mo
f (U) 8s No 14 33° 07´·21N., 133° 52´·84E.

Chart 1648 [ previous update 6458/19 ] WGS84 DATUM

Insert
PfMo(U)8s No 14 (a) 33° 07´·2N., 133° 52´·8E.
Delete
JfMo(U)8s No 14, close SE of: (a) above

171 JAPAN - Shikoku - Light.

Source: Japanese Notice 49/999/19

Chart JP 108 (Panel, Kami-Kawaguchi Ko) [ previous update 170/20 ] WGS84 DATUM
Insert
è G Lt 33° 02´ 14·7"N., 133° 03´ 28·4"E.

172 JAPAN - Seto Naikai - Lights. Pontoon. Fish havens.

Source: Japanese Notice 49/1000/19

Chart JP 112 [ previous update 3662/19 ] WGS84 DATUM

Insert
è G Lt 34° 15´ 17·3"N., 134° 40´ 25·7"E.

è Lt 34° 15´ 17·1"N., 134° 43´ 07·2"E.

pontoon, double firm line, width 15m joining: 34° 15´ 06·8"N., 134° 42´ 33·9"E.
34° 15´ 06·0"N., 134° 42´ 34·4"E.

Á 34° 14´ 24·6"N., 134° 41´ 32·3"E.

circular limit of fish haven, dotted line, radius 70m centred on: (a) 34° 13´ 06·2"N., 134° 40´ 53·4"E.

À, within: (a) above

Chart JP 150C [ previous update 6462/19 ] WGS84 DATUM

Insert
Á 34° 14´·41N., 134° 41´·54E.
34° 13´·10N., 134° 40´·88E.

173 JAPAN - Seto Naikai - Depth.

Source: Japanese Notice 49/1001/19

Chart JP 112 [ previous update 172/20 ] WGS84 DATUM

Insert depth, 10, enclosed by 10m approximate contour, Rep(2019) 34° 10´ 47·6"N., 134° 38´ 59·4"E.

2.31
Wk02/20
 II

175 JAPAN - Seto Naikai - Fixed point.

Source: Japanese Notice 49/1002/19

Chart JP 1110 [ previous update 5618/19 ] WGS84 DATUM

Insert
è BM 34° 30´ 32·4"N., 135° 23´ 51·8"E.

176 JAPAN - Seto Naikai - Bridge.

Source: Japanese Notice 49/1003/19

Chart JP 101A [ previous update 4393/19 ] WGS84 DATUM

Insert bridge, double firm line, joining: 34° 42´ 34·8"N., 135° 16´ 46·4"E.
34° 42´ 35·9"N., 135° 16´ 45·5"E.

177 JAPAN - Seto Naikai - Depth. Obstruction. Fixed point. Berths. Legends.
Source: Japanese Notice 49/1004/19

Chart JP 101A [ previous update 176/20 ] WGS84 DATUM

Insert legend, Ruins, orientated N/S centred on: 34° 41´ 14·8"N., 135° 13´ 27·1"E.
34° 41´ 08·6"N., 135° 13´ 29·5"E.
Replace depth, 41, with + PA 34° 41´ 43·0"N., 135° 13´ 08·0"E.
Delete berth number, 1 (a) 34° 41´ 12·8"N., 135° 13´ 27·4"E.
berth number, 2 (b) 34° 41´ 13·2"N., 135° 13´ 30·1"E.
legend, Dolphin Berth, close W of: (a) above
legend, No 4 Breakwater, close E of: (b) above

è G Lt 34° 41´ 17·4"N., 135° 13´ 27·7"E.

Chart JP 101B [ previous update 4394/19 ] WGS84 DATUM

Insert legend, Ruins, orientated N/S centred on: 34° 41´ 14·7"N., 135° 13´ 27·2"E.
34° 41´ 08·9"N., 135° 13´ 29·3"E.
Replace depth, 41, with + PA 34° 41´ 43·0"N., 135° 13´ 08·0"E.
Delete berth number, 1 (a) 34° 41´ 12·8"N., 135° 13´ 27·4"E.
berth number, 2 (b) 34° 41´ 13·2"N., 135° 13´ 30·1"E.
legend, Dolphin Berth, close W of: (a) above
legend, No 4 Breakwater, close E of: (b) above

è G Lt 34° 41´ 17·4"N., 135° 13´ 27·7"E.

2.32
Wk02/20
 II

194 KOREA - South Coast - Maritime limit. Anchor berths. Anchorage area. Depths.
Radio reporting line.
Source: ENC KR4F4H20

Chart 127 [ previous update 6714/19 ] WGS84 DATUM

Delete radio reporting line, inbound and outbound, pecked line, and
associated legend, SR, joining: 34° 35´·0N., 127° 53´·9E.
34° 35´·0N., 127° 59´·9E.

Chart 3391 (INT 5360) [ previous update 6714/19 ] WGS84 DATUM

Insert maritime limit, pecked line, joining: 34° 39´·53N., 127° 57´·09E.
34° 39´·53N., 127° 59´·68E.

ïD-1 V.L.C.C, centred on: 34° 38´·06N., 127° 58´·52E.

depth, 202 (a) 34° 38´·36N., 127° 55´·87E.
Delete depth, 23, close E of: (a) above
Replace
ïD-1 V.L.C.C, with, ½No 2, centred on: 34° 39´·22N., 127° 57´·94E.
Delete radio reporting line, inbound and outbound, pecked line, and
associated legend, SR, joining: 34° 35´·01N., 127° 54´·00E.
34° 35´·01N., 127° 59´·98E.

205 KOREA - West Coast - Buoyage. Light-beacons. Wreck.

Source: Korean Notices 49/1151-1152/19 and 49/1158-1159/19

Chart 913 (INT 5254) [ previous update 6442/19 ] WGS84 DATUM

Insert
G;Fl(4)Y.8s
f (2 buoys)
36° 44´·25N., 125° 47´·15E.
Replace
Th¦ Fl.G.4s10m5M with Tx= Q(6)+LFl.15s10m7M 36° 17´·33N., 126° 17´·95E.
Delete
Ef 34° 44´·80N., 125° 14´·73E.

Chart 1258 [ previous update 6393/19 ] WGS84 DATUM

Insert
G;Fl(4)Y.8s
f (2 buoys)
36° 44´·25N., 125° 47´·15E.

Chart 3365 (INT 5252) [ previous update 6679/19 ] WGS84 DATUM

Insert
´PA 34° 00´·59N., 126° 18´·44E.
Delete
Ef 34° 44´·80N., 125° 14´·73E.

2.33
Wk02/20
 II

227 KOREA - East Coast - Rocks.

Source: Korean Notice 49/1143/19

Chart 127 [ previous update 194/20 ] WGS84 DATUM

Replace depth, 156, with seabed type, R, with depth, 147, wth seabed
type, R 35° 17´·8N., 129° 19´·8E.

Chart 896 (INT 5355) [ previous update 6158/19 ] WGS84 DATUM

Insert depth, 147, wth seabed type, R (a) 35° 17´·78N., 129° 19´·81E.
Delete depth, 156, with seabed type, R, close S of: (a) above

Chart 3666 (INT 5251) [ previous update 6158/19 ] WGS84 DATUM

Insert depth, 147, wth seabed type, R (a) 35° 17´·78N., 129° 19´·81E.
Delete depth, 156, with seabed type, R, close N of: (a) above

252 KOREA - South Coast - Tidal streams.

Source: ENC KR4G3E10

Chart 127 [ previous update 227/20 ] WGS84 DATUM

Insert symbol. flood tide stream arrow, direction 261°, 3·5kn, centred
on: (a) 34° 40´·0N., 128° 25´·6E.
symbol, ebb tide stream arrow, direction 80° , 2·2kn, close S of: (a) above
Delete symbol, flood tide stream arrow, 1·0kn, close E of: (a) above
symbol, ebb tide stream arrow, 1·0kn, close E of: (a) above
Insert symbol, flood tide stream arrow, direction 311°, 1·8kn, centred
on: (b) 34° 35´·3N., 128° 03´·8E.
symbol, ebb tide stream arrow, direction 140°, 2·2kn, close SW
of: (b) above

Chart 3391 (INT 5360) [ previous update 194/20 ] WGS84 DATUM

Insert symbol, flood tide stream arrow, direction 311°, 1·8kn, centred
on: (a) 34° 34´·78N., 128° 04´·26E.
symbol, ebb tide stream arrow, direction 140°, 2·2kn, close SW
of: (a) above

257 KOREA - West Coast - Depths.

Source: ENC KR4F2O30

Chart 913 (INT 5254) [ previous update 205/20 ] WGS84 DATUM

Replace depth, 43, with depth, 38 36° 28´·37N., 126° 26´·88E.

132 PHILIPPINE ISLANDS - Luzon - Lights.

Source: Philippines Notice 11/74/19

Chart 4412 [ previous update 5153/19 ] WGS84 DATUM

Amend light to, Fl(3)5s10M 15° 03´·5N., 121° 56´·6E.
light to, Fl.10s 15° 02´·7N., 121° 58´·4E.

2.34
Wk02/20
 II

139 PHILIPPINE ISLANDS - Luzon - Light.

Source: Philippines Notice 11/71/19

Chart 4427 [ previous update 4973/17 ] WGS84 DATUM

Amend light to, Fl.5s18M 20° 24´·13N., 121° 57´·55E.

247 MALAYSIA - Sarawak - Well.

Source: Marine Department, Sarawak Notice 142/19

Chart 3482 (INT 550) [ previous update 168/20 ] WGS84 DATUM

Delete
+ Well 4° 38´·1N., 111° 36´·8E.

Chart 3483 (INT 551) [ previous update 6533/19 ] WGS84 DATUM

Delete
+ Well 4° 38´·1N., 111° 36´·8E.

272 INDONESIA - Timor - Lights.

Source: Indonesian Notices 50/664-668/19

Chart 2472 [ previous update 6719/19 ] WGS84 DATUM

Insert
¶ Q.14M 8° 36´·2S., 122° 50´·7E.
Amend light to, Fl.27M 10° 05´·3S., 123° 33´·3E.
light to, Fl(3)27M 10° 07´·5S., 123° 26´·5E.
light to, LFl(2)20M 10° 43´·6S., 123° 02´·7E.

Chart 2874 [ previous update New Edition 19/09/2019 ] WGS84 DATUM

Amend light to, LFl(2)10s47m20M 10° 43´·5S., 123° 02´·7E.
light to, Fl(3)20s127m27M 10° 07´·5S., 123° 26´·7E.
light to, Fl.3s27M 10° 05´·3S., 123° 33´·3E.

Chart 2903 [ previous update 3608/19 ] WGS84 DATUM

Amend range of light to, 14M 8° 36´·2S., 122° 50´·8E.
light to, Fl(3)20s127m27M 10° 07´·5S., 123° 26´·5E.
light to, LFl(2)10s47m20M 10° 43´·6S., 123° 02´·8E.

Chart 2908 [ previous update 4360/19 ] WGS84 DATUM

Amend light to, Fl.3s27M 10° 05´·3S., 123° 33´·3E.
light to, Fl(3)20s127m27M 10° 07´·5S., 123° 26´·5E.
light to, Fl.4s22m11M 8° 07´·1S., 124° 37´·1E.

Chart 2909 [ previous update 305/19 ] WGS84 DATUM

Amend light to, Fl.4s22m11M 8° 07´·1S., 124° 37´·1E.

Chart 2910 [ previous update 4360/19 ] WGS84 DATUM

Amend range of light to, 14M 8° 36´·2S., 122° 50´·7E.

Chart 3296 (Panel B, Approaches to Tenau and Kupang) [ previous update 4360/19 ] WGS84 DATUM
Amend light to, Fl(3)20s127m27M 10° 07´·52S., 123° 26´·75E.

2.35
Wk02/20
 II
272 INDONESIA - Timor - Lights. (continued)

Chart 3296 (Panel A, Selat Rote) [ previous update 4360/19 ] WGS84 DATUM
Amend light to, Fl.3s12m27M 10° 05´·29S., 123° 33´·21E.
light to, Fl(3)20s127m27M 10° 07´·52S., 123° 26´·75E.

Chart 4721 (INT 721) [ previous update 6449/19 ] WGS84 DATUM

Insert
¶ Q.14M 8° 36´·2S., 122° 50´·7E.

¶ Fl.27M 10° 05´·3S., 123° 33´·2E.

Amend light to, Fl(3)27M 10° 07´·8S., 123° 26´·7E.
light to, LFl(2)20M 10° 43´·6S., 123° 02´·8E.

Chart 4722 (INT 722) [ previous update 64/20 ] WGS84 DATUM

Insert
¶ Q.14M 8° 36´·2S., 122° 50´·7E.

¶ Fl.27M 10° 05´·3S., 123° 33´·2E.

Amend light to, Fl(3)27M 10° 07´·8S., 123° 26´·7E.
light to, LFl(2)20M 10° 43´·6S., 123° 02´·8E.

254 AUSTRALIA - Queensland - Buoy.

Source: Australian Notice 25/1304/19

Chart Aus 249 [ previous update 6079/19 ] WGS84 DATUM

Move
EfFl(5)Y.20s, from: 21° 02´·24S., 149° 32´·80E.
to: 21° 02´·04S., 149° 32´·85E.

Chart Aus 251 [ previous update 4533/19 ] WGS84 DATUM

Move
EfFl(5)Y.20s, from: 21° 02´·24S., 149° 32´·80E.
to: 21° 02´·04S., 149° 32´·85E.

258 AUSTRALIA - New South Wales - Depths.

Source: Australian Notice 25/1303/19

Chart Aus 807 [ previous update 5447/18 ] WGS84 DATUM

Replace depth, 77, with depth, 68 34° 59´·46S., 150° 50´·15E.

Chart Aus 808 [ previous update 5393/19 ] WGS84 DATUM

Replace depth, 78, with depth, 68 34° 59´·47S., 150° 50´·18E.

263 AUSTRALIA - Western Australia - Beacon.

Source: Australian Notice 25/1315/19

Chart Aus 753 [ previous update 4420/17 ] WGS84 DATUM

Delete
K 29° 51´·20S., 114° 58´·72E.

2.36
Wk02/20
 II

266 AUSTRALIA - Victoria - Beacon.

Source: Australian Notice 25/1322/19

Chart Aus 151 (Panel, Continuation of Western Port)) [ previous update 5346/19 ] WGS84 DATUM
Delete
K¤v 38° 15´·62S., 145° 21´·31E.

268 AUSTRALIA - Northern Territory - NM Block. Submarine cable.

Source: Australian Notice 25/1310/19
Note: Former notice 4877(T)/19 is cancelled.

Chart Aus 309 [ previous update 6449/19 ] WGS84 DATUM

Insert submarine cable, É, joining: 11° 45´·3S., 130° 38´·5E.
11° 45´·9S., 130° 39´·9E.
11° 47´·1S., 130° 39´·9E.
11° 48´·1S., 130° 39´·1E.
11° 50´·3S., 130° 36´·1E.
11° 52´·5S., 130° 33´·8E.
11° 54´·0S., 130° 33´·3E.
12° 05´·5S., 130° 32´·7E.
12° 10´·3S., 130° 33´·5E.
12° 13´·4S., 130° 33´·7E.
12° 14´·3S., 130° 33´·2E.

Chart Aus 316 [ previous update 4883/19 ] WGS84 DATUM

Insert submarine cable, É, joining: 12° 12´·9S., 130° 33´·7E.
12° 13´·4S., 130° 33´·7E.
12° 14´·3S., 130° 33´·2E.

Chart Aus 722 [ previous update 6070/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 11° 51´·96S., 130° 35´·69E.
submarine cable, É , joining:
11° 59´·26S., 130° 33´·01E.
12° 05´·47S., 130° 32´·72E.
12° 10´·25S., 130° 33´·47E.
12° 13´·43S., 130° 33´·68E.
12° 14´·29S., 130° 33´·17E.

271 PAPUA NEW GUINEA - Miscellaneous corrections.

Source: Australian Notice 25/1307/19

Chart Aus 387 [ previous update 120/20 ] WGS84 DATUM

Amend legend to, PNG 645 5° 24´·0S., 146° 12´·0E.
Replace chart number, Aus 645, with chart number, PNG 645 within Zone of Confidence (ZOC)
Diagram

2.37
Wk02/20
 II

273 AUSTRALIA - Western Australia - Buoyage.

Source: Australian Notice 25/1312/19

Chart Aus 64 [ previous update 100/20 ] WGS84 DATUM

Insert
Ef 21° 40´·71S., 115° 02´·82E.
21° 40´·83S., 115° 02´·70E.
21° 40´·83S., 115° 01´·86E.
21° 40´·82S., 115° 01´·32E.
21° 40´·97S., 115° 01´·08E.
21° 40´·80S., 115° 00´·32E.
21° 41´·09S., 115° 02´·10E.
21° 40´·61S., 114° 59´·70E.
21° 40´·46S., 115° 00´·06E.
21° 40´·85S., 115° 00´·18E.

Chart Aus 69 (Panel, Port of Ashburton) [ previous update 100/20 ] WGS84 DATUM
Insert
Ef 21° 40´·614S., 114° 59´·700E.
21° 40´·464S., 115° 00´·060E.
21° 40´·848S., 115° 00´·180E.
21° 40´·800S., 115° 00´·323E.
21° 40´·968S., 115° 01´·080E.
21° 40´·821S., 115° 01´·320E.
21° 40´·830S., 115° 01´·860E.
21° 41´·094S., 115° 02´·100E.
21° 40´·830S., 115° 02´·700E.

275 AUSTRALIA - Western Australia - Buoy.

Source: Australian Notice 25/1314/19

Chart Aus 115 [ previous update 3739/18 ] WGS84 DATUM

Insert
EcFl(5)Y.20s 33° 15´·60S., 115° 38´·62E.

280 AUSTRALIA - Victoria - Restricted area.

Source: 25/1320/19

Chart Aus 357 [ previous update 53/20 ] WGS84 DATUM

Insert circular limit of restricted area, radius 0·35M, Ç, centred
on: 38° 19´·1S., 147° 37´·0E.

Chart Aus 487 [ previous update 53/20 ] WGS84 DATUM

Insert circular limit of restricted area, radius 0·35M, Ç, centred
on: 38° 19´·1S., 147° 37´·0E.

2.38
Wk02/20
 II

193 MEXICO - Pacific Ocean Coast - Buoyage.

Source: Mexican Notices 22/306-310/19

Chart 1105 (Panel, Guaymas) [ previous update 6092/18 ] WGS84 DATUM

Insert
EfFl.Y.2s No 2 27° 55´·136N., 110° 52´·988W.

EfFl.Y.2s No 1 27° 55´·139N., 110° 52´·888W.

EdFl.R.3s No 4 27° 55´·129N., 110° 52´·773W.

EdFl.R.3s No 2 27° 55´·021N., 110° 52´·621W.

symbol, green spherical buoy, Fl.G.3s No 3 27° 55´·094N., 110° 52´·797W.

200 CHILE - Northern Coasts - NM Block.

Source: Chilean Notice 12/94/19

Chart 4249 [ previous update 3171/18 ] SIRGAS DATUM

Insert the accompanying block, centred on: 36° 43´·3S., 73° 07´·8W.

262 MEXICO - Pacific Ocean Coast - Spoil ground. Legend. Pilot boarding places.
Source: UKHO
Note: Former Notice 4182(P)/18 is cancelled.

Chart 1106 [ previous update New Chart 10/12/2015 ] WGS84 DATUM

Insert limit of spoil ground, pecked line, joining: 23° 10´·802N., 106° 24´·931W.
23° 11´·341N., 106° 24´·768W.
and
23° 11´·357N., 106° 24´·763W.
23° 11´·675N., 106° 24´·667W.
23° 11´·658N., 106° 24´·605W.
legend, Spoil Ground, centred on: 23° 11´·568N., 106° 24´·649W.

 23° 10´·108N., 106° 25´·436W.

Delete
 23° 09´·000N., 106° 26´·000W.

2.39
Wk02/20
 II

259 ANTARCTICA - Automatic Identification Systems. Virtual aids to navigation.

Source: Argentine Lights List 12/19

Chart 446 (INT 9158) [ previous update 6131/18 ] WGS84 DATUM

Insert symbol, Virtual aid to navigation, V-AIS 64° 49´·62S., 62° 57´·31W.
64° 53´·52S., 62° 56´·02W.
64° 54´·02S., 63° 04´·59W.
64° 51´·02S., 63° 07´·16W.

Chart 1774 (Panel, Marian Cove and Potter Cove) [ previous update 2317/18 ] UNDETERMINED DATUM
Insert symbol, Virtual aid to navigation, V-AIS 62° 14´·80S., 58° 43´·99W.
62° 15´·83S., 58° 42´·82W.

Chart 1774 (Panel, Admiralty Bay and King George Bay) [ previous update 2317/18 ] UNDETERMINED DATUM
Insert symbol, Virtual aid to navigation, V-AIS 62° 15´·86S., 58° 37´·30W.

Chart 1776 [ previous update 2401/18 ] UNDETERMINED DATUM

Insert symbol, Virtual aid to navigation, V-AIS 62° 18´·78S., 58° 48´·00W.
62° 14´·88S., 58° 43´·85W.
62° 15´·91S., 58° 42´·68W.
62° 15´·99S., 58° 37´·18W.

Chart 2974 (INT 9163) [ previous update 3367/18 ] WGS84 DATUM

Insert symbol, Automatic Identification System, AIS 68° 08´·63S., 67° 03´·91W.
symbol, Automatic Identification System, AIS, at beacon 68° 13´·01S., 66° 57´·27W.
symbol, Automatic Identification System, AIS, at light 68° 11´·75S., 67° 09´·47W.
symbol, Automatic Identification System, AIS, at beacon 68° 10´·44S., 67° 15´·67W.

Chart 3213 (Panel, Debenham Islands) [ previous update 4591/19 ] UNDETERMINED DATUM
Insert symbol, Automatic Identification System, AIS, at beacon 68° 08´·83S., 67° 04´·41W.

Chart 3213 (Panel, Neny Island) [ previous update 4591/19 ] UNDETERMINED DATUM
Insert symbol, Automatic Identification System, AIS, at beacon 68° 13´·19S., 66° 57´·82W.

Chart 3566 [ previous update 1411/19 ] UNDETERMINED DATUM

Insert symbol, Virtual aid to navigation, V-AIS 64° 49´·62S., 62° 57´·31W.
64° 53´·52S., 62° 56´·02W.
64° 54´·02S., 63° 04´·59W.
64° 51´·02S., 63° 07´·16W.

149 BRAZIL - North Coast - Spoil ground. Legend.

Source: Brazilian Notice 22/N229(P)/19

Chart 526 (Panel F, Porto de Mucuripe) [ previous update 2038/19 ] WGS84 DATUM
Insert limit of spoil ground, pecked line, joining: (a) 3° 43´·20S., 38° 30´·67W.
(b) 3° 43´·20S., 38° 30´·23W.
(c) 3° 42´·97S., 38° 30´·23W.
(d) 3° 42´·97S., 38° 30´·67W.
legend, Spoil Ground, within: (a)-(d) above

2.40
Wk02/20
 II

215 BRAZIL - North Coast - Depths.

Source: Brazilian Notice I 22/226/19

Chart 3959 [ previous update 6306/19 ] WGS84 DATUM

Insert depth, 96, and extend 10m contour SE to enclose (a) 1° 08´·8N., 49° 38´·9W.
Delete depth, 114, close SE of: (a) above
Insert depth, 69 (b) 1° 05´·9N., 49° 39´·1W.
Delete depth, 99, close S of: (b) above
Insert depth, 87, and extend 10m contour NE to enclose (c) 0° 59´·8N., 49° 44´·3W.
Delete depth, 98, close SW of: (c) above

Chart 3962 [ previous update 6201/19 ] WGS84 DATUM

Insert depth, 96, and extend 10m contour SE to enclose (a) 1° 08´·8N., 49° 38´·9W.
Delete depth, 114, close SE of: (a) above
Insert depth, 69 (b) 1° 05´·9N., 49° 39´·1W.
Delete depth, 99, close S of: (b) above
Insert depth, 87, and extend 10m contour NE to enclose (c) 0° 59´·8N., 49° 44´·3W.
Delete depth, 98, close SW of: (c) above

222 BRAZIL - East Coast - NM Block.

Source: Brazilian Notice 22/231/19 and Brazilian LL 20/19

Chart 551 (Panel A, Barra do Riacho) [ previous update 6144/18 ] WGS84 DATUM
Insert the accompanying block, centred on: 19° 50´·7S., 40° 03´·2W.

153 CARIBBEAN SEA - Depth.

Source: NGA and ENC CO300020

Chart 2943 [ previous update 6517/19 ] WGS84 DATUM

Insert depth, 183, enclosed by 200m contour, Rep (1969) ED 15° 28´·4N., 80° 47´·5W.

Chart 4400 (INT 400) [ previous update 119/20 ] WGS84 DATUM

Insert depth, 183, enclosed by 200m contour 15° 28´·4N., 80° 47´·5W.

Chart 4401 (INT 401) [ previous update 6517/19 ] WGS84 DATUM

Insert depth, 183, enclosed by 200m contour 15° 28´·4N., 80° 47´·5W.

Chart 4402 (INT 402) [ previous update 119/20 ] WGS84 DATUM

Insert depth, 183, enclosed by 200m contour 15° 28´·4N., 80° 47´·5W.

2.41
Wk02/20
 II

240 CUBA - South Coast - Lights.

Source: Cuban Notices 1/19-20/20

Chart 444 (Panel, Entrance to Bahia de Cienfuegos) [ previous update 2184/19 ] WGS84 DATUM
Amend range of light to, 23M 22° 05´·132N., 80° 27´·541W.
range of light to, 5M 22° 03´·717N., 80° 27´·699W.

Chart 444 [ previous update 2184/19 ] WGS84 DATUM

Amend range of light to, 23M 22° 05´·10N., 80° 27´·54W.

260 UNITED STATES OF AMERICA - Gulf of Mexico - Light.

Source: US Coast Guard District 8 LNM 49/11309/19

Chart 3184 (Panel A, Port Aransas to Corpus Christi) [ previous update 6692/19 ] NAD83 DATUM
Delete
¶ Fl.R.4s17ft ’26’ 27° 52´·72N., 97° 17´·09W.

261 UNITED STATES OF AMERICA - Gulf of Mexico - Light.

Source: US Coast Guard District 8 LNM 48/11364/19

Chart 3382 (Panel 2) [ previous update 4560/19 ] NAD83 DATUM

Delete
¶ Iso.G.6s PA ’55’ 29° 36´·72N., 89° 53´·70W.

234 CANADA - Wrecks.

Source: Canadian Notice 11/4116/19

Chart 4749 [ previous update 676/19 ] NAD83 DATUM

Insert
® 45° 20´·15N., 66° 12´·42W.
45° 18´·44N., 66° 05´·96W.
45° 18´·32N., 66° 06´·02W.

236 CANADA - Gulf of Saint Lawrence - Buoy.

Source: Canadian Notice 11/4024/19

Chart 4766 [ previous update 5145/19 ] NAD83 DATUM

Insert
JwMo(A) ME 47° 09´·3N., 64° 58´·3W.

237 CANADA - Newfoundland and Labrador - Well.

Source: Canadian Notice 11/4049/19

Chart 2666 [ previous update 6090/19 ] WGS84 DATUM

Insert
åWell 46° 47´·2N., 48° 10´·7W.

2.42
Wk02/20
 II

238 CANADA - Saint Lawrence River - Vertical clearances.

Source: Canadian Notice 11/1310/19

Chart 4792 (Panel, B-C) [ previous update 6080/19 ] NAD83 DATUM

Amend vertical clearance to, 14m 45° 29´ 28·7"N., 73° 32´ 03·3"W.
vertical clearance to, 25m 45° 29´ 39·8"N., 73° 31´ 29·8"W.
vertical clearance to, 64m 45° 29´ 49·5"N., 73° 30´ 59·6"W.

243 CANADA - Nova Scotia - Buoy.

Source: Canadian Notice 11/4011/19

Chart 2492 [ previous update 6351/19 ] NAD83 DATUM

Delete
GdFl.R Bell 44° 32´·1N., 67° 06´·9W.

Chart 4746 [ previous update 6351/19 ] NAD83 DATUM

Delete
GjFl R BELL 44° 32´·1N., 67° 06´·7W.

249 UNITED STATES OF AMERICA - East Coast - Obstruction.

Source: US Coast Guard District 5 LNM 50/12222/19

Chart 2919 [ previous update 6593/19 ] NAD83 DATUM

Insert
18, Obstn 37° 02´·64N., 76° 09´·78W.

250 CANADA - Nova Scotia - Obstructions.

Source: Canadian Notices 11/4012-4013/19 and 11/4320/19

Chart 4747 [ previous update 6108/19 ] NAD83 DATUM

Insert
163- ODAS/SADO 44° 14´·9N., 63° 09´·9W.

Chart 4748 [ previous update 5601/19 ] NAD83 DATUM

Insert
89,ODAS/SADO 44° 14´·9N., 63° 09´·9W.

Chart 4751 [ previous update 6124/19 ] NAD83 DATUM

Replace
91, ODAS/SADO with 89, ODAS/SADO 44° 14´·95N., 63° 09´·89W.

2.43
Wk02/20
 II

267 CANADA - Newfoundland and Labrador - Buoyage.

Source: Canadian Notice 11/4016/19

Chart 2666 [ previous update 237/20 ] WGS84 DATUM

Insert
GfFl(5)Y.20s ODAS 46° 58´·5N., 54° 41´·8W.

Chart 4734 [ previous update 5768/19 ] NAD83 DATUM

Insert
GfFl(5) Y 20s ODAS/SADO 47° 15´·7N., 55° 30´·0W.
46° 58´·5N., 54° 41´·8W.

270 UNITED STATES OF AMERICA - East Coast - Legend. Dredged depth. Depth.
Source: OCS

Chart 2605 (Panel 2) [ previous update New Edition 12/09/2019 ] NAD83 DATUM
Insert legend, AUXILLARY CHANNEL Project Depth 20ft (see Note),
centred on: 40° 04´·96N., 74° 51´·24W.
Delete dredged depth, 8 1/2 feet (2001), centred on: 40° 04´·93N., 74° 51´·60W.

Chart 2605 (Panel 3) [ previous update New Edition 12/09/2019 ] NAD83 DATUM
Insert legend, AUXILLARY CHANNEL Project Depth 20ft (see Note),
centred on: 40° 04´·96N., 74° 51´·25W.
Delete dredged depth, 8 1/2 feet (2001), centred on: 40° 04´·94N., 74° 51´·60W.
depth, 16 40° 05´·24N., 74° 50´·48W.

276 CANADA - Nova Scotia - NM Block. Depths.

Source: Canadian Notices 11/4023/19 and 11/4406/19

Chart 4765 [ previous update 5601/19 ] NAD83 DATUM

Insert depth, 05, enclosed by 1fm contour (a) 46° 06´·1N., 63° 43´·9W.
Delete depth, 11, close NE of: (a) above
Insert depth, 12 (b) 46° 03´·6N., 63° 51´·4W.
Delete depth, 23, close S of: (b) above
Replace depth 15, with depth 14 46° 10´·4N., 63° 54´·3W.
depth 11, with depth 04, enclosed by 1fm contour 46° 05´·2N., 63° 46´·6W.

2.44
Wk02/20
 II
276 CANADA - Nova Scotia - NM Block. Depths. (continued)

Chart 4770 [ previous update 4525/19 ] NAD83 DATUM

Insert the accompanying block, centred on: 46° 10´·2N., 63° 50´·9W.
depth, 89 (a) 46° 12´·23N., 63° 59´·94W.
Delete depth, 107 , close N of: (a) above
Insert depth, 55, enclosed by 5.5m contour 46° 11´·73N., 63° 59´·80W.
depth, 3 (b) 46° 11´·23N., 63° 58´·62W.
Delete depth, 4, close SW of: (b) above
Insert depth, 09, enclosed by 1.8m contour 46° 01´·86N., 64° 03´·37W.
depth, 24 46° 03´·64N., 63° 51´·39W.
depth, 38 (c) 45° 57´·69N., 63° 51´·27W.
Delete depth, 58 , close N of: (c) above
Replace depth, 21 , with depth14 , enclosed by 1.8m contour 46° 05´·15N., 63° 46´·58W.
depth, 24 , with depth 16 , enclosed by 1.8m contour 46° 06´·10N., 63° 43´·92W.

277 CANADA - Saint Lawrence River - NM Block.

Source: Canadian Notice 11/1221/19

Chart 4775 [ previous update 3869/19 ] NAD83 DATUM

Insert the accompanying block, centred on: 50° 00´·9N., 66° 48´·6W.

2.45
Wk02/20
 II

161(P)/20 ENGLAND - Bristol Channel - Depth.

Source: ms Northern Wind
1. A shoal depth of 17·7m exists in position 51° 24´·4N., 3° 59´·9W.
2. This and other changes will be included in the next New Edition of Chart 1121 to be published early 2020.
(ETRS89 DATUM)

Chart affected - 1121 (INT 1062)

189(T)/20 ENGLAND - South Coast - Measuring instrument. Buoy.

Source: Plymouth Marine Laboratory
1. A measuring instrument, marked by a yellow spherical light-buoy, Q, has been established in position
50° 15´·10N., 4° 13´·09W.
2. Former Notice 3893(T)/18 is cancelled.
(ETRS89 DATUM)

Charts affected - 1267 - 1613 - 1900

197(T)/20 IRELAND - East Coast - Depths. Maintained channels.

Source: Belfast Harbour Notice 15/19
1. Depths less than charted exist within Victoria Channel, Belfast Docks.
2. A shoal depth of 9m exists in position 54° 41´·605N., 5° 46´·530W.
3. The maintained depth between beacon No 15, 54° 38´·351N., 5° 52´·468W., and the turning basin,
54° 37´·518N., 5° 53´·420W., is reduced to 9·1m.
4. The controlling depth between West Twin beacon, 54° 37´·354N., 5° 53´·744W., and East Twin beacon
54° 37´·352N., 5° 53´·560W., is reduced to 8·8m.
5. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 1752 (INT 1664) - 1753 (INT 1661) - 2198

2.46
Wk02/20
 II

279(P)/20 SCOTLAND - East Coast - Note.

Source: Port of Cromarty Firth Notice SD01/19
1. Updated Section: GENERAL INFORMATION text box, Cromarty Firth Regulations
Replace:

Cromarty Firth Regulations

•Speed. Seagoing vessels must not exceed a speed
of 8kn within the Cromarty Firth Port Authority
limits.
•Bye-laws. Details of which are available from the
Harbour Master, are in force.
•Anchoring. The agreement of the Port Authority
must be obtained prior to anchoring within
harbour limits.
With:

Cromarty Firth Regulations

•Speed. Seagoing vessels must not exceed a speed
of 8kn within the Cromarty Firth Port Authority
limits.
•Bye-laws. Details of which are available from the
Harbour Master, are in force.
•Anchoring. The agreement of the Port Authority
must be obtained prior to anchoring within
harbour limits.
•Minimum safe passing distances. All vessels,
other than those under pilotage and servicing
MODUs, are required to maintain a minimum
distance of 100m from the following:

Vessels alongside a berth

Vessels or MODUs at anchor within the firth
Vessels involved in discharging or loading cargo whilst at anchor

Chart affected - 8276

134(T)/20 NORWEGIAN SEA - Svalbard - Measuring instruments.

Source: Norwegian Notice 17/59281(T)/18, and Norwegian bulletin 17/19
1. Unmarked subsurface ODAS measuring instruments have been established in the following positions:

Position Depth Below Surface Largest Scale Chart

79° 00´·0N., 8° 32´·5E. On the seabed 3136
79° 00´·0N., 8° 19´·7E. 40m 3136
79° 00´·1N., 7° 59´·7E. 40m 3136
79° 10´·0N., 6° 20´·0E. 60m 3136
76° 26´·3N., 13° 56´·7E. 800m 3137
72° 03´·2N., 14° 43´·6E. 100m above the seabed 2683
78° 29´·2N., 2° 28´·5W. 149m 4010
2. Vessels trawling are requested to maintain a safe distance.
3. Former Notice 5334(T)/19 is cancelled.
(WGS84 DATUM)

Charts affected - 2683 - 3136 (INT 9313) - 3137 (INT 9311) - 4010 (INT 10) - 4100 (INT 100)

2.47
Wk02/20
 II

150(P)/20 LITHUANIA - Depths. Maintained channels. Works.

Source: ENC LT660710 and Lithuanian Notice 11/187(T)/19
1. Significant changes to charted detail have taken place within the port of Klaipėda. The most significant of these are listed
below.
2. Depths less than charted exist in the following positions:

Depth Position
6·9m 55° 42´·761N., 21° 07´·102E.
5·8m 55° 42´·564N., 21° 07´·224E.
12·8m 55° 41´·810N., 21° 07´·684E.
9·9m 55° 39´·938N., 21° 08´·825E.
3. The charted maintained area, depth 15m, centred on position 55° 43´·70N., 21° 03´·70E. , has been extended south-
eastwards to a new southern limit, bounded by the following positions:

55° 42´·954N., 21° 06´·418E. (existing limit)

55° 42´·843N., 21° 06´·649E.
55° 42´·896N., 21° 06´·855E. (existing limit)
4. The charted maintained area, depth 14m, centred on position 55° 41´·820N., 21° 07´·670E. is no longer in existence.
5. The charted maintained area, depth 14·5m, has been extended south-westwards to include the following positions:

55° 40´·002N., 21° 08´·187E. (existing limit)

55° 39´·977N., 21° 08´·183E.
55° 39´·977N., 21° 08´·235E.
55° 39´·948N., 21° 08´·236E.
55° 39´·948N., 21° 08´·256E. (FSRU Independence)
and
55° 39´·781N., 21° 08´·286E. (FSRU Independence)
55° 39´·767N., 21° 08´·286E.
55° 39´·767N., 21° 08´·408E.
55° 39´·833N., 21° 08´·568E. (existing limit)
6. *Works are in progress between berths 135-136 and 140, in an area bounded by the following positions:

55° 39´·136N., 21° 09´·661E.

55° 39´·084N., 21° 09´·545E.
55° 38´·992N., 21° 09´·507E.
55° 38´·933N., 21° 09´·580E.
55° 38´·881N., 21° 09´·628E.
55° 38´·826N., 21° 09´·655E.
55° 38´·799N., 21° 09´·818E.
55° 38´·835N., 21° 09´·839E.
55° 38´·897N., 21° 09´·850E.
7. Mariners are advised to navigate with caution in the area and to contact the local port authority for the latest information.
8. These changes will be included in the next New Edition of Chart 2276.
9. Former Notice 914(P)/18 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Chart affected - 2276

2.48
Wk02/20
 II

191(T)/20 NETHERLANDS - Wreck. Buoyage.

Source: Netherlands Notice 49/419(T)/19
1. A wreck, dangerous to navigation, exists in position: 53° 00´·25N., 4° 36´·52E.
2. Light-buoys have been established to mark the wreck:

Characteristic Designation Buoy Type Position

VQ(9)10s Racon(D) NH-WK-W West cardinal pillar buoy 53° 00´·26N., 4° 36´·30E.
VQ(3)5s NH-WK-E East cardinal pillar buoy 53° 00´·25N., 4° 36´·75E.
(WGS84 DATUM)

Charts affected - 126 (INT 1468) - 1546 (INT 1470)

226(T)/20 GERMANY - North Sea Coast - Buoy.

Source: German Notice 49/46(T)/19
1. A yellow pillar light-buoy, Fl(5)Y.20s, has been established in position 53° 51´·83N., 8° 58´·87E.
(WGS84 DATUM)

Chart affected - DE 46 (INT 1453)

274(P)/20 GERMANY - North Sea Coast - Depths. Anchorage area.

Source: German Notice 50/44/19
1. Depths less than charted exist within the Elbe channel and Neuwerk-Reede anchorage in the following positions:

Depth Position
9·7m 53° 59´·48N., 8° 24´·15E.
11·6m 53° 58´·34N., 8° 28´·29E.
10·6m 53° 58´·17N., 8° 28´·88E.
12·1m 53° 58´·09N., 8° 30´·16E.
9·3m 53° 57´·80N., 8° 31´·61E.
2. Mariners are advised to navigate with caution in the area.
3. These and other changes will be included in the next New Edition of Chart DE44 published January 2020.
(WGS84 DATUM)

Chart affected - DE 44 (INT 1452)

242(P)/20 FRANCE - West Coast - Submarine pipeline. Spoil ground. Beacons. Buoyage. Offshore installation.
Automatic Identification Systems. Platform.
Source: French Notice 49/56/19
1. A submarine pipeline has been laid in the approaches to Le Pouliguen, joining the following positions:

47° 16´·41N., 2° 25´·34W.

47° 16´·38N., 2° 25´·23W.
47° 16´·02N., 2° 25´·06W.
47° 15´·89N., 2° 24´·91W.
47° 15´·70N., 2° 24´·96W.
47° 15´·58N., 2° 24´·86W.
47° 14´·94N., 2° 25´·07W.
2. A spoil ground area has been established, radius 50m, centred on 47° 14´·94N., 2° 25´·07W. and is marked by beacons.

2.49
Wk02/20
 II
242(P)/20 FRANCE - West Coast - Submarine pipeline. Spoil ground. Beacons. Buoyage. Offshore installation.
Automatic Identification Systems. Platform. (continued)
3. Changes have taken place within the offshore windfarm in the approaches to Le Croisic.
a. The following platform, light-buoys and associated Automatic Identification Sytems, AIS, have been established:

Feature Type Characteristic Position

Lit platform with AIS Fl(5)Y.20s 47° 14´·08N., 2° 46´·82W.
Special pillar buoy with AIS Fl(5)Y.20s 47° 14´·29N., 2° 47´·02W.
Special spherical buoy Fl(5)Y.20s 47° 14´·29N., 2° 47´·19W.
b. The following light-buoys and associated AIS have been removed:

Special ODAS buoy Fl(5)Y.20s 47° 14´·64N., 2° 46´·57W.

Special ODAS buoy with AIS Fl(5)Y.20s 47° 14´·04N., 2° 46´·84W.
4. Mariners are advised to navigate with caution in the area.
5. These changes will be included in the next New Edition of Chart 2986.
(WGS84 DATUM)

Chart affected - 2986 (INT 1840)

144(P)/20 ITALY - East Coast - Traffic separation schemes. Routeing measures. Anchorage areas. Precautionary
areas.
Source: Italian Notice 24.11/19
1. Italian maritime authorities have approved changes to the Traffic Separation Scheme in the approaches to Ancona
(43° 37´·5N., 13° 29´·8E. ) and Falconara Marittima (43° 38´·0N., 13° 23´·9E. ). Changes to associated anchorage areas
have also been made. The amended routeing measures and anchorage areas will be implemented at 00:01 Local Time on 15
January 2020.
2. Details of the amended Traffic Separation Scheme, precautionary area and anchorage areas are shown in the accompanying
diagram.
3. Mariners are advised to navigate with caution in the area.
4. Charts will be updated when full details are available.
(WGS84 DATUM)

Charts affected - 220 - 1444 - 5523

210(P)/20 TURKEY - South Coast - Harbour limit. Anchorage areas. Pilot boarding places. Light. Automatic
Identification System. Restricted area.
Source: Turkish Notices 45/214/19, 46/220/19, 48/229/19 and 49/232/19
1. *There are numerous changes to existing charted detail in the approaches to the ports of Botaş and İskenderun.
2. The İskenderun and Botaş harbour limit has been amended as follows:

36° 44´·90N., 36° 03´·20E.

36° 55´·30N., 36° 02´·24E.
3. The limits of No 1 Anchorage have been amended as follows:

36° 51´·80N., 35° 59´·20E.

36° 51´·20N., 36° 01´·20E.
36° 47´·00N., 36° 01´·20E.
36° 47´·00N., 35° 58´·80E.
36° 49´·10N., 35° 57´·00E.

2.50
Wk02/20
 II
210(P)/20 TURKEY - South Coast - Harbour limit. Anchorage areas. Pilot boarding places. Light. Automatic
Identification System. Restricted area. (continued)
4. A new anchorage area, No 4 (Non-dangerous cargo and Naval Vessels), has been established, bounded by the following
positions:

36° 47´·60N., 35° 53´·40E.

36° 47´·60N., 35° 54´·50E.
36° 46´·00N., 35° 53´·20E.
36° 46´·00N., 35° 52´·00E.
5. Anchorage area No 6 in position 36° 52´·64N., 36° 00´·79E. has been amended to No 3.
6. *Anchorage area, No 7 (Quarantine and Dangerous cargo), in position 36° 52´·87N., 35° 58´·94E. has been removed.

7. New pilot boarding places have been established in the following positions:

Botaş 2 36° 51´·35N., 35° 57´·30E.

Botaş 3 36° 50´·30N., 35° 56´·40E.
Botaş 4 36° 47´·00N., 35° 56´·00E.
*İskenderun 3 36° 46´·50N., 36° 09´·60E.
8. *Pilot boarding places in the following positions have been renamed:

New name Position

Botaş 1 36° 52´·50N., 35° 58´·80E.
İskenderun 4 36° 48´·00N., 36° 05´·00E.
İskenderun 2 36° 40´·70N., 36° 10´·50E.
İskenderun 1 36° 37´·20N., 36° 10´·00E.
9. The pilot boarding places in the following positions have been removed:

36° 50´·00N., 35° 57´·00E.

36° 46´·00N., 35° 52´·00E.
*36° 44´·00N., 36° 09´·50E.
10. The light, Fl(2)10s30m10M and associated Automatic Identification System, AIS, has been moved from position
36° 46´·69N., 35° 48´·00E. to position 36° 47´·04N., 35° 49´·00E.
11. * The restricted area, entry prohibited, at İsdemir has been amended as follows:

36° 42´·34N., 36° 11´·58E.

36° 42´·62N., 36° 10´·55E.
36° 42´·67N., 36° 10´·52E.
36° 42´·74N., 36° 10´·51E.
36° 43´·33N., 36° 10´·48E.
36° 43´·47N., 36° 10´·64E.
36° 43´·47N., 36° 10´·89E.
36° 43´·45N., 36° 10´·92E.
36° 43´·73N., 36° 11´·09E.
36° 44´·29N., 36° 10´·66E.
36° 44´·87N., 36° 10´·71E.
36° 45´·12N., 36° 11´·12E.
36° 45´·13N., 36° 11´·35E.
36° 45´·17N., 36° 11´·50E.
12. Chart 2104 will be updated by Notice to Mariners.
13. Chart 2632 has been updated by Notice to Mariners 6430/19
14. These changes will be included in New Editions of Charts 246 and 247 to be published early 2020.
15. Former Notice 6401(P)/19 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 246 (INT 3660) - 247 (INT 3794)

2.51
Wk02/20
 II

245(T)/20 SOUTH AFRICA - West Coast - Shellfish bed. Buoyage.

Source: South African Notice 11/69(T)/19
1. An aquaculture area has been established within an area bounded by the following positions:

33° 01´·80S., 17° 56´·43E.

33° 02´·17S., 17° 56´·43E.
33° 02´·18S., 17° 56´·50E.
33° 02´·57S., 17° 56´·50E.
33° 02´·57S., 17° 56´·22E.
33° 02´·76S., 17° 56´·22E.
33° 02´·76S., 17° 56´·54E.
33° 02´·39S., 17° 56´·95E.
33° 01´·80S., 17° 56´·95E.
2. Special light-buoys, Fl(5)Y.20s, have been established in the following positions:

33° 03´·39S., 18° 00´·71E.

33° 03´·39S., 18° 00´·98E.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 1236 (INT 2673) - 4142 (INT 2672)

163(P)/20 KUWAIT - Works. Buoyage. Causeways.

Source: NAVAREA IX Warning 141/18, Kuwaiti Notice 7/19 and UKHO
1. * Works to build a causeway across Khalīj al Kuwayt, have been completed, joining the following approximate positions:

29° 34´·65N., 48° 02´·25E.

29° 31´·70N., 48° 01´·51E.
29° 30´·19N., 48° 00´·88E.
29° 28´·24N., 47° 59´·69E.
29° 26´·48N., 47° 58´·22E.
29° 23´·00N., 47° 55´·08E.
29° 22´·19N., 47° 54´·57E.
29° 21´·39N., 47° 54´·60E.
2. *Artificial islands have been completed, centred on the following positions:

29° 30´·32N., 48° 01´·02E.

29° 23´·98N., 47° 56´·02E.
3. *A channel, marked by buoys, has been established under Sheikh Jabber bridge between positions:

29° 25´·98N., 47° 57´·77E.

29° 26´·04N., 47° 57´·82E.
4. *Works on the Doha Link Causeway have also been completed, joining the following approximate positions:

29° 21´·55N., 47° 54´·42E.

29° 21´·90N., 47° 53´·52E.
29° 22´·22N., 47° 52´·28E.
29° 22´·42N., 47° 50´·92E.
29° 22´·50N., 47° 49´·92E.
5. A channel under the causeway, marked by navigation lights and daymarks, exists in position 29° 22´·02N., 47° 53´·13E.
6. Mariners are advised to navigate with caution in the area.

2.52
Wk02/20
 II
163(P)/20 KUWAIT - Works. Buoyage. Causeways. (continued)
7. These and other changes will be included in the next New Edition of Chart 1214 to be published early 2020 and the next
New Edition of chart 2884.
8. Former Notice 2816(P)/19 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 1214 - 2884 (INT 7278)

225(P)/20 QATAR - Dredged areas. Buoyage. Channels.

Source: Qatar Petroleum
1. Dredging operations along the approach channels to Mesaieed (Musay’īd or Umm Said) have now been completed.
2. The Main Channel has been widened and dredged to 13·5m between the following approximate positions:

24° 51´·06N., 51° 41´·28E.

24° 53´·51N., 51° 43´·33E.
3. The East Channel has been widened and dredged to 13·5m between the following approximate positions:

25° 10´·75N., 51° 44´·28E.

25° 06´·03N., 51° 43´·71E.
24° 57´·17N., 51° 47´·50E.
24° 56´·35N., 51° 47´·34E.
24° 53´·51N., 51° 43´·33E.
4. The North Inner Channel has been widened and dredged to 13·5m between the following approximate positions:

24° 54´·70N., 51° 36´·68E.

24° 54´·95N., 51° 39´·39E.
24° 54´·28N., 51° 39´·93E.
24° 53´·64N., 51° 40´·18E.
24° 52´·56N., 51° 40´·10E.
24° 51´·06N., 51° 40´·87E.
5. The West Channel has been widened and dredged to 11m between the following approximate positions:

25° 02´·71N., 51° 41´·79E.

25° 00´·76N., 51° 42´·39E.
25° 00´·07N., 51° 42´·42E.
24° 58´·29N., 51° 42´·63E.
24° 56´·72N., 51° 42´·28E.
24° 55´·84N., 51° 42´·35E.
24° 53´·78N., 51° 43´·39E.
24° 53´·51N., 51° 43´·33E.
6. Numerous changes to buoyage have taken place along all channels.
7. Mariners are advised to navigate with caution in the area and to contact local port authorities for the latest information.
8. These and other changes will be included in the next New Editions of Charts 3783, 3789, 3787 and 3950 to be published
early 2020, and the next New Edition of Chart 8118.
9. Chart 2886 will be updated by Notice to Mariners.
10. Former Notice 5176(P)/19 is cancelled.
(WGS84 DATUM)

Charts affected - 3783 - 3787 (INT 7245) - 3789 - 3950 (INT 7244) - 8118

2.53
Wk02/20
 II

244(P)/20 QATAR - Offshore installation.

Source: Qatar Petroleum
1. Offshore jacket installation works are taking place in the following positions:

26° 14´·53N., 52° 19´·74E.

26° 09´·94N., 52° 15´·09E.
26° 06´·30N., 52° 08´·55E.
26° 00´·97N., 52° 11´·12E.
25° 57´·46N., 52° 01´·76E.
25° 54´·26N., 52° 07´·74E.
25° 51´·93N., 51° 55´·56E.
25° 51´·28N., 52° 02´·37E.
2. *A restricted area has been established, bounded by the following positions:

25° 51´·36N., 51° 52´·69E.

25° 46´·92N., 52° 05´·20E.
26° 15´·18N., 52° 22´·79E.
26° 19´·06N., 52° 18´·45E.
3. Mariners are advised to navigate with caution in the area.
4. Former Notice 6390(P)/19 is cancelled.
* Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 2523 (INT 7250) - 2837 (INT 7017) - 2847 (INT 7018) - 2858 (INT 750) - 2886 (INT 7243) - 2887
(INT 7232) - 3772 (INT 7249) - 3950 (INT 7244)

231(T)/20 INDIA - East Coast - Buoyage.

Source: Indian Notice 20/251(T)/19
1. Yellow data light-buoys, Fl(4)15s, with radar reflectors and mast-carrying sensors have been established in the following
positions:

Buoy Position
BD08/OB 17° 49´·48N., 89° 14´·15E.
BD10/OB 16° 21´·70N., 87° 59´·42E.
BD11/OB 13° 31´·50N., 84° 10´·00E.
BD13/OB 13° 59´·40N., 86° 59´·82E.
*BD14/OB 6° 33´·93N., 88° 21´·30E.
CB01/CB 11° 35´·33N., 92° 35´·77E.
CB06/CB 13° 06´·05N., 80° 19´·02E.
2. Yellow tsunami light-buoys, Fl(4)15s, with radar reflectors and mast-carrying sensors have been established in the
following positions:

Buoy Position
TB09/TB 17° 03´·28N., 90° 00´·22E.
TB05/TB 10° 15´·42N., 88° 30´·60E.
STB01/TB 6° 15´·00N., 88° 48´·00E.
WHOI Buoy 17° 48´·23N., 89° 30´·28E.
3. Mariners are advised to maintain a clearance of 1 nautical mile.
4. Former Notice 5907(T)/19 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 317 (INT 7400) - 828 - 830 - 1398 - 2069 - 4706 (INT 706) - 4707 (INT 707) - IN 31 (INT 756) -
IN 33 (INT 755) - IN 3001 (INT 7402) - IN 3004 (INT 7403)

2.54
Wk02/20
 II

253(T)/20 INDIA - West Coast - Data buoys.

Source: Indian Notice 23/250(T)/19
1. Yellow data light-buoys, Fl(4)15s, with radar reflectors and mast carrying sensors have been established in the following
positions:

Buoy Position
STB02/TB 20° 48´·00N., 65° 25´·00E
TB12/TB 19° 53´·72N., 66° 59´·85E.
TB12A/TB 18° 38´·17N., 67° 10´·18E.
AD06/OB 18° 29´·70N., 67° 27´·00E.
*AD07/OB 14° 56´·13N., 68° 59´·07E.
AD08/OB 12° 04´·08N., 68° 37´·97E.
AD09/OB 8° 10´·98N., 73° 17´·90E.
AD10/OB 10° 19´·30N., 72° 35´·23E.
CB02/CB 10° 52´·43N., 72° 12´·53E.
*CB04/CB 15° 24´·30N., 73° 45´·12E.
CALVAL/MB 10° 36´·85N., 72° 17´·45E.
2. Mariners are advised to maintain a clearance of 1 nautical mile.
3. Former Notice 5177(T)/19 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 707 - 709 - 2738 - 4703 (INT 703) - 4705 (INT 705) - 4706 (INT 706) - 4707 (INT 707) - IN 22 (INT
752) - IN 292 (INT 7021)

138(T)/20 VIETNAM - Works. Buoyage. Channel.

Source: VMS-South Notices 257/19, 261/19, 263/19 and 265/19
1. Works to salvage the vessel Vietsun Integrity have commenced. The extent of the works area is marked by the following
buoys:

Characteristic Designation Buoy Type Position

Fl(2+1)Y.12s S1 Special 10° 32´·52N., 106° 50´·84E.
Fl(2+1)Y.12s S2 Special 10° 32´·92N., 106° 51´·00E.
2. A temporary channel through the works area has been established, marked by the following buoys:

Characteristic Designation Buoy Type Position

Fl.R.3s 26B Red lateral 10° 32´·78N., 106° 50´·84E.
Fl.G.3s 31A Green lateral 10° 32´·80N., 106° 50´·94E.
Fl.R.3s 26C Red lateral 10° 32´·80N., 106° 51´·03E.
Fl.G.3s 31B Green lateral 10° 32´·83N., 106° 51´·12E.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 1039

2.55
Wk02/20
 II

152(T)/20 MALAYSIA - Peninsular Malaysia, East Coast - Maritime limit.

Source: Marine Department, Malaysia Notice 187(T)/19
1. A temporary ship lay-up area has been established in an area bounded by the following positions:

1° 40´·00N., 104° 25´·10E.

1° 40´·00N., 104° 27´·10E.
1° 35´·00N., 104° 27´·10E.
1° 35´·00N., 104° 25´·10E.
(WGS84 DATUM)

Chart affected - 2403

209(P)/20 CHINA - Yellow Sea Coast - Pilot boarding places.

Source: Chinese Chart 12581
1.

Update Feature Position

Insert pilot boarding place, No 1 34° 47´·00N., 119° 40´·41E.
pilot boarding place, No 6 34° 44´·93N., 119° 34´·10E.
Replace pilot boarding place, No 5, with pilot 34° 48´·39N., 119° 42´·09E.
boarding place, No 7
pilot boarding place, No 6, with pilot 34° 51´·24N., 119° 49´·76E.
boarding place, No 8

Chart affected - 8167

218(T)/20 VIETNAM - Buoy.

Source: VMS-North Notice 294(T)/19
1. The lateral light-buoy, Fl.R.3s P38, in position 20° 49´·83N., 106° 48´·47E. is temporarily out of service.
(WGS84 DATUM)

Chart affected - 3882

223(P)/20 CHINA - East Coast - Works.

Source: UKHO
1. A bridge is reported to be under construction in the vicinity of position 32° 00´·34N., 120° 42´·80E. with a reported vertical
clearance of 60m.
2. Extensive port developments are reported to exist in the north of Liuhaisha Shuidao 31° 59´·86N., 120° 39´·33E.
3. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
4. Chart 1605 will be updated when full details are available.
(CGCS 2000 DATUM)

Chart affected - 1605

2.56
Wk02/20
 II

178(P)/20 JAPAN - Hokkaidō - Scientific instruments.

Source: Japanese Notice 49/5570(P)/19
1. Submarine seismometers have been established in the following positions:

42° 36´ 58·8"N., 141° 39´ 18·2"E.

42° 36´ 14·3"N., 141° 38´ 05·8"E.
42° 35´ 24·0"N., 141° 37´ 00·7"E.
42° 35´ 24·0"N., 141° 39´ 17·0"E.
(WGS84 DATUM)

Charts affected - JP 1030 - JP 1033A - JP 1034 - JP 1036

179(T)/20 JAPAN - Honshū - Buoyage.

Source: Japanese Notice 49/5573(T)/19
1. Yellow spar buoys, (Y Lt), have been established in the following positions:

35° 40’ 26·3" N. , 139° 56’ 48·1" E.

*35° 40´ 24·5"N., 139° 56´ 49·5"E.
35° 40’ 22·4" N. , 139° 56’ 51·1" E.
35° 40’ 20·2" N. , 139° 56’ 53·6" E.
35° 40’ 18·3" N. , 139° 56’ 56·0" E.
*35° 40´ 17·7"N., 139° 56´ 59·3"E.
2. Former Notice 6612(T)/19 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Chart affected - JP 1088

180(T)/20 JAPAN - Honshū - Restricted area. Works.

Source: Japanese Notice 49/5574(T)/19
1. A restricted area, entry prohibited, has been established within an area bounded by the following positions:

35° 29´ 06"N., 139° 47´ 51"E.

35° 28´ 57"N., 139° 48´ 02"E.
35° 28´ 49"N., 139° 47´ 49"E.
35° 28´ 57"N., 139° 47´ 40"E.
2. Works are taking place within the area above.
(WGS84 DATUM)

Charts affected - JP 67 - JP 1061 - JP 1062

2.57
Wk02/20
 II

181(P)/20 JAPAN - Seto Naikai - Restricted area. Works.

Source: Japanese Notice 49/5577(P)/19
1. A restricted area, entry prohibited, will be established between 10 January 2020 and 31 March 2022, within an area bounded
by the following positions:

34° 39´ 43·4"N., 135° 16´ 30·3"E.

34° 39´ 26·2"N., 135° 15´ 54·0"E.
34° 40´ 15·2"N., 135° 15´ 20·0"E.
2. Reclamation works are taking place within the area.
3. Charts will be updated by Notice to Mariners.
(WGS84 DATUM)

Charts affected - JP 101A - JP 106 - JP 150A - JP 1103

264(P)/20 INDONESIA - Jawa - Precautionary area. Separation zones.

Traffic separation scheme.
Source: IMO and Indonesian Notices 40/533-534/19
1. The International Maritime Organization (IMO) has adopted proposals to establish a New Traffic Separation Scheme and
Precautionary Area in the Sunda Strait, which is to be implemented at 0000 UTC on 1 July 2020.
2. The details of the new scheme are shown in the accompanying diagram. The numbered positions on the diagram relate to
the positions listed below.
3. A new traffic separation scheme is to be established as follows:
a. A separation zone, 0·3M wide, is to be established joining the following positions:

(2) 5° 48´·89S., 105° 51´·31E.

(3) 5° 49´·06S., 105° 51´·58E.
(6) 5° 51´·34S., 105° 50´·16E.
(7) 5° 51´·17S., 105° 49´·89E.
b.A traffic lane for north-east bound traffic is to be established between the separation zone in 3a. above and a line joining
the following positions:

(4) 5° 49´·66S., 105° 52´·54E.

(5) 5° 51´·94S., 105° 51´·13E.
c. A traffic lane for south-west bound traffic is to be established between the separation zone in 3a. above and a line joining
the following positions:

(1) 5° 48´·30S., 105° 50´·35E.

(8) 5° 50´·57S., 105° 48´·92E.
d.A separation line is to be established joining the following positions:

(15) 5° 53´·65S., 105° 48´·56E.

(16) 5° 57´·04S., 105° 46´·46E.
e.A traffic lane for north-east bound traffic is to be established between the separation line in 3d. above and a line joining
the following positions:

(10) 5° 53´·97S., 105° 49´·09E.

(11) 5° 55´·03S., 105° 48´·43E.
(14) 5° 57´·76S., 105° 47´·32E.
f.A traffic lane for south-west bound traffic is to be established between the separation line in 3d. above and a line joining
the following positions:

(9) 5° 53´·34S., 105° 48´·06E.

(12) 5° 54´·41S., 105° 47´·39E.
(13) 5° 56´·38S., 105° 45´·51E.

2.58
Wk02/20
 II
264(P)/20 INDONESIA - Jawa - Precautionary area. Separation zones.
Traffic separation scheme. (continued)
4. A precautionary area, with recommended directions of traffic flow, is to be established, bounded by the following positions:

(8) 5° 50´·57S., 105° 48´·92E.

(5) 5° 51´·94S., 105° 51´·13E.
(10) 5° 53´·97S., 105° 49´·09E.
(9) 5° 53´·34S., 105° 48´·06E.
5. An inshore traffic zone is to be established, joining the following positions:

(17) 5° 47´·57S., 105° 48´·01E.

(1) 5° 48´·30S., 105° 50´·35E.
(8) 5° 50´·57S., 105° 48´·92E.
(9) 5° 53´·34S., 105° 48´·06E.
(12) 5° 54´·41S., 105° 47´·39E.
(13) 5° 56´·38S., 105° 45´·51E.
(18) 5° 54´·46S., 105° 43´·04E.
6. These changes will be included in New Edition of Charts 2056, 2785 and 2862 to be published mid 2020.
(WGS84 DATUM)

Charts affected - 2056 - 2785 - 2862

265(P)/20 INDONESIA - Nusa Tengarra - Precautionary areas. Separation zones. Traffic separation scheme.
Source: IMO & Indonesian Notice 40/535-536/19
1. The International Maritime Organization (IMO) has adopted proposals to establish a New Traffic Separation Scheme and
Precautionary Areas in the Lombok Strait, which is to be implemented at 0000 UTC on 1 July 2020.
2. The details of the new scheme are shown in the accompanying diagram. The numbered positions on the diagram relate to
the positions listed below.

2.59
Wk02/20
 II
265(P)/20 INDONESIA - Nusa Tengarra - Precautionary areas. Separation zones.
Traffic separation scheme. (continued)
3. A new traffic separation scheme is to be established as follows:
a. A separation zone, 0·5M wide, is to be established joining the following positions:

(2) 8° 18´·73S., 115° 52´·32E.

(3) 8° 18´·94S., 115° 52´·83E.
(7) 8° 23´·43S., 115° 51´·27E.
(6) 8° 23´·24S., 115° 50´·76E.
b. A traffic lane for north-east bound traffic is to be established between the separation zone in 3a. above and a line joining
the following positions:

(4) 8° 19´·89S., 115° 55´·09E.

(8) 8° 24´·29S., 115° 53´·56E.
c. A traffic lane for south-west bound traffic is to be established between the separation zone in 3a. above and a line joining
the following positions:

(1) 8° 17´·84S., 115° 50´·04E.

(5) 8° 22´·37S., 115° 48´·46E.
d. A separation zone, 0·5M wide, is to be established joining the following positions:

(11) 8° 28´·01S., 115° 49´·10E.

(10) 8° 28´·21S., 115° 49´·61E.
(15) 8° 35´·40S., 115° 47´·12E.
(14) 8° 35´·21S., 115° 46´·61E.
e. A traffic lane for north-east bound traffic is to be established between the separation zone in 3d. above and a line joining
the following positions:

(9) 8° 29´·10S., 115° 51´·90E.

(16) 8° 36´·25S., 115° 49´·42E.
f. A traffic lane for south-west bound traffic is to be established between the separation zone in 3d. above and a line joining
the following positions:

(12) 8° 27´·12S., 115° 46´·82E.

(13) 8° 34´·36S., 115° 44´·31E.
g. A separation zone, 0·5M wide, is to be established joining the following positions:

(19) 8° 40´·53S., 115° 44´·76E.

(18) 8° 40´·71S., 115° 45´·27E.
(23) 8° 53´·89S., 115° 40´·70E.
(22) 8° 53´·73S., 115° 40´·18E.
h. A traffic lane for north-east bound traffic is to be established between the separation zone in 3g. above and a line joining
the following positions:

(17) 8° 41´·53S., 115° 47´·58E.

(25) 8° 45´·50S., 115° 46´·21E.
(24) 8° 55´·41S., 115° 46´·26E.
i. A traffic lane for south-west bound traffic is to be established between the separation zone in 3g. above and a line joining
the following positions:

(20) 8° 39´·71S., 115° 42´·45E.

(21) 8° 52´·99S., 115° 37´·85E.

2.60
Wk02/20
 II
265(P)/20 INDONESIA - Nusa Tengarra - Precautionary areas. Separation zones.
Traffic separation scheme. (continued)
4. Precautionary areas, with recommended directions of traffic flow, are to be established, bounded by the following positions:

(5) 8° 22´·37S., 115° 48´·46E.

(8) 8° 24´·29S., 115° 53´·56E.
(9) 8° 29´·10S., 115° 51´·90E.
(12) 8° 27´·12S., 115° 46´·82E.
and
(13) 8° 34´·36S., 115° 44´·31E.
(16) 8° 36´·25S., 115° 49´·42E.
(17) 8° 41´·53S., 115° 47´·58E.
(20) 8° 39´·71S., 115° 42´·45E.
5. An inshore traffic zone is to be established, joining the following positions:

(26) 8° 24´·21S., 116° 03´·45E.

(4) 8° 19´·89S., 115° 55´·09E.
(8) 8° 24´·29S., 115° 53´·56E.
(9) 8° 29´·10S., 115° 51´·90E.
(16) 8° 36´·25S., 115° 49´·42E.
(17) 8° 41´·53S., 115° 47´·58E.
(25) 8° 45´·50S., 115° 46´·21E.
(24) 8° 55´·41S., 115° 46´·26E.
(27) 8° 45´·17S., 115° 49´·27E.
6. These changes will be included in New Editions of Charts 2875, 2876, 2915 and 3706 to be published mid 2020.
(WGS84 DATUM)

Charts affected - 2875 - 2876 - 2915 - 3706

182(T)/20 NORTH PACIFIC OCEAN - General information.

Source: Japanese Notice 49/5578(T)/19
1. A rocket launch is due to take place from the Uchinoura Space Center between 9 and 31 January 2020.
2. Rocket debris is predicted to fall within a 32 mile radius centred on position 30° 10´·2N., 132° 14´·2E.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 2347 - 2412 - 4509 (INT 509)

230(P)/20 ECUADOR - Channel. Buoyage. Automatic Identification Systems. Light. Radar beacon. Anchorage
areas. Depths. Rock. Recommended route. Traffic separation scheme.
Precautionary areas.
Source: ENC EC401071, ENC EC510710, ENC EC401070, ENC EC401083, Ecuadorean Daily Notices 14 July 2019, 20 July
2019 and 26 August 2019.
1. *Depths have significantly changed in the approaches to Canal del Morro. A new dredged channel, recommended track,
precautionary areas and a traffic separation scheme have been established between the following approximate positions:

2° 55´·11S., 80° 29´·91W.

2° 51´·45S., 80° 20´·14W.
2° 47´·18S., 80° 15´·36W.
2° 46´·00S., 80° 14´·41W.
2° 45´·64S., 80° 14´·22W.
2° 45´·41S., 80° 14´·18W.
2° 43´·26S., 80° 14´·03W.
2° 41´·71S., 80° 14´·44W.
2. The channel is marked by buoys and associated Automatic Identification Systems, AIS.

2.61
Wk02/20
 II
230(P)/20 ECUADOR - Channel. Buoyage. Automatic Identification Systems. Light. Radar beacon. Anchorage
areas. Depths. Rock. Recommended route. Traffic separation scheme.
Precautionary areas. (continued)
3. The recommended track in Estero Salado has been dredged to at least 10m between the following positions:

2° 40´·04S., 80° 13´·81W.

2° 39´·06S., 80° 13´·74W.
2° 37´·86S., 80° 13´·05W.
2° 37´·18S., 80° 12´·17W.
2° 35´·73S., 80° 08´·72W.
2° 33´·76S., 80° 06´·38W.
2° 28´·70S., 80° 04´·16W.
2° 25´·84S., 80° 02´·07W.
2° 22´·50S., 80° 01´·02W.
4. *The anchorage area in the vicinity of Posorja, has been removed.
5. A new anchorage area has been established, bounded by the following positions:

2° 40´·78S., 80° 13´·71W.

2° 40´·80S., 80° 13´·32W.
2° 41´·94S., 80° 13´·43W.
2° 41´·92S., 80° 13´·78W.
6. *Anchorages, designations A, B, C, C, C and D have been established in the vicinity of Posorja.
7. *A new anchorage area has been established, bounded by the following positions:

2° 55´·44S., 80° 30´·05W.

2° 56´·87S., 80° 30´·05W.
2° 56´·87S., 80° 28´·70W.
2° 55´·44S., 80° 28´·70W.
8. A rock, depth 5m, exists in position 2° 43´·22S., 80° 13´·80W.
9. Depths less than charted exist within the approaches to Puerto Marítimo de Guayaquil. The most significant are as follows:

Depth Position
9·1m 2° 42´·90S., 80° 13´·69W.
6·6m 2° 43´·23S., 80° 13´·12W.
0·3m 2° 42´·08S., 80° 13´·11W.
7·1m 2° 43´·58S., 80° 12´·38W.
8·5m 2° 36´·28S., 80° 10´·28W.
10. A sectored light has been established in position 2° 49´·04S., 80° 14´·73W.
11. A safewater light-buoy, Iso.2s AIS Racon (P), has been established in position 2° 55´·11S., 80° 29´·91W.
12. Mariners are advised to navigate with caution in the area.
13. These changes will be included in New Editions of Charts 509 and 586 to be published early 2020.
14. Former Notice 6577(P)/19 is cancelled.
* Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 509 - 586

131(P)/20 BRAZIL - South Coast - Depth.

Source: Brazilian Notice 22/S230(P)/19
1. A depth of 12·4m, is reported to exist in Anchorage area D in position: 32° 04´·66S., 52° 05´·34W.
(WGS84 DATUM)

Chart affected - 2002

2.62
Wk02/20
 II

204(P)/20 BRAZIL - East Coast - Depths. Buoyage.

Source: Brazilian Notices I 22/226(P)-227(P)/19
1. Depths less than charted exist in Canal Grande do Curuá. The most significant are as follows:

Depth Position
4·2m 1° 08´·64N., 49° 36´·03W.
9·6m 1° 08´·83N., 49° 38´·94W.
6·9m 1° 05´·91N., 49° 39´·13W.
9·4m 1° 06´·46N., 49° 41´·72W.
9·1m 1° 02´·13N., 49° 40´·20W.
8·7m 0° 59´·84N., 49° 44´·28W.
3·5m 0° 55´·81N., 49° 51´·58W.
2·9m 0° 51´·68N., 49° 49´·03W.
0·8m 0° 53´·88N., 49° 54´·30W.
2. The following light-buoys have been established:

Characteristic Designation Buoy Type Position

Fl.R.5s 1 Port-hand lateral 1° 04´·14N., 49° 38´·71W.
Fl.G.5s 2 Starboard-hand lateral 1° 04´·70N., 49° 36´·46W.
Q(2)G.5s 4 Starboard-hand lateral 0° 57´·88N., 49° 39´·78W.
3. The following light-buoys have been moved:

Characteristic Designation Buoy Type Former Position New Position

Q(2)G.6s 6 Starboard-hand 0° 54´·40N., 49° 47´·54W. 0° 55´·56N., 49° 46´·58W.
lateral
Fl(3)G.12s 8 Starboard-hand 0° 52´·84N., 49° 50´·47W. 0° 50´·81N., 49° 51´·24W.
lateral
4. Mariners are advised to navigate with caution in the area.
5. These changes will be included in a New Edition of Chart 2189 to be published early 2020.
6. Charts 3959 and 3962 will be updated by Notice to Mariners.
(WGS84 DATUM)

Chart affected - 2189

2.63
Wk02/20
 II

256(P)/20 BRAZIL - East Coast - Depths.

Source: Brazilian Notice I 2/226(P)/19
1. Shoaling is reported in Canal Grande do Curuá as follows:
a) Least depth 1m within an area bounded by the following positions:

0° 52´·83N., 49° 58´·04W.

1° 02´·85N., 49° 47´·73W.
1° 12´·43N., 49° 40´·38W.
1° 12´·03N., 49° 37´·43W.
1° 08´·72N., 49° 38´·64W.
1° 04´·45N., 49° 43´·33W.
0° 59´·03N., 49° 46´·59W.
0° 54´·35N., 49° 51´·75W.
0° 52´·76N., 49° 56´·32W.
b) Least depth 4·2m within areas bounded by the following positions:

1° 08´·51N., 49° 36´·56W.

1° 11´·25N., 49° 35´·02W.
1° 11´·28N., 49° 33´·99W.
1° 08´·40N., 49° 35´·58W.
1° 07´·68N., 49° 36´·61W.
and
1° 03´·88N., 49° 35´·79W.
1° 02´·50N., 49° 36´·57W.
1° 02´·97N., 49° 36´·88W.
1° 04´·59N., 49° 36´·33W.
1° 04´·81N., 49° 35´·49W.
c) Least depth 6·9m within an area bounded by the following positions:

1° 05´·25N., 49° 40´·02W.

1° 07´·26N., 49° 39´·21W.
1° 07´·75N., 49° 37´·54W.
1° 04´·05N., 49° 38´·80W.
1° 00´·90N., 49° 40´·55W.
1° 01´·68N., 49° 42´·16W.
1° 03´·64N., 49° 41´·34W.
d) Least depth 4·2m within an area bounded by the following positions:

1° 03´·88N., 49° 35´·79W.

1° 02´·50N., 49° 36´·57W.
1° 02´·97N., 49° 36´·88W.
1° 04´·59N., 49° 36´·33W.
1° 04´·81N., 49° 35´·49W.
e) Least depth 8·6m within an area bounded by the following positions:

0° 59´·68N., 49° 44´·55W.

1° 00´·43N., 49° 43´·97W.
1° 00´·05N., 49° 43´·80W.
0° 59´·44N., 49° 44´·38W.
f) Least depth 3·1m within an area bounded by the following positions:

0° 54´·32N., 49° 44´·77W.

0° 50´·56N., 49° 47´·64W.
0° 49´·39N., 49° 50´·52W.
0° 50´·55N., 49° 51´·80W.
0° 53´·10N., 49° 49´·82W.
0° 55´·59N., 49° 46´·73W.

2.64
Wk02/20
 II
256(P)/20 BRAZIL - East Coast - Depths. (continued)
2. Mariners are advised to navigate with caution in the area.
3. Charts will be updated when full details are available.
(WGS84 DATUM)

Charts affected - 2189 - 3959 - 3962

156(P)/20 WEST INDIES - Turks and Caicos Islands - Depths. Drying heights. Coral.
Source: British Government Survey
1. * Lidar surveys show that numerous depths and drying heights less than charted exist at Caicos Bank, Cockburn Harbour
in South Caicos and surrounding the area of the Turks Islands. The most significant are as follows:

Depth Position
1·5m 21° 29´·523N., 71° 32´·197W.
2·1m 21° 29´·428N., 71° 32´·311W.
2·8m 21° 29´·384N., 71° 32´·176W.
0·6m 21° 29´·344N., 71° 31´·874W.
1·3m 21° 29´·169N., 71° 31´·805W.
1·4m 21° 29´·155N., 71° 31´·623W.
Drying height 0·7m 21° 29´·795N., 71° 32´·294W.
Drying height 0·5m 21° 29´·380N., 71° 31´·047W.
Drying height 0·4m 21° 29´·458N., 71° 31´·097W.
Drying height 0·5m 21° 30´·35N., 71° 08´·28W.
Drying height 0·3m 21° 30´·13N., 71° 09´·25W.
9·3m 21° 29´·93N., 71° 09´·51W.
7·8m 21° 30´·56N., 71° 09´·23W.
0·9m 21° 31´·86N., 71° 06´·77W.
14·5m 21° 33´·30N., 71° 04´·93W.
4·7m 21° 31´·11N., 71° 05´·91W.
9·6m 21° 30´·43N., 71° 05´·76W.
0·5m 21° 28´·26N., 71° 06´·33W.
4·6m 21° 26´·90N., 71° 05´·84W.
2m 21° 25´·92N., 71° 05´·66W.
0·5m 21° 25´·43N., 71° 05´·05W.
6·2m 21° 25´·18N., 71° 04´·15W.
7·9m 21° 24´·06N., 71° 02´·48W.

7·7m 21° 11´·36N., 71° 16´·56W.

8·3m 21° 23´·02N., 71° 03´·67W.
7·2m 21° 22´·56N., 71° 00´·27W.
6·6m 21° 19´·31N., 71° 04´·88W.
6·1m 21° 18´·46N., 71° 04´·69W.
3·5m 21° 20´·60N., 71° 04´·62W.
2·5m 21° 18´·57N., 71° 10´·83W.
6·4m 21° 22´·10N., 71° 04´·18W.
7·4m 21° 16´·97N., 71° 10´·13W.
5·1m 21° 17´·46N., 71° 07´·86W.
3·5m 21° 23´·68N., 71° 04´·95W.

2.65
Wk02/20
 II
156(P)/20 WEST INDIES - Turks and Caicos Islands - Depths. Drying heights. Coral. (continued)

4·4m 21° 19´·59N., 71° 06´·21W.

4·9m 21° 18´·29N., 71° 08´·50W.
4·3m 21° 18´·89N., 71° 08´·06W.
3·9m 21° 17´·61N., 71° 11´·19W.
2·7m 21° 19´·57N., 71° 09´·28W.
2·3m 21° 19´·36N., 71° 10´·98W.
3·5m 21° 19´·15N., 71° 11´·50W.
2·2m 21° 19´·95N., 71° 08´·47W.
5·8m 21° 17´·32N., 71° 13´·43W.
8·5m 21° 16´·44N., 71° 13´·18W.
8·3m 21° 16´·22N., 71° 14´·14W.
6·7m 21° 15´·33N., 71° 14´·64W.

2·2m 21° 14´·68N., 71° 14´·83W.

7·8m 21° 13´·42N., 71° 14´·20W.
2·6m 21° 20´·32N., 71° 07´·70W.
2m 21° 21´·32N., 71° 09´·69W.
2·4m 21° 20´·77N., 71° 06´·82W.
1·9m 21° 21´·01N., 71° 05´·92W.
1·5m 21° 21´·05N., 71° 05´·53W.
1·7m 21° 21´·25N., 71° 07´·49W.
8·6m 21° 10´·06N., 71° 16´·14W.
3·5m 21° 22´·48N., 71° 11´·90W.
21·5m 21° 33´·92N., 71° 04´·06W.
12·8m 21° 12´·93N., 71° 11´·91W.
9·8m 21° 09´·42N., 71° 17´·34W.
11·8m 21° 05´·33N., 71° 18´·98W.
9·7m 21° 07´·82N., 71° 18´·17W.
9m 21° 22´·43N., 70° 59´·36W.
18·2m 21° 07´·34N., 71° 17´·01W.
11·5m 21° 20´·70N., 70° 57´·46W.

*3·7m 21° 44´·30N., 71° 28´·09W.

*7m 21° 43´·88N., 71° 24´·01W.
*10·7m 21° 42´·00N., 71° 23´·04W.
*8·5m 21° 40´·41N., 71° 24´·98W.
*7·9m 21° 39´·00N., 71° 26´·22W.
*8·7m 21° 36´·28N., 71° 27´·51W.
*6·8m 21° 19´·56N., 71° 36´·55W.
*5·6m 21° 18´·56N., 71° 36´·27W.
*5·9m 21° 17´·00N., 71° 35´·24W.
*4·8m 21° 16´·38N., 71° 35´·06W.
*4·4m 21° 15´·29N., 71° 35´·13W.
*4·6m 21° 12´·81N., 71° 35´·94W.
*9·6m 21° 12´·58N., 71° 34´·41W.
*5·4m 21° 11´·80N., 71° 35´·28W.
*6·6m 21° 10´·23N., 71° 34´·13W.
*6·4m 21° 08´·94N., 71° 33´·71W.
*7·3m 21° 07´·48N., 71° 32´·77W.
*5·1m 21° 08´·00N., 71° 35´·87W.
*8·4m 21° 06´·57N., 71° 36´·58W.
*4·2m 21° 08´·11N., 71° 39´·07W.
*3·2m 21° 07´·04N., 71° 42´·88W.
*5·2m 21° 05´·95N., 71° 43´·75W.
*7·5m 21° 04´·40N., 71° 43´·39W.
*4m 21° 03´·82N., 71° 44´·20W.

2.66
Wk02/20
 II
156(P)/20 WEST INDIES - Turks and Caicos Islands - Depths. Drying heights. Coral. (continued)
6. Due to numerous uncharted coral heads it is strongly advised that mariners without local knowledge should avoid navigating
within the area bounded by the following positions:

21° 25´·36N., 71° 08´·58W.

21° 25´·32N., 71° 06´·46W.
21° 24´·60N., 71° 05´·54W.
21° 21´·63N., 71° 05´·13W.
21° 20´·60N., 71° 10´·83W.
21° 20´·47N., 71° 12´·68W.
21° 22´·89N., 71° 11´·43W.
7. Mariners are advised to navigate with caution in the area.
8. These changes will be included in the next New Editions of Charts 1441 and 1450.
9. Charts 468, 3001, 3907 and 3908 will be updated by Notice to Mariners.
10. Former Notice 6231(P)/19 is cancelled.
* indicates new or revised entry
(WGS84 DATUM)

Charts affected - 1441 - 1450

202(T)/20 WEST INDIES - Trinidad and Tobago - Buoy.

Source: Trinidad and Tobago Ministry of Works and Transport Navigational Warning 100/19
1. Diamond Rock west cardinal light-buoy, VQ(9)10s, in position 10° 40´·26N., 61° 46´·37W. is reported off station.
2. Mariners are advised to navigate with caution in this area.
(WGS84 DATUM)

Chart affected - 483

203(T)/20 MEXICO - Gulf of Mexico - Buoyage.

Source: Mexican Notices 22/319(T)-322(T)/19
1. The following light-buoys are temporarily out of service:

Characteristic Position
Fl.G.3s ‘1’ 18° 27´·384N., 93° 12´·459W.
Fl.G.2s ‘3’ 18° 27´·040N., 93° 12´·194W.
Fl.R.3s ‘4’ 18° 26´·998N., 93° 12´·290W.
Fl.G.3s ‘5’ 18° 26´·794N., 93° 12´·187W.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 359

207(T)/20 MEXICO - Gulf of Mexico - Buoy.

Source: Mexican Notice 22/316(T)/19
1. The light-buoy, Fl.10s, in position 18° 12´·34N., 94° 25´·60W. is reported to be out of service.
(WGS84 DATUM)

Charts affected - 2751 - 8195

2.67
Wk02/20
 II

208(T)/20 MEXICO - Gulf of Mexico - Buoyage.

Source: Mexican Notices 22/324(T)-325(T)/19
1. The light-buoy, Fl.10s, in position 19° 15´·75N., 96° 08´·10W. is reported to be out of service.
2. The light-buoy, Fl.R.3s No 6, in position 19° 13´·633N., 96° 09´·111W. is reported to be out of position.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 375

2.68
Wk02/20
To accompany Notice to Mariners 133/2020

On Chart IN 203

CHARTS IN2018, IN2051, IN2059, IN2060, IN2080 AND IN2083: POSITIONS

To agree with the larger scale charts IN2018, IN2051, IN2059, IN2060, IN2080
and IN2083 which are referred to WGS84 Datum, positions read from chart
IN203 must be adjusted by 0·03 minutes NORTHWARD and 0·02 minutes
WESTWARD.

Wk02/20
To accompany Notice to Mariners 144(P)/20

Wk02/20
 To accompany Notice to Mariners 264(P)/20

Wk02/20
To accompany Notice to Mariners 265(P)/20

Wk02/20
To accompany Notice to Mariners 142/20. Image Size (mm) 97.2 by 121.7

Wk02/20
To accompany Notice to Mariners 142/20. Image Size (mm) 107.2 by 142.6

Wk02/20
To accompany Notice to Mariners 143/20. Image Size (mm) 113.1 by 102.9

Wk02/20
To accompany Notice to Mariners 169/20. Image Size (mm) 99.7 by 59.8

Wk02/20
To accompany Notice to Mariners 169/20. Image Size (mm) 93.2 by 87.5

Wk02/20
To accompany Notice to Mariners 174/20. Image Size (mm) 216.8 by 105.6

Wk02/20
To accompany Notice to Mariners 198/20. Image Size (mm) 76.4 by 186.1

Wk02/20
To accompany Notice to Mariners 200/20. Image Size (mm) 133.6 by 108.2

Wk02/20
To accompany Notice to Mariners 206/20. Image Size (mm) 56 by 183.2

Wk02/20
To accompany Notice to Mariners 211/20. Image Size (mm) 183.5 by 208.1

Wk02/20
 To accompany Notice to Mariners 211/20. Image Size (mm) 183.5 by 211.8

Wk02/20
To accompany Notice to Mariners 221/20. Image Size (mm) 65 by 106.3

Wk02/20
To accompany Notice to Mariners 222/20. Image Size (mm) 88.5 by 147.6

Wk02/20
To accompany Notice to Mariners 235/20. Image Size (mm) 157.5 by 59.4

Wk02/20
To accompany Notice to Mariners 235/20. Image Size (mm) 92.1 by 49.3

Wk02/20
To accompany Notice to Mariners 241/20. Image Size (mm) 94.7 by 122.6

Wk02/20
To accompany Notice to Mariners 268/20. Image Size (mm) 163.1 by 111.3

Wk02/20
To accompany Notice to Mariners 276/20. Image Size (mm) 62.6 by 137.3

Wk02/20
To accompany Notice to Mariners 277/20. Image Size (mm) 86.5 by 144.7

Wk02/20
 III

NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2016 Edition). It is recommended that the warnings reprinted below should be kept in a file or
book, followed by subsequent weekly reprints. Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: [email protected]
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 2, published on the UKHO website 27 December 19.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 2
The following NAVAREA I warnings were in force at 270500 UTC Dec 19.

2019 series: 127 175 197 203 204 205.

201 Cancelled. Cancel 199/19.

202 Cancelled. Cancel 201/19.

203 1. Navarea I warnings in force at 201000 UTC Dec 19. 2. Cancel 198/19.

204 SOUTH-WESTERN APPROACHES TO THE BRITISH ISLES. Chart GB 2 (INT 160).

1. ODAS light-buoy K1, 48-43.5N 012-29.1W, reported adrift in 49-00.0N 010-00.0W at 240900 UTC Dec 19.
2. Cancel 202/19.

205 1. RIGLIST. Correct at 270500 UTC Dec 19.

Southern North Sea: 51N to 55N

NEW Esbjerg Maersk Resolute
53-00.6N 002-11.2E Seafox 4 ACP Leman Gas Field
53-14.0N 003-14.5E 590021
53-28.4N 004-29.5E Ensco 121 ACP L11-B-PA
53-33.0N 001-04.6E Energy Endeavour ACP Pickerill A
NEW 53-45.2N 003-55.0E Prospector 1 ACP K6-GT
53-49.0N 004-30.8E Prospector 5 ACP L5A-D
NEW 53-52.2N 001-12.5E Ensco 123
53-56.4N 002-44.8E Noble Hans Deul ACP Chiswick
54-03.0N 002-29.5E Ensco 100 ACP Ketch Gas Field
54-16.1N 002-19.4E Ensco 92 ACP 44/22A-M
54-24.4N 002-48.9E Maersk Resolve ACP D12-B

3.1 Wk02/20
 III
North Sea: 55N to 60N, East of 5W
55-29.0N 005-06.7E Noble Sam Turner ACP Dan Oil Field
55-43.4N 004-48.0E Maersk Guardian ACP Tyra Gas Field
56-15.0N 003-20.9E Maersk Invincible ACP Valhall Oil Field
56-16.8N 003-24.0E Maersk Reacher ACP Valhall Oil Field
56-21.8N 004-08.7E Rowan Viking
56-38.9N 002-13.3E Noble Sam Hartley
56-43.5N 002-12.5E Ensco 120 ACP Jasmine Gas Field
NEW Invergordon Wilphoenix
56-49.1N 003-08.1E Maersk Interceptor
56-50.9N 001-35.7E Ocean Endeavor
56-58.0N 001-52.2E Rowan Gorilla 5 ACP Franklin Gas Field
57-05.5N 000-57.6E Ocean Valiant
57-06.6N 002-50.8E Maersk Integrator ACP Ula Oil Field
57-11.7N 001-54.8E Maersk Highlander ACP u/c Pierce Oil Field Westward
57-48.6N 000-58.3W Maersk Innovator ACP Buzzard Oil and Gas Field
57-50.7N 000-54.7W COSL Pioneer
NEW 57-57.0N 001-12.9E Paragon MSS1
57-57.4N 001-50.7E Rowan Gorilla 7 ACP Armada Gas Field
58-19.5N 000-41.9E Transocean 712
58-45.8N 001-12.6E Noble Houston Colbert
58-46.9N 001-54.2E West Phoenix
58-50.7N 001-44.6E Rowan Stavanger ACP Gudrun Oil and Gas Field
59-02.2N 002-13.5E Maersk Intrepid
59-16.1N 002-17.0E Leiv Eiriksson
59-20.2N 002-21.8E Deepsea Bergen
59-23.0N 001-35.1E Ocean Patriot
59-35.4N 001-03.4E Noble Lloyd Noble ACP u/c Mariner Oil Field
59-47.6N 002-10.9E Deepsea Nordkapp

Norwegian Sea: 60N to 65N, East of 5W

NEW Invergordon Transocean Leader
60-24.7N 004-03.3W Deepsea Aberdeen
60-34.5N 003-26.5E West Hercules
60-44.4N 003-34.8E Songa Equinox
60-48.0N 003-27.0E Transocean Endurance
NEW 60-52.6N 003-29.5E COSL Promoter
61-23.8N 002-06.9E Transocean Norge
61-28.6N 002-12.2E Transocean Spitsbergen
64-51.9N 006-50.3E Transocean Enabler

South and West Coasts of the British Isles.

NEW 53-37.9N 003-10.6W Irish Sea Pioneer ACP Lennox Oil/Gas Field
NEW 53-49.0N 003-33.6W Borr Ran ACP South Morecambe Gas Field.

NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform; u/c - under construction
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no

2. Cancel 200/19.

Wk02/20 3.2
 IV

[02/20]
UPDATES TO ADMIRALTY SAILING DIRECTIONS

NP2 Africa Pilot Volume 2 (2017 Edition) 2 Prohibited area. A large marine farm, centred on
225530S 142700E, in which navigation is
prohibited, occupies the SW part of the bay. The
Namibia -- Walvis Bay — extremities of the restricted area are marked by light
Limiting conditions; controlling depths
buoys (special).
226 Prohibited anchorage. Anchoring is prohibited
within a radius of 7 cables of the Fairway Light Buoy.
Paragraph 8.44 1 line 1 Replace by:
Paragraph 8.54 1 lines 1--3 including existing Section IV
1 The channel to the main harbour is maintained to Notice Week 38/19 Replace by:
144 m. The channel to the Oil Tanker Berths (8.64) is
1 The harbour is entered through a dredged, buoyed
maintained to 160 m.
channel, leading S through the bay. The multi--purpose
South African Charts ZA 1004 (2019); ZA 1005 (2019) berthing facilities front the town of Walvis Bay, while
[NP2--No 19--Wk 02/20] the container terminal lies to the W of the harbour on
reclaimed land.
The Oil Tanker Berths lie in the SE part of the bay
Namibia -- Walvis Bay — and are approached through a separate dredged and
Arrival information; VTS; regulations buoyed channel. A small marina lies in the SW corner
of the harbour.
226

After Paragraph 8.50 1 line 4 Insert: South African Charts ZA 1004 (2019); 1005 (2019)
[NP2--No 20--Wk 02/20]
Vessel traffic service
8.50a
1 A VTS scheme is in operation for the control of
shipping in the approaches to Walvis Bay. The Namibia -- Walvis Bay — Directions
scheme is not IMO adopted.
For further details, see ADMIRALTY List of 227
Radio Signals Volume 6(8).
Paragraph 8.60 1--2 Replace by:
Paragraph 8.51 1 lines 1--6 including existing Section IV
1 Caution. Because the extremity of Pelican Point is
Notice Week 11/19 Replace by:
reported to be extending NE, vessels should not pass
1 Designated anchorages are as follows: between Spit Light Buoy (225155S 142687E) and
No 1 (224994S 143076E), deep--water the point.
anchorage and dangerous cargo; Approach from south and west. From a position
No 2 (225191S 143119E), for shallow draught about 1¾ miles NNW of Pelican Point Light (8.34), the
vessels; track leads E in the inbound lane of the TSS to the
No 3 (225310S 142810E); vicinity of the Fairway Light Buoy (225058S
No 4 (225418S 142822E), for small vessels. A 142922E) and the pilot boarding position.
stranded wreck (225399S 142710E) lies in 2 Approach from north and north--west. From a
the NW part of the anchorage. position about 4½ miles NNE of Pelican Point Light
The holding is generally good on a mud bottom. the track leads SSE in the inbound lane of the TSS
Paragraph 8.52 1 lines 1--4 including existing Section IV to the vicinity of the Fairway Light Buoy and the pilot
Notice Week 38/19 Replace by: boarding position.

1 Pilotage is compulsory. The pilot boards about

5½ cables NW or WSW of the Fairway Light Buoy Paragraph 8.61 lines 1--11 including heading Replace by:
(safe water) (225058S 142922E).
See ADMIRALTY List of Radio Signals Volume 6(8). Oil Tanker Berth Channel
8.61
Paragraph 8.53 1 lines 1--4 including heading Replace by: 1 Leading lights:
Front light (round structure with red bands)
Traffic regulations (225462S 143163E).
8.53 Rear light (similar structure) (6 cables from front
1 Traffic separation scheme. A TSS is established light).
in the approaches to Walvis Bay. This scheme is not From the vicinity of the Fairway Light Buoy
IMO--adopted. The principles for the use of the (225058S 142922E), the alignment (151) of these
scheme defined in Rule 10 of the International lights leads SSE for about 4¼ miles through the
Regulations for Preventing Collisions at Sea (1972) dredged channel, marked by light buoys (lateral), to
apply. the turning basin, and thence to the required berth.

4.1 Wk02/20
 IV

Paragraph 8.62 including paragraph number Replace by: Paragraph 6.37 2 line 3 For (142901S 404095E) Read
(142909S 404096E)
Main Harbour Channel
8.62 Paragraph 6.37 2 line 5 For 3 cables Read 1 cable
1 Track. From the vicinity of the Fairway Light Buoy
(225058S 142922E), the track leads SSE for Paragraph 6.37 2 line 7 For 1555 Read 1544
about 1½ miles to the channel bifurcation marked by a
light buoy (preferred channel to starboard).
Leading lights: Mozambique Chart 16205/19 [NP3--No 19--Wk 02/20]
Front light (warehouse) (225709S 142977E).
Rear light (framework tower) (3¾ cables from front Kenya -- Lamu -- Manda Bay — Pilotage
light).
2 The alignment (183) of the above lights, leads 272
S, through the dredged channel, marked by
light buoys (lateral), to the turning basin, and Paragraph 10.90 1 lines 5--6 Replace by:
thence to the required berth.
Useful mark: ...and over. See 10.95.
Radar tower (225675S 143010E).
Kenya Port Authority [NP3--No 20--Wk 02/20]
Paragraph 8.63 including heading Replace by:

Kenya -- Lamu -- Manda Bay — Pilotage

Spare
8.63
274
South African Chart ZA 1004; 1005 (2019) Paragraph 10.95 4 line 7 Replace by:
[NP2--No 21--Wk 02/20]
...advance. Pilots board in approximate position 22253S
Namibia -- Walvis Bay — Berths 410262E.

227 Paragraph 10.95 6 Replace by:

Paragraph 8.66 1 lines 1--4 including existing Section IV 6 Development. The Kenyan government is
Notice Week 38/19 Replace by: developing Manda Bay and has instigated the Lamu
Port Southern Sudan--Ethiopia Transport Corridor
1 The multipurpose terminal (225723S 142944E) project (LAPSSET). The first phase was completed in
provides eight berths with a length totalling 1500 m; 2019 with Berth No 1 situated at Shaka la Paye
maintained depths of 14 m (Nos 1 to 3) and 106 m (10.99). Access to the new port facilities follows a
(Nos 4 to 8). buoyed channel and leading lights through Mlango
Passenger terminal Muhaji (10.96) and Manda Roads, between Manda
8.66a Island and Pate Island, thence into Manda Bay.
1 The passenger terminal comprises a dolphin jetty Further information should be obtained from the Port
(Berth No 9), about 350 m in length and with a Authority.
maintained depth of 11 m, extending NNW from the
SW end of Berth No 8. A 250 m radius turning basin, Kenya Port Authority [NP3--No 21--Wk 02/20]
maintained to 144 m, fronts the NE part of the jetty.
Oil Tanker Berths NP5 South America Pilot Volume 1
8.66b (2017 Edition)
1 Comprising two dolphin jetties connected by
walkways and a 5 cable long trestle to the shore, the
facility (225438S 143137E) is designed to Brazil -- East coast --
accommodate 60 000 dwt tankers. The turning basin Puerto de Suape — Anchorages
and depths alongside are maintained to 160 m. A tug
berth lies at the root of the jetty. 163

South African Chart ZA 1004; 1005 (2019) Paragraph 5.107 2 line(s) 1--3 Replace by:
[NP2--No 22--Wk 02/20] 2 Outer anchorages. There are three charted
anchorages E of the breakwater:
Anchorage No 1 for vessels with a maximum draught
NP3 Africa Pilot Volume 3 (2019 Edition) of 144 m;
Anchorage No 2 for vessels with maximum draughts
from 145 to 173 m;
Mozambique -- Nacala —
Directions; Leading lights Anchorage No 3 for vessels in quarantine with a
maximum draught of 173 m.
183
Brazilian Notice 22/Section IV.3 E Coast SD Edt.13/19
Paragraph 6.37 1 line 1 For 142516S Read 142500S [NP5--No 102--Wk 02/20]

Wk02/20 4.2
 IV

Brazil -- South east coast -- Porto de Imbituba — NP7A South America Pilot Volume 4
Arrival information; speed limit (2018 Edition)
270
Colombia -- Approaches to Puerto Barranquilla
After Paragraph 8.158 2 line 7 Insert: — Anchorages

3 Speed limit. Due to the presence of white whales, 250

from July to November a speed limit of 7 kn applies in
the outer part of the harbour, reducing to 4 kn in the Paragraph 9.83 1 line(s) 1--6 Replace by:
inner part of the harbour. Outer anchorages are as follows:
Anchorage CP03--A (110370N 745832W),
Brazilian Notice 22/ Section IV.3 S Coast SD Edt.13/19. quarantine anchorage, depths of around 10 to
[NP5--No 103--Wk 02/20] 40 m.
Anchorage CP03--C (110600N 745550W),
depths of around 13 to 125 m.
NP7 South America Pilot Volume 3 (2018 Edition) ENC CO400612 [NP7A--No 48--Wk 02/20]

Peru -- Approaches to Puerto San Nicolás —

Anchorage; wreck NP10 Arctic Pilot Volume 1 (2016 Edition)

281 Russia -- Kara Sea -- Ostrov Vil’kitskogo --

Vil’kitskiy — Directions; light
Paragraph 9.113 2 line(s) 3--4 Replace by:
289
5 151350S Dangerous A wreck lies close
751530W cargo vessels E of the After Paragraph 11.7 1 line 3 Insert:
anchorage Vil’kitskiy Light (white round tower, black bands,
32 m in height) (733094N 754639E).
Peruvian Notice 11/19; ENC PE503122
[NP7--No 60--Wk 02/20] Russian Notice 49/5679/19 [NP10--No 16--Wk 02/20]

Russia -- Kara Sea -- Ostrov Vil’kitskogo --

Peru -- Bahía del Callao -- Vil’kitskiy — Directions; light
La Pampilla — Prohibited area
290
299
Paragraph 11.10 1 lines 8--11 Replace by:
After Paragraph 10.17 3 line 3 Insert:
...sandy, 6 m high, from where Vil’kitskiy Light
Prohibited Area. Entry is prohibited into an area (11.7) is exhibited.
centred on 115772S 770836W.
Paragraph 11.11 1 line 2 Replace by:
Peruvian Notice 11/123/19 [NP7--No 61--Wk 02/20] ...754639E), the...

Russian Notice 49/5679/19 [NP10--No 17--Wk 02/20]

Ecuador -- Golfo de Guayaquil --
Guayaquil — Vertical clearance
Russia -- Kara Sea -- Ostrov Vil’kitskogo --
Vil’kitskiy — Directions; light
332
297
Paragraph 11.62 1 including existing Section IV Notice
Week 02/19 Replace by: Paragraph 11.72 2 line 4 Replace by:
1 A cable car (21118S 795205W) spans the river (11.7) and:
between the cities of Guayaquil and Durán. It has
been reported that least vertical clearances range Russian Notice 49/5679/19 [NP10--No 18--Wk 02/20]
from 11 to 15 m.
Puente Santay (21307S 795299W), a foot and Russia -- Kara Sea -- Ostrov Vil’kitskogo --
cycle bridge, spans Río Guayas from Guayaquil to Vil’kitskiy — Directions; light
Isla Santay (11.81). It is a double leaves bascule
bridge, the opening span is towards the W over the 300
deeper water of the river. Vertical clearance when the Paragraph 11.101 1 line 2 Replace by:
bridge is closed is 14 m.
The bridge is opened twice daily, dependent on the ...754639E) the route...
times of HW.
Paragraph 11.102 1 lines 2--3 Replace by:
Ecuadorian Notice 49/B/19 [NP7--No 62--Wk 02/20] Vil’kitskiy Light (733094N 754639E) (11.7).

4.3 Wk02/20
 IV

Paragraph 11.103 1 line 2 Replace by: Estonia -- Outer approaches to Väinameri --

Osmussaar — Directions; wreck
...754639E) (11.7), the...
419
Russian Notice 49/5679/19 [NP10--No 19--Wk 02/20]
Paragraph 12.77 2 line(s) 2--8 Replace by:

...Osmussaar (Baltic Pilot Volume 3) and clear of a

dangerous wreck (591448N 232716E), the alignment
NP18 Baltic Pilot Volume 1 (2018 Edition) (1924), of these lights leads SSW along the
recommended track, avoiding the charted shoals and
obstructions, passing:
Denmark -- Kattegat -- WNW of Dirhami neem (591257N 232950E)
Anholt — Directions; obstruction (12.69), thence:

162 Paragraph 12.77 3 line(s) 6--8 Delete

Paragraph 5.18 1 line 10 Replace by:

Paragraph 12.77 5 line(s) 2--4 Replace by:
SW of Nordvestrev (564542N 112700, thence:
Clear of a rock (564288N 113022E), position WNW of shoals extending from Telise neem
approximate, 1½ cables W of the harbour (590460N 232620E) (12.69).
entrance.
Estonian Notice 12/189/19 [NP19--No 90--Wk 02/20]
Danish Chart 124/19 [NP18--No 57--Wk 02/20]

Denmark -- Kattegat -- Svitringen Rende to south

of Anholt — Directions; obstructions NP20 Baltic Pilot Volume 3 (2019 Edition)
166

Paragraph 5.51 1 line(s) 4--6 Replace by:

Estonia -- Osmussaar — Directions; wreck
...position N of Anholt Wind Farm (5.45). The track then
leads SE for 20 miles, passing: 96
Clear of a group of rocky obstructions lying on each
side of a submarine cable in the vicinity of After Paragraph 3.16 1 line 6 Insert:
563821N 111915E, thence:
SW of a light buoy (S cardinal) (563870N SE of a dangerous wreck (591448N 232716E),
112589E). thence:
Thence to a position on Route T, 12 miles S of
Anholt (564268N 113422E).
Estonian Notice 12/189/19 [NP20--No 51--Wk 02/20]
Danish Chart 124/19 [NP18--No 58--Wk 02/20]

Finland -- Åland Islands --

Maarianhamina — Directions

NP19 Baltic Pilot Volume 2 (2018 Edition) 266

Paragraph 6.285 1 line(s) 1 For Möckelö Leading Lights

Sweden -- Stockholm -- Read Västerhamn
Lidingöbron -- Vertical clearance

285 Paragraph 6.285 2--3 Replace by:

Paragraph 7.186 2 line(s) 1 For two Read three 2 W of Korrviksten Light Buoy (W cardinal), about
3½ cables SSW of Lotsberget Front Light,
thence:
After Paragraph 7.186 2 line 4 Insert: E of Gregersö södra Light Buoy (E cardinal)
Lilla Lidingöbron (592161N 180641E), a bridge (600476N 195549E).
under construction (2019), is situated close NW of 3 Thence the track continues N, through a channel
Gamla Lidingöbron. A restricted area, marked by marked by buoys (E cardinal), as required for
buoys (special), surrounds the area under berthing.
construction.

Swedish Notice 783/14541/19 [NP19--No 89--Wk 02/20] Finnish Notice 33/277/19 [NP20--No 52--Wk 02/20]

Wk02/20 4.4
 IV

NP23 Bering Sea and Strait Pilot (2019 Edition) NP32A China Sea Pilot Volume 3 (2019 Edition)

Russia -- Siberia -- Kolyuchinskaya — Philippines -- Luzon Strait -- Batan Island --

Nature reserve Mananioy Bay — Directions; lights

396 101

After Paragraph 13.28 4 line 5 Insert: After Paragraph 3.37 1 line 7 Insert:
Nature Reserve. Kolyuchinskaya Guba lies within Mahatao Light (white concrete tower, red top)
the Beringiya National Park. The N limit of the park (202413N 1215755E).
lies at the entrance to Kolyuchinskaya Guba between
670637N 1744297W and 670421N 1743470W. Philippine Notice 11/71/19 [NP32A--No 85--Wk 02/20]

Russian Notice 49/5681/19 [NP23--No 3--Wk 02/20] Philippines -- Luzon Strait -- Batan Island --
Mananioy Bay — Directions; lights
NP25 British Columbia Pilot Volume 1 102--103
(2019 Edition)
After Paragraph 3.53 1 line 3 and centre heading
Directions Insert:
Canada -- Barkley Sound -- Trevor Channel —
Directions; light sector Principal marks
3.53a
330
1 Major lights
Paragraph 10.32 1 line(s) 1--6 Replace by: Mahatao Light (202413N 1215755E) (3.37).
1 From a position in the vicinity of (484711N Philippine Notice 11/71/19 [NP32A--No 86--Wk 02/20]
1251770W), about 3 miles W of Cape Beale (2.21),
the track leads ENE, at night in the white sector China -- East China Sea -- Zhoushan Qundao --
(0685–0725) of Trevor Channel Entrance Light East of Xiazhi Dao — Wreck
(white round tower) (484873N 1251091W),
exhibited from an islet NE of Cape Beale, passing: 220

Canadian Western Notice 11/3671/19 Paragraph 6.57 3 lines 1--11 including existing Section IV
[NP25--No 4--Wk 02/20] Notice Week 06/19 Replace by:
3 Approach north of deep--water channel from
east--north--east. From the vicinity of 295300N
NP28 Dover Strait Pilot (2017 Edition)
1225300E on the offshore route the track leads
WSW to Xiazhi Men, passing:
Netherlands -- Westerscheldt -- Hansweert -- SSE of Waiyang’an Dao (295193N 1223556E)
Zuidergat — Traffic regulations; cross currents (6.21) from which a light is exhibited, thence:
Clear of a dangerous wreck (294780N
190 1223232E), position approximate, reported
After Paragraph 7.211 1 line 5 Insert: (2018), thence:
NNW of the outer anchorage areas (294300N
Vessels must avoid passing each other between 1223400E) (6.50), thence:
No 51 Light Buoy (starboard hand) (512546N SSE of Liyang’an Dao (295275N 1223124E)
40136E) and No 55 Light Buoy (starboard hand) (6.33), from where a light is exhibited, and:
(512413N 40183E) during moderate or strong
cross currents; see 7.212. Chinese Notice 47/1523/19 [NP32A--No 87--Wk 02/20]
Paragraph 7.212 4 line 4 For --0020 Read --0010
China -- East China Sea -- Zhoushan Qundao --
East of Xiazhi Dao — Wreck
Paragraph 7.212 4 line 5 For +0100 Read +0040
223
Belgian Notice 24/299/19 [NP28--No 44--Wk 02/20]
Paragraph 6.68 2 lines 1--10 including existing Section IV
Notice Week 35/19 Replace by:
Netherlands -- Westerscheldt -- Hansweert --
Zuidergat — VTS; cross current 2 There are tidal stream rates up to 5½ kn in
channels adjacent to this passage, and attention is
190 drawn to the tidal stream arrows on the chart.
Directions. From a position SSW of Waiyang’an
After Paragraph 7.212 5 line 5 Insert: Dao (Dongtingshan) (295193N 1223556E) (6.21),
Warnings of the cross current will be announced by the channel leads W, passing:
the VTS (7.12). N of a dangerous wreck, (294780N 1223232E),
position approximate, reported (2018), thence:
Belgian Notice 24/299/19 [NP28--No 45--Wk 02/20] S of Shangpan Jiao (6.57), thence:

4.5 Wk02/20
 IV

S of Qingshan Jiao (294997N 1222472E) (6.9), NP37 West Coasts of England and Wales Pilot
from where a light (yellow and black round metal (2017 Edition)
column, 9 m in height) is exhibited, thence:
Isle of Man -- West coast -- West--north--west of
Chinese Notice 47/1523/19 [NP32A--No 88--Wk 02/20] Bradda Head — Directions; wreck

319
After Paragraph 10.178 2 line 3 Insert:
Clear of a dangerous wreck (540726N 45161W),
thence:
NP36 Indonesia Pilot Volume 1 (2019 Edition)
Isle of Man Notice 16/19 [NP37--No 39--Wk 02/20]

Indonesia -- Pulau Batam --

Kabil — Directions; light
NP42A Japan Pilot Volume 2 (2017 Edition)

177 Honshu -- Nanpo Shoto -- O Shima --

Habu Ko — Leading lights
Paragraph 10.102 1--3 Replace by:
149
1 Kabil Leading Lights:
Paragraph 7.12 3 line(s) 1--6 Replace by:
Front light (triangle, point up, on white beacon)
(10486N 1040837E) situated on the head of 3 Local knowledge is advisable.
the jetty extending E from the town. Directions. The chart is sufficient guide.
Rear light (triangle, point down, on similar structure)
(6½ cables SW of the front light). Japanese Notice 48/979/19 [NP42A--No 19--Wk 02/20]
2 On approaching Selat Riau from N, the alignment
(2169) of the lights leads SW through a channel, Tokyo Wan -- Tokyo--Ku —
marked by light buoys (lateral), passing: Traffic regulations; prohibited area
SE of Karang Galang (10951N 1041109E), on
193
which there is a light (see Malacca Strait and West
Coast of Sumatera Pilot). Paragraph 8.188 1 line 15 including existing Section IV
3 Thence the track continues to lead SW through the Notice Week 03/19 Replace by:
buoyed channel to a position SW of Citranusa Kabil
Port (10.109). ...Maximum permitted air draught 284 m.
Thence the buoyed channel leads SSW to the port Prohibited areas. Entry is prohibited to two areas,
of Kabil. marked by light buoys (special), centred on positions
Caution. A small detached reef lies in position 3536·69N 13947·77E and 353510N 1395005E.
10360N 1040863E. It is marked by a light buoy Japanese Notice 48/5563(P)/19
(isolated danger). [NP42A--No 20--Wk 02/20]
4 Useful marks:
Light beacon (triangle, apex down, on white beacon)
(10304N 1040841E).
NP42B Japan Pilot Volume 3 (2019 Edition)
GB Chart 3937 (2019) [NP36--No 11--Wk 02/20]
Japan -- Osaka Wan -- Kobe --
Kobe--Chuo Passage — Directional light

Indonesia -- Pulau Karimun Besar -- 350

Selat Gelam — Directions; shoal
Paragraph 13.35 2--3 Replace by:
2 The track then leads NNW, through the passage,
195
into the outer part of Section 2; for aircraft approach
areas see 13.20.
Paragraph 11.70 2 lines 8--10 Replace by: 3 The track then leads N, within the white sector
(356--000) of Nadahama--Higashi Directional Light
Caution. A rock awash (05914N 1032612E) lies
(white post, 16 m in height) (344202N 1351463E),
close SE of the light buoy (port hand) within the
through a passage, marked by light buoys (lateral), to
channel.
the head of Section 2. This passage is sometimes
Port Authority. Dit Jen Perhubungan Laut, Cabang
Tanjung Balai Karimun, Tanjung Balai Karimun, Riau, referred to as Nadahama Fairway (344120N
Indonesia. 1351466E).

Japanese Notice 47/5556(P)/19

GB Chart 3833 (2019) [NP36--No 12--Wk 02/20] [NP42B--No 4--Wk 02/20]

Wk02/20 4.6
 IV

NP43 South and East Coasts of Korea, East Russia -- Zaliv Petra Velikogo -- Zaliv Amurskiy
Coast of Siberia and Sea of Okhotsk Pilot — Directions; marine farms
(2018 Edition)
249

South Korea -- South coast -- After Paragraph 6.55 2 line 9 Insert:

Yeosu Haeman — Anchorages
Caution. Extensive marine farms lie at the head of
131 the bay.

Paragraph 3.44 1 line(s) 3--9 Replace by: Russian Notices 50/5860 & 5860/19
[NP43--No 98--Wk 02/20]
D--1, designated for VLCCs, centred on 343771N
1275866E.
Anchorage No 2, quarantine, within the N part of the
anchorage D1 and centred on 343913N
1275787E. NP44 Malacca Strait and West Coast of Sumatera
D--2, with a radius of 4 cables centred on 344014N Pilot (2019 Edition)
1275388E, and depths from 19 to 21 m.
Unrestricted.
Malaysia -- Singapore Strait --
ENC KR4F4H20 [NP43--No 97--Wk 02/20] Tanjung Pelapas — Pilotage

183
South Korea -- South coast --
Jinhae Man — Name Paragraph 7.32 1 line 5 For 11469N 1033211E Read
11393N 1033187E
164

Paragraph 3.286 2 lines 1--3 Replace by: GB Chart 3833 (2019) [NP44--No 14--Wk 02/20]
2 Goheyon Fairway to Gajodo Sudo. From a
position about 8½ cables N of Hwangdeokdo the route Indonesia -- Pulau Batam --
leads SW for 6¾ miles through Goheyon Fairway to... Sekupang — Directions; buoyage
South Korean Chart 2165 (2019) 188
[NP43--No 94--Wk 02/20]
Paragraph 7.55 8 Replace by:
South Korea -- South coast -- 8 Between a light beacon (port hand, 8 m in
Jinhae Man — Name
height) (10810N 1035520E) standing on
the coastal reef and a shoal patch (10800N
165
1035500E), with depths less than 3 m. A
Paragraph 3.295 4 line 9 For Tongyeong Fairway Read light buoy (starboard hand) marks the NW
Goheyon Fairway extremity of of the shoal. Thence:

Paragraph 3.297 1 lines 1--3 including heading and GB Chart 3937 (2019) [NP44--No 13--Wk 02/20]
continuity legend Replace by:

Goheyon Fairway to Gajodo Sudo

(continued from 3.295 and 3.296) NP45 Mediterranean Pilot Volume 1
3.297 (2018 Edition)
1 From a position about 8½ cables N of
Hwangdeokdo (350055N 1283728E) the track
leads SW through Goheyon Fairway, marked by light... Spain -- East coast -- Castellón — Anchorages

South Korean Chart 2165 (2019) 139

[NP43--No 95--Wk 02/20]
Paragraph 3.81 1 line(s) 3--11 Replace by:
South Korea -- South coast -- ...anchorage area with a radius of 7½ cables centred on
Jinhae Man — Name 395529N 00405E, with depths of about 24 to 31 m.
A designated anchorage for vessels carrying
167 non--dangerous cargo is centred on 395850N
00432E with depths of about 17 to 27 m.
Paragraph 3.301 1 line 8 For Tongyeong Fairway Read
A designated anchorage for vessels carrying
Goheyon Fairway
dangerous cargo is centred on 395856N 00603E
with depths of about 24 to 30 m.
South Korean Chart 2165 (2019)
[NP43--No 96--Wk 02/20] Spanish Notice 48/382/19 [NP45--No 70--Wk 02/20]

4.7 Wk02/20
 IV

NP47 Mediterranean Pilot Volume 3 NP56 Norway Pilot Volume 1 (2018 Edition)
(2017 Edition)
Sweden -- West coast -- Skagerrak --
Grebbestad — Directions; leading lights
Greece -- Ionian Sea -- Stenó Kérkyras --
Kérkyra Harbour — Pilotage
251
147 Paragraph 8.88 4 line(s) 5--12 Replace by:
Paragraph 5.74 1 line(s) 3--4 Replace by: ...Leading Light, the track leads N into the harbour.
...under 500 gt. Pilots board 1 mile ESE of Nisída Vído, in Swedish Notice 783/14414/19 [NP56--No 23--Wk 02/20]
the vicinity of 393796N 195707E

ENC GR5ZM401 [NP47--No 62--Wk 02/20] NP58A Norway Pilot Volume 3A (2015 Edition)

West coast -- Dønna --

Åkervågen — Vertical clearance
NP49 Mediterranean Pilot Volume 5
(2018 Edition) 169

Paragraph 4.316 1 line 7 For 24 m Read 22 m

Turkey -- South coast -- ™skenderun Körfezi --
™sdemir — Restricted area
Norwegian Notice 22/60846/19
[NP58A--No 86--Wk 02/20]
186

Paragraph 5.270 1 lines 1--6 Replace by: West coast -- Lofoten -- Moskenesøya -- Å —
Directions; light sectors
1 A security zone extends from a position about
1½ miles N of the harbour entrance to a position 366
1 mile S of the root of the S breakwater. The area
extends between about 3 cables and 1 mile to Paragraph 11.13 1 line 4 For (328--322) Read
seaward and encompasses the harbour entrance. (3295--333)
Unauthorised entry to the area is prohibited.
Paragraph 11.13 4 line 5 For (298--310) Read
Turkish Notice 48/229/19 [NP49--No 40--Wk 02/20] (2985--310)

Cyprus -- East coast -- Fumagusta — Anchorage Norwegian Notice 22/60850/19

[NP58A--No 87--Wk 02/20]
207
West coast -- Lofoten -- Moskenesøya --
Paragraph 6.127 1 line 4 Replace by: Olnilsøya — Directions; light sector
...of about 15 m to 70 m. A submarine cable has been laid 369
in the N of the anchorage.
Paragraph 11.31 1 line 3 For (344--354) Read
French Notice 48/138/19 [NP49--No 41--Wk 02/20] (343--354)

Norwegian Notice 22/60847/19

[NP58A--No 88--Wk 02/20]
NP50 Newfoundland and Labrador Pilot
(2016 Edition)
NP58B Norway Pilot Volume 3B (2018 Edition)
Newfoundland -- Fortune Bay --
Fortune Harbour — Buoyage Sør--Troms -- Kvæfjord -- Bygdesundet —
Submarine pipeline
158
105
Paragraph 4.69 1 line(s) 11 For VF4 Read VF2
Paragraph 4.83 1 line 6 Replace by:

Paragraph 4.69 1 line(s) 13 For VF2 Read VF4 ...stony, and clear of a submarine pipeline (684681N
160823E). Mooring bolts are available at Trastad.

Canadian Eastern Notice 11/4832/19 Norwegian Notice 22/60868/19

[NP50--No 21--Wk 02/20] [NP58B--No 27--Wk 02/20]

Wk02/20 4.8
 IV

Sør--Troms -- Andfjorden -- Sifjorden -- Aust--Finnmark -- Austhavet --

Bloskeneset — Directions; light sector Vardø — Directions; light

110 370
Paragraph 4.123 5 line 11 For (066--077) Read Paragraph 12.38 4 line(s) 8 For (12.37) Read (white
(067--0775) wooden tower, 20 m in height)

Norwegian Notice 22/60843/19 Norwegian Notice 22/60867/19

[NP58B--No 28--Wk 02/20] [NP58B--No 34--Wk 02/20]

Sør--Troms -- Andfjorden -- Sifjorden -- Aust--Finnmark -- Austhavet --

Bloskeneset — Directions; light sector Vardø — Directions; light

112 374

Paragraph 4.132 1 line 4 For (095--1115) Read Paragraph 12.81 1 line 2 Delete
(0955--1115)
Norwegian Notice 22/60867/19
Norwegian Notice 22/60843/19 [NP58B--No 35--Wk 02/20]
[NP58B--No 29--Wk 02/20]

NP62 Pacific Islands Pilot Volume 3

Sør--Troms -- Andfjorden -- Sifjorden --
Bloskeneset — Directions; light sector (2020 Edition)

112
French Polynesia -- Îles de la Société --
Paragraph 4.133 1 line 4 For (066--077) Read Tahiti -- Bassin de Taunoa — Anchorage
(067--0775)
164

Norwegian Notice 22/60843/19 Paragraph 6.159 2--3 Replace by:

[NP58B--No 30--Wk 02/20] 2 Directions. The basin is approached from N and
entered through Passe de Taunoa (173120S
Nord--Troms -- Rebbenesøya -- Sandøyfjorden -- 1493310W) (6.155). The basin may also be entered
Sørstabben — Directions; light sector through a marked channel from Bassin de Papaoa
(6.158).
195
Landing. Landing places in the basin are unusable
Paragraph 7.30 1 line 6 For (336--353) Read in strong NW winds.
(3405--3525)
French Notice 40/228/19 [NP62--No 1--Wk 02/20]

Norwegian Notice 22/60841/19

French Polynesia -- Îles Marquises --
[NP58B--No 31--Wk 02/20] Nuku--Hiva -- Baie de Taiohae — Anchorage

Nord--Troms -- Rebbenesøya -- Sandøyfjorden -- 247

Sørstabben — Directions; light sector
After Paragraph 10.95 1 line 3 Insert:
195 Anchorage, reserved for vessels more than 90 m in
Paragraph 7.32 1 line 3 For (187--190) Read length, may be obtained centred on 85543S
(188--1905) 1400604W with 72 hours notice (see also 10.92).

French Notice 38/231/19 [NP62--No 2--Wk 02/20]

Norwegian Notice 22/60841/19
[NP58B--No 32--Wk 02/20]
NP63 Persian Gulf Pilot (2018 Edition)
Aust--Finnmark -- Austhavet --
Vardø — Directions; light United Arab Emirates -- Approaches to Mubarraz
terminal -- TSS Between Zaqqum and
369 Umm Shaif — Directions
Paragraph 12.37 2 line(s) 3--5 Delete
171
Photograph caption For Vardø Light (12.37) Read Vardø After Paragraph 7.272 1 line 6 Insert:
Light (12.38)
Clear of an obstruction (250455N 532102E),
depth 19 m, thence:
Norwegian Notice 22/60867/19
[NP58B--No 33--Wk 02/20] H102 ADNOC [NP63--No 89--Wk 02/20]

4.9 Wk02/20
 IV

Qatar -- Mesaieed — Controlling depths NP67 West Coasts of Spain and Portugal Pilot
(2018 Edition)
190

Paragraph 7.424 1 line(s) 1--4 Replace by: Spain -- Golfo de Cadiz -- Río Guadalquivir —
Entrance channel; wrecks
1 East Channel, Main Channel and North Inner
Channel are dredged to a depth of 135 m (2019). 188
West Channel is dredged to a depth of 110 m (2019).
Paragraph 6.132 2 line(s) 2 Replace by:
H102 Qatar Petroleum [NP63--No 90--Wk 02/20] ...(364575N 62691W) the alignment (069) of the
leading lights leads...
Kuwait -- KhalØj al Kuwayt -- MØnº’ ad DawÖah —
Prohibited area After Paragraph 6.132 2 line 7 Insert:
3 Caution. A wreck, marked by a light buoy (special),
235 lies in the vicinity of 364749N 62123W. A second
Paragraph 8.370 1 line(s) 11--13 Delete wreck, also marked by a light buoy (special), lies
1¼ cables ENE.

Correspondence Kuwait Ministry of Communications Spanish Notice 47/369/19; ENC ES504421

[NP63--No 91--Wk 02/20] [NP67--No 14--Wk 02/20]

Wk02/20 4.10
 V

UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS

NP74, Vol A Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

EAST COAST. FIRTH OF FORTH. RIVER FORTH

A2935 Remove from list; deleted

EAST COAST. FIRTH OF FORTH. RIVER FORTH

A2936 Remove from list; deleted

SOLAN OILFIELD
A8240 - Otter Bank. Westward. 60 03·70 N Mo(U)W 15s .. 15 Platform Diagonally opposite on 2 corners of
SOLAN 205/26a 3 58·28 W platform
(GB)
- - - - Reserve light .. Mo(U)W 15s .. 10
- - - - Subsidiary light .. Mo(U)R 15s .. 3
---- .. Horn Mo(U) .. 2 .. (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
- - - - Reserve fog signal .. Horn Mo(U) .. 0·5 . . (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
* * * * * * * *

NP75, Vol B Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 52, dated 26 December 2019.

B1051 GW/EMS 54 09·96 N Iso W 8s 14 17 Red light vessel Shown 24 hours. Floodlit
DE, 4003, 308500 (DE) 6 20·72 E 12
- Emergency light .. FR .. .. .. May show 2 F R (vert)
- .. Horn Mo(R) .. .. .. Sounded continuously
30s
*

B2074 Vorupør. Mole. Head 56 57·75 N Fl G 5s 6 5 Framework tower fl 1.

DK, , 270 8 21·64 E 3 TE 2019
*

B3237 - Tananger. Havnetangen 58 55·88 N Oc(3)WRG 10s 13 W2·5 Post W181·3°-216·7°(35·4°),

NO, , 100600 5 34·51 E R1·6 3 R100°-126·7°(26·7°),
G1·4 W058·9°-070·4°(11·5°),
G070·4°-094·3°(23·9°),
W094·3°-100°(5·7°),
R216·7°-058·9°(202·2°)
* *

B3237·2 - Melingholmen. S End 58 55·67 N Fl R 3s 3 0·7 Post fl 0·3

NO, , 100700 5 35·02 E 4
*

B3239 Midtfjæra 58 55·84 N VQ(3)W 5s 7 3 Tripod

NO, , 101200 5 32·37 E 16
- .. Racon .. .. .. ALRS Vol 2 Station 64950
*

5.1 Wk02/20
 V

NP75, Vol B Edition 2019/20 continued.

B3241 Oksafotskjeret 58 56·82 N Fl WRG 5s 9 W4·8 Column fl 0·5.

NO, , 100900 5 31·81 E R3·2 10 W201·3°-228·6°(27·3°),
G 3 R228·6°-269·5°(40·9°),
G269·5°-306·4°(36·9°),
W306·4°-309·7°(3·3°),
R309·7°-338·6°(28·9°),
G338·6°-355·7°(17·1°),
W355·7°-001·3°(5·6°),
R001·3°-037·1°(35·8°),
G037·1°-054·9°(17·8°),
W054·9°-056·6°(1·7°),
R056·6°-153·7°(97·1°),
G153·7°-201·3°(47·6°)
* *

B3270·5 - Ulsnesgrunnen. W 58 59·23 N QR 5 2·1

NO, , 106336 5 42·82 E
* *

B3277·313 - Verven 58 58·40 N FG 4 1·2 Post Floodlit

NO, , 107647 5 44·74 E
* *

NP76, Vol C Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

SOUTH COAST
C2450·4 Remove from list; deleted

C4077·92 - Aleksandrovskaya. 60 01·54 N Dir WRG 5s .. 4 Red U, white stripe Fl R342·4°-344·5°(2·1°).

RU, 2201, 440·8 Vnutrenniy. Bridge. Dir Lt 29 50·03 E 22 Al WR344·5°-344·7°(0·2°).
344·9° Fl W344·7°-345·1°(0·4°).
Al WG345·1°-345·3°(0·2°).
Fl G345·3°-347·4°(2·1°).
Operates from April to December
* * * * * * * *

C4077·95 - Aleksandrovskaya. 60 01·56 N Dir WRG 5s .. 4 Red U, white stripe Fl G162·4°-164·5°(2·1°).

RU, 2201, 440·7 Vneshniy. Bridge. Dir Lt 29 50·02 E 22 Al WG164·5°-164·7°(0·2°).
164·9° Fl W164·7°-165·1°(0·4°).
Al WR165·1°-165·3°(0·2°).
Fl R165·3°-167·4°(2·1°).
Operates from April to December
* * * * * * * *

SAARISTOMERI (ARCHIPELAGO SEA). AHVENANMERI (ÅLANDS HAV). MAARIANHAMINA

C4505·4 Remove from list; deleted

SAARISTOMERI (ARCHIPELAGO SEA). AHVENANMERI (ÅLANDS HAV). MAARIANHAMINA

C4505·41 Remove from list; deleted

5.2 Wk02/20
 V

NP77, Vol D Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

D1534·12 - Ria. Canal de Deusto 43 16·89 N Q R 1s 10 1 Red tripod, on hut

ES, I, 00880 2 58·08 W 8
* *

D1838·5 - As Sinas. Jetty 42 34·60 N Q R 1s .. 1 Red post, white bands TE 2019

ES, I, 04393 8 48·58 W
*

D1893·1 - Canido. Ldg Lts 116·9°. 42 11·62 N Oc G 4s 13 3 White &, with black ec 1.
ES, I, 05181 Rear. 356m from front 8 47·82 W ,, on metal tower TE 2019
9
*

D2349·968 - Marina Jetty. N Head 37 20·05 N Fl(3)G 9s .. 3 Green post (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5.
ES, I, 09992·41 5 59·56 W Replaced by light buoy (T) 2019
*

D2391 - No 3 36 22·65 N Fl(4)G 11s .. 3 Green % on green (fl 0·5, ec 1·5) x 3, fl 0·5, ec 4·5.
ES, I, 10644 6 12·66 W beacon Irregular (T) 2019
*

D2457 - Sandy Shore. North Groyne 36 07·90 N QW .. . . ) on yellow beacon, TE 2019

(GB:MODN) 5 20·37 W black top
*

D7326·5 Shināş. Fishing Harbour. 24 44·92 N Fl R 5s 6 5 Red & on metal post

OM, , 1150 Main Breakwater. Head 56 28·49 E 2
*

NP79, Vol F Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

NARCONDAM ISLAND
F1201·1 - 13 27·31 N Fl(3)W 20s 61 8 White metal (fl 0·5, ec 1) x 2, fl 0·5, ec 16·5.
94 15·32 E framework tower W054°-194°(140°)
14
*

F2860·15 - Port of Kemaman. Outer 4 12·92 N QR 12 5 Beacon TE 2019

Approaches. South 103 29·85 E
*

F2885·6 Seabelle Rock 5 54·61 N Fl W 4s 9 8 White column on TE 2019

102 42·59 E piles
*

F3221·2 Mui Rong. Westward. DT5 18 50·03 N Fl(2+1)W 10s .. . . White concrete
105 42·71 E tower, green bands
*

5.3 Wk02/20
 V

NP80, Vol G Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

ANTARCTIC PENINSULA. FALLIESES COAST. MARGUERITE BAY

G1401·7 - Reference Islands 68 11·75 S Fl W 5s 18 9 Red round GRP fl 1
(GB) 67 09·36 W tower, black top
4
-- .. AIS .. .. .. MMSI No 997016122
* * * * * * * *

G5256·4 - Entrance. Dir Lt 070°30′ 48 48·72 N Dir F WRG 11 8 White square F R064·5°-068·5°(4°).
CA, P, 172·5 125 10·91 W framework with red F W068·5°-072·5°(4°).
bands F G072·5°-074·5°(2°).
7 White sector indicates preferred
channel
--- .. Fl R 4s 18 5
* * * * *

QUEEN CHARLOTTE SOUND. NORTHERN INSIDE CHANNELS

G5677 - Burke Channel. Haaksvold 51 57·88 N Fl G 6s 7 5 White square fl 0·5
CA, P, 603 Point 127 42·82 W framework tower
with green band at
top
8
* * * * * * *

G5677·4 - Burke Channel. Kelkpa 52 07·29 N Fl R 6s 8 5 White square fl 0·5

CA, P, 602 Point 127 36·44 W framework tower
with red band on top
6
* * * * *

G5681·5 - N of Georgie Point. Teal 52 11·19 N Fl G 6s 7 3 White square fl 0·5

CA, P, 594·5 Island 127 53·07 W framework tower
with green band at
top
6
* * * * * * * *

G5686 - Coolidge Point 52 21·01 N Fl R 6s 6 5 White square fl 0·5

CA, P, 600 127 43·01 W framework tower
with red band at top
8
* * * *

QUEEN CHARLOTTE SOUND. NORTHERN INSIDE CHANNELS

G5687 - Dean Channel. Hokonson 52 21·00 N Fl G 6s 5 3 Green, white, black fl 0·5
CA, P, 600·6 Point 127 28·73 W & on square
framework tower
6
* * * * * * * *

G5687·5 - Dean Channel. Fougner 52 24·33 N Fl R 4s 10 3 White square

CA, P, 600·8 Point 127 22·77 W framework tower
with red band on top
6
* * * * * * * *

QUEEN CHARLOTTE SOUND. NORTHERN INSIDE CHANNELS. BURKE CHANNEL

G5688·5 - North Bentinck Arm. 52 20·95 N Fl R 6s 7 5 White square fl 0·5
CA, P, 597 Flagpole Point 126 55·69 W framework tower
with red band at top
6
* * * * * *

QUEEN CHARLOTTE SOUND. NORTHERN INSIDE CHANNELS. FISHER CHANNEL. JOHNSON CHANNEL
G5689·8 - Nicholson (Hoonees) 52 18·53 N Fl(3)W 12s 7 3 White square (fl 0·5, ec 2) x 2, fl 0·5, ec 6·5.
CA, P, 604·2 Island. S End 127 56·62 W framework tower Operates 24 hours
8
* * * * * * * *

5.4 Wk02/20
 V

NP80, Vol G Edition 2019/20 continued.

G5689·9 - Coldwell Point. Sisters 52 19·15 N Fl W 6s 7 3 White square fl 0·5.

CA, P, 604·5 Point 128 01·52 W framework tower Operates 24 hours
7
* * * * * * * *

QUEEN CHARLOTTE SOUND. NORTHERN INSIDE CHANNELS. FISHER CHANNEL

G5692 - Johnson Channel. E Shore 52 14·89 N Fl R 6s 6 3 White square fl 0·3
CA, P, 594·8 127 54·08 W framework tower
with red band at top
7
* * * * * * * *

NP81, Vol H Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 49, dated 05 December 2019.

CHENAL DU VIEUX FORT

H1889·7 Remove from list; deleted

CHENAL DU VIEUX FORT

H1889·705 - E. of entrance to Baie du 51 23·86 N Iso WRG 8s 17 11 Red and White U, on R009·25°-010°(0·75°),
CA, A, 1539·125 Vieux Fort 57 48·22 W square framework W010°-012°(2°),
tower G012°-012·75°(0·75°).
Seasonal. Operates 24 hours
* * * * * * * *

CHENAL DU VIEUX FORT

H1889·71 Remove from list; deleted

NP82, Vol J Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

BAHIA DE CARDENAS
J4879 - Cayo Piedras del Norte 23 14·58 N Fl W 10s 24 12 White round masonry fl 1·5
CU, P2101, 182 81 07·23 W tower
19
- - Reserve light .. .. .. 8
* *

J4881 - Cayo Diana 23 09·84 N Fl W 8s 15 10 White framework Range 3M (T) 2020

CU, P2101, 198 81 06·17 W tower
12
*

J5072 - Canal Cuatro Reales. Cayo 20 26·90 N Fl W 10s 14 10 Aluminium fl 1.

CU, P2101, 738 Carapacho. W End 78 02·42 W framework tower TE 2020
9
*

J5096 - Punta de Pasacaballos 22 03·72 N Fl R 4s 10 5 Red % on framework

CU, P2101, 908 80 27·70 W tower
8
*

5.5 Wk02/20
 V

NP82, Vol J Edition 2019/20 continued.

J5097·4 - Cayo Carenas. 4th Ldg Lts 22 05·10 N Fl W 1·5s 4 23 Orange , on white
CU, P2101, 910 358°30′. Front 80 27·54 W concrete wall
3
*

J5097·41 - Cayo Carenas. 4th Ldg Lts 22 05·13 N Fl W 1·5s 4 23 Orange , on white
CU, P2101, 911 358°30′. Rear. 60m from 80 27·54 W concrete wall
front 4
*

VENEZUELAN ARCHIPIÉLAGO. ARCHIPIÉLAGO LOS TESTIGOS

J6509 - Isla Testigo Grande 11 22·69 N Fl W 10s 445 23 White GRP fl 1
VE, , V5040 (VE) 63 07·25 W framework tower,
orange band
3
-- .. Racon 442 .. .. ALRS Vol 2 Station 94623
*

NP85, Vol M Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

M4189·74 Chudo. Southward 36 17·33 N Q(6)+LFl W 10 7 " on black beacon,

KR, 410, 3243·9 126 17·95 E 15s yellow top
17
* *

ANMA GUNDO
M4207·02 - Gochang. Wind farm. No 35 29·85 N Mo(U)Y 10s 14 9 Yellow round steel Other identical lights mark the wind
KR, 410, 3146·13 16 126 19·11 E post farm limits
2
* * * * * * * *

M4207·021 - Gochang. Wind farm. No 6 35 29·41 N Fl(4)Y 8s 14 3 Yellow round steel

KR, 410, 3146·9 126 20·01 E post
2
* * * * * * * *

M4207·022 - Gochang. Wind farm. No 1 35 29·19 N Mo(U)Y 10s 14 9 Yellow round steel
KR, 410, 3146·3 126 20·48 E post
2
* * * * * * * *

M4207·023 - Gochang. Wind farm. No 3 35 28·57 N Fl(4)Y 8s 14 3 Yellow round steel

KR, 410, 3146·5 126 19·73 E post
2
* * * * * * * *

M4207·024 - Gochang. Wind farm. No 5 35 27·95 N Mo(U)Y 10s 14 9 Yellow round steel
KR, 410, 3146·7 126 18·99 E post
2
* * * * * * * *

M4207·025 - Gochang. Wind farm. No 35 28·39 N Fl(4)Y 8s 14 3 Yellow round steel

KR, 410, 3146·11 15 126 18·08 E post
2
* * * * * * * *

M4207·026 - Gochang. Wind farm. No 35 28·61 N Mo(U)Y 10s 14 9 Yellow round steel
KR, 410, 3146·17 20 126 17·63 E post
2
* * * * * * * *

5.6 Wk02/20
 V

NP85, Vol M Edition 2019/20 continued.

M4207·027 - Gochang. Wind farm. No 35 29·23 N Fl(4)Y 8s 14 3 Yellow round steel

KR, 410, 3146·15 18 126 18·37 E post
2
* * * * * * * *

M4210·37 Sudo. SW 35 04·94 N Fl G 5s 10 9 Green round concrete

KR, 410, 3138·21 126 07·74 E tower
15
* * * * * * * *

M4265·55 Ihohyeonsa 33 29·92 N Fl(2)R 6s 10 8 Red round pillar

KR, 410, 2679·5 126 27·00 E 9
*

M4279·78 Norokdo 34 12·13 N Fl(4)Y 8s 4 7 Yellow round metal Y014°-202°(188°)

KR, 410, 2600·1 126 32·33 E post
2
*

M4283·35 Tongri Hang 34 09·36 N Fl G 6s 11 8 White metal post

KR, 410, 2601·1 126 34·83 E 8
* *

M4322·43 Nodae Gundo. Haseo 34 41·79 N Fl(2)W 10s 13 7 # on black metal

KR, 410, 2237·2 128 16·13 E post, red band
KR, 410, 4561·4 15
-- .. AIS .. .. .. MMSI No 994401569
* * * *

M4340·99 - Approaches. Dongjin 35 04·54 N Iso G 4s 29 4 Green & Bridge light sectors , G (odd)
KR, 410, 2137·5 Bridge. Left. L2, L3 128 27·98 E 115°-295°(180°), G (even)
295°-115°(180°)
- - - Centre. C2, C3 .. Iso W 4s 29 7 White v, red stripes
- - - Right. R2, R3 .. Iso R 4s 29 4 Red %
- - - Piers P2, P3, P4, P5 .. Iso Y 4s 24 6
*

M4343 Sobeombeokdo. Dochinyeo 35 04·54 N Fl(2)W 5s 10 7 # on black metal

KR, 410, 2091 128 40·35 E post, red band
11
-- .. Racon .. .. .. ALRS Vol 2 Station 82815
* * * *

M4353·91 - Nakdong Gang. Jeondeung 35 04·46 N Fl(2)G 6s 2 2 Green & on green Nakdonggangjeondeung Channel is
KR, 410, 2064·1 Channel. No 1 128 53·25 E pile marked by Fl(2)G 6s and Fl(2)R 6s
12 light beacons
* *

M4413·625 Igari Hang. W Breakwater. 36 11·12 N Fl(2)R 6s 13 8 Red round concrete

KR, 410, 1301·7 Head 129 23·18 E tower
10
*

NP87, Vol P Edition 2019/20. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

P3468·02 - LB2 22 46·49 N Fl W 4s .. . . Red and white pile

CN, G103, 4415·7 113 36·36 E
* * * * * * * *

5.7 Wk02/20
 V

NP87, Vol P Edition 2019/20 continued.

P3468·03 - LB1 22 46·80 N Fl W 4s .. . . Red and white pile

CN, G103, 4415·6 113 36·06 E
* * * * * * * *

P3716·6265 - Fuchimen Bridge, Opening. 30 05·51 N FG .. . . Green - S on white Two way navigable span. Bridge piers
CN, G102, 2426·071 No 7. No 8 121 58·82 E & marked by Q Y lights
CN, G102, 2426·082 - - No 5. No 6 .. QR .. . . Red & Marks port side of navigable span
- - No 9. No 10 .. QG .. . . Green % Marks starboard side of navigable
span
- - No 1. No 2 .. FR .. . . Red × on yellow & Sailing under these spans is prohibited
-- .. AIS .. .. .. MMSI No 994121537
* * * * * * * *

NP88, Vol Q Edition 2020/21. Weekly Edition No. 2, Dated 09 January 2020.
Last Updates: Weekly Edition No. 1, dated 02 January 2020.

SELAT LEWOTOBI. PULAU LOBETOBI

Q1339 - Pulau Lobetobi 8 36·21 S Q W 1s 45 14 White metal fl 0·2
ID, , 5711 (ID) 122 50·75 E framework tower
15
* * * *

Q1348 - Pulau Sika 8 07·11 S Fl W 4s 22 11 White beacon fl 0·5

ID, , 5729 (ID) 124 37·10 E
* *

PULAU ROTE
Q1356 - Ba'a 10 43·57 S LFl(2)W 10s 47 20 Concrete tower fl 2, ec 2, fl 2, ec 4.
ID, , 5750 (ID) 123 02·77 E 45 W090°-211°(121°)
- - Ship movement light .. FW .. .. .. Shown from pier head when a vessel
is expected or departing
* * * *

PULAU SEMAU
Q1360 - T Kulun 10 07·54 S Fl(3)W 20s 127 27 White metal (fl 1, ec 1) x 2, fl 1, ec 15.
ID, , 5800 (ID) 123 26·74 E framework tower W046°-293°(247°)
16
-- .. Racon .. .. .. ALRS Vol 2 Station 86540
* *

TIMOR. TELUK KUPANG. PULAU KERA

Q1360·5 - Pulau Kera 10 05·29 S Fl W 3s 12 27 White GRP tower fl 0·5
ID, , 5801 (ID) 123 33·21 E 20
* * * * * *

5.8 Wk02/20
 VI

UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS

Weekly Edition No. 2 dated 09 January 2020

The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2020.pdf)

VOLUME 1, NP281(1), 2019/20

Published Wk 48/19
(Last Updates: Weekly Edition No. 1 dated 02 January 2020)

MARITIME RADIO STATIONS

PAGE 189, POLAND, below GDYNIA MRCC.

Insert:

POLISH RESCUE RADIO (SPL) [2934]

Control Centre: 54°32′·00N 18°32′·00E MMSI 002618102 DSC VHF MF
Telephone: +48 58 3553670 Fax: +48 58 6205363
+48 58 6205328
Email: [email protected]
NOTE(S): Distress, Urgency and Safety traffic only.

VHF
Czołpino 54°43′·10N 17°14′·50E Ch 05 16
Gąski 54°14′·60N 15°52′·40E Ch 16 61
Gdańsk 54°22′·20N 18°46′·70E Ch 05 16
Jarosławiec 54°32′·40N 16°32′·60E Ch 16 62
Kikut 53°58′·90N 14°34′·80E Ch 05 16
Krynica Morska 54°22′·90N 19°25′·30E Ch 16 61
Niechorze 54°05′·70N 15°03′·90E Ch 16 62
Police 53°33′·90N 14°35′·10E Ch 16 61
Rozewie 54°49′·80N 18°20′·20E Ch 16 62
Stilo 54°47′·20N 17°44′·00E Ch 16 61
The transmitters above are remotely controlled by the Maritime Safety Centre located in Gdynia and run by the Maritime Office of Gdynia.

RT (MF)
Position Transmits Receives Hours of Watch
2182 2182 H24
Ustka 54°35′·28N 16°51′·01E
2591 2090

Radiotelex [2934]
Position Transmits Receives Hours of Watch
2174·5 2174·5 H24
Ustka 54°35′·28N 16°51′·01E 2177 2189·51
2187·5 2187·5 H24
1 routine traffic and test calls

Polish Hydrographic Office correspondence (RSDRA2019000305554) 2/20

Wk02/20
6.1
6.1
 VI
VI

PAGE 189, POLAND, below ŚWINOUJŚCIE (MRSC).

Insert:

VTS ZATOKA GDAŃSK - VTS CENTRE

Control Centre: 54°24′·33N 18°30′·70E MMSI 002611400 DSC VHF
Telephone: +48 58 6216162 Fax: +48 58 6205363
+48 58 6211443 +48 58 6205328
+48 60 1991331
+48 62 72727
Call: VTS Zatoka Email: [email protected]
Inmarsat BGAN: 772265042 Website: www.umgdy.gov.pl
NOTE(S): Distress, Urgency and Safety traffic only.

VHF
Ch 16 66 71 H24

Polish Hydrographic Office correspondence (RSDRA2019000301012) 2/20

PAGE 191, POLAND.

WITOWO.
Delete entry

(former update 1/20)

Polish Hydrographic Office correspondence (RSDRA2019000301012) 2/20

VOLUME 2, NP282(1), 2019/20

Published Wk 13/19
(Last Updates: Weekly Edition No. 1 dated 02 January 2020)

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 132, SWEDEN, below Knolls Grund Lt Buoy.

Insert:

Landskrona Safe Water Mark 55°54′·60N 12°44′·50E 992651006 Virtual

Swedish Notice 785/14571/19 (RSDRA2019000300587) 2/20

PAGE 148, TURKEY (Marmara Denizi).

Karaburun Lt Buoy.
Delete entry

Turkish Notice 49/231/19 (RSDRA2019000300365) 2/20

VOLUME 2, NP282(2), 2019/20

Published Wk 13/19
(Last Updates: Weekly Edition No. 1 dated 02 January 2020)

RADAR BEACONS

PAGE 14, VIETNAM, below 80680 Hai Phong Channel Front Ldg Lt (South).
Insert:

Hai Phong Channel Bn E 20°48′·71N 106°49′·66E 3 & 10 17 60 N 80681

Hai Phong Channel Bn F 20°48′·63N 106°49′·09E 3 & 10 17 60 G 80682

Vietnamese Chart 50008 (RSDRA2019000300272) 2/20

Wk02/20 6.2
6.2
 VI
VI

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 120, CHINA, below E Jiao Lt Bn.

Insert:

EDD WM Wreck 24°22′·23N 118°10′·37E 994126308 Broadcasts every 3 minutes Virtual

Chinese Notice 48/1564/19 (RSDRA2019000299925) 2/20

PAGE 132, CHINA.

LBD 5 Wreck.
Delete entry

Chinese Notice 48/1556/19 (RSDRA2019000299925) 2/20

PAGE 150, CHINA, below Wei Long 36 Wreck.

Insert:

Wei Tou Wan Lt Buoy No 3 24°29′·63N 118°32′·75E 999412666 Broadcasts every 3 minutes Real

Chinese Notice 48/1561/19 (RSDRA2019000299925) 2/20

PAGE 156, CHINA, below Xuwei Ocean Station Warning Platform.

Insert:

XYYH 1528 Wreck 24°26′·12N 118°30′·63E 994126307 Broadcasts every 3 minutes Virtual

Chinese Notice 48/1562/19 (RSDRA2019000299925) 2/20

PAGE 220, VIETNAM, below Hōi Bāi Tide Gauge.

Insert:

Hon Dau Island Lt 20°39′·99N 106°48′·97E 574000003 Broadcasts every 10 minutes Real 21

Vietnamese Chart 50007 (RSDRA2019000300245) 2/20

VOLUME 3, NP283(1), 2020

Published Wk 50/19
(Last Updates: Weekly Edition No. 1 dated 02 January 2020)

RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS

PAGES 118 and 119, GERMAN VTS CENTRES, broadcast table, Emden, Ems Traffic row.
Delete row and replace by:

Westerems Lt buoy No 1, Riffgat Lt buoy and Osterems Lt buoy

to Lt buoy No 35 Ch 74
Ems Traffic Lt buoy No 35 to Lt buoy No 57 Ch 74 Every H+50
Lt buoy No 57 to Lt buoy No 86 Ch 74
Papenburg to Gandersum and the Leda Ch 15

BSH correspondence (RSDRA2019000300625) 2/20

6.3
6.3 Wk02/20
 VI
VI

PAGE 178, POLAND, below ŁAWICA SŁUPSKA VTS.

Insert:

POLISH RESCUE RADIO (SPL) [2934]

Control Centre: 54°32′·00N 18°32′·00E
2591 RT (MF) Ustka 54°35′·28N 16°51′·01E
Ch 05 Czołpino 54°43′·10N 17°14′·50E
Ch 61 Gąski 54°14′·60N 15°52′·40E
Ch 05 Gdańsk 54°22′·20N 18°46′·70E
Ch 62 Jarosławiec 54°32′·40N 16°32′·60E
Ch 05 Kikut 53°58′·90N 14°34′·80E
VHF
Ch 61 Krynica Morska 54°22′·90N 19°25′·30E
Ch 62 Niechorze 54°05′·70N 15°03′·90E
Ch 61 Police 53°33′·90N 14°35′·10E
Ch 62 Rozewie 54°49′·80N 18°20′·20E
Ch 61 Stilo 54°47′·20N 17°44′·00E
Weather 0135 0735 1335 1935 On
Weather and Sea Bulletins, in English and Polish.
Bulletins request
0133 0533 0933 1333 1733
Navigational Navigational Warnings for Polish coastal waters, in English and Polish.
2133 On request
Warnings
1035 1335 On request Ice reports in English and Polish.
NOTE(S): All broadcasts preceded by an announcement on VHF Ch 16 and 2182 kHz.

Polish Hydrographic Office correspondence (RSDRA2019000305554) 2/20

PAGE 180, POLAND.

WITOWO.
Delete entry

(former update 1/20)

Polish Hydrographic Office correspondence (RSDRA2019000301012) 2/20

VOLUME 5, NP285, 2019/20

Published Wk 28/19
(Last Updates: Weekly Edition No. 1 dated 02 January 2020)

VHF DSC, LIST OF COAST STATIONS FOR SEA AREA A1

PAGE 128, NAVAREA I, POLAND.

WITOWO.
Delete entry

(former update 1/20)

Polish Hydrographic Office correspondence (RSDRA2019000301012) 2/20

PAGE 128, NAVAREA I, POLAND.

Insert:

POLISH RESCUE RADIO 002618102

Remotely controlled stations:-
Czołpino 54°43′·10N 17°14′·50E 25
Gąski 54°14′·60N 15°52′·40E 23
Gdańsk 54°22′·20N 18°46′·70E 23
Jarosławiec 54°32′·40N 16°32′·60E 24
Kikut 53°58′·90N 14°34′·80E 29
Krynica Morska 54°22′·90N 19°25′·30E 24
Niechorze 54°05′·70N 15°03′·90E 25
Police 53°33′·90N 14°35′·10E 24
Rozewie 54°49′·80N 18°20′·20E 28
Stilo 54°47′·20N 17°44′·00E 29

Polish Hydrographic Office correspondence (RSDRA2019000305554) 2/20

Wk02/20 6.4
6.4
 VI
VI

MF DSC, LIST OF COAST STATIONS FOR SEA AREA A2

PAGE 157, NAVAREA I, POLAND.

WITOWO.
Delete entry

(former update 1/20)

Polish Hydrographic Office correspondence (RSDRA2019000301012) 2/20

PAGE 157, NAVAREA I, POLAND.

Insert:

POLISH RESCUE RADIO 002618102

Remotely controlled stations:- (Gdynia MRCC)
Ustka 54°35′·28N 16°51′·01E 150

Polish Hydrographic Office correspondence (RSDRA2019000305554) 2/20

DISTRESS, SEARCH AND RESCUE

PAGE 353, NAVAREA I.

POLAND.
Delete entry and replace by:

POLAND See diagram R2

National SAR Agency: Ministry of Maritime Economy and Inland Waterways, Maritime Economy Department
Address: Nowy Swiat 6/12 Str. Warsaw 00-400, Poland
Telephone: +48 22 5838570
Fax: +48 22 5838571
email: [email protected]
Website: www.mgm.gov.pl
The Polish Maritime Search and Rescue service is coordinated from MRCC Gdynia. Polish Rescue Radio (SPL) maintains a
continuous listening watch on international distress frequencies on MF and VHF DSC.
TeleMedical Assistance Service: Academical Centre for Maritime and Tropical Medicine, Powstania Styczniowego 9B Gdynia 81-519,
Poland
Tel: +48 58 6998460
email: [email protected]
Can also be contacted via MRCC Gdynia, Polish Rescue Radio Station or directly.
Telephone +48 Fax +48 Others/Ship Earth Stations (SES)
ARCC WARSAW (Cospas-Sarsat 22 5745190 22 5745199 AFTN: EPWWZQZX
SPOC)
22 5745191 EPWWYCYX
email: [email protected]
Polish MAS (Maritime Assistance 58 6216162 58 6205363 Mobile: +48 601 991331
Service) Centre VTS Gulf of Gdansk
58 6211443 58 6205328 Inmarsat: 764847029
58 6672727 600933290
58 6672728 email: [email protected]
MRCC GDYNIA 58 6610196 58 6607640 Mobile: +48 50 50 50 971
58 6610197 email: [email protected]
58 6205551 [email protected]
58 6216811
MRSC ŚWINOUJŚCIE 91 3214917 91 3216042 Mobile: +48 50 50 50 969
91 3215929 email: [email protected]
[email protected]
POLISH RESCUE RADIO (SPL) 58 3553670 58 6205363 email: [email protected]
58 6205328
VTS ZATOKA GDAŃSK - VTS 58 6216162 58 6205363 Inmarsat BGAN: 772265042
CENTRE
58 6211443 58 6205328 email: [email protected]
60 1991331 Website: www.umgdy.gov.pl
62 72727 MMSI: 002611400

(former update 1/20)

Polish Hydrographic Office correspondence (RSDRA2019000301012) 2/20

6.5
6.5 Wk02/20
 VI
VI
VOLUME 6, PART 2, NP 286(2), 2019/20 REPORTING:

Published Wk 21/19 It is mandatory for vessels to send the following reports:

(1) Sailing Plan (SP) (inward-bound from the German Bight): An SP must be
–––––––––––––––––– sent to VTS Centre Ems Traffic on VHF Ch 74 when approaching River Ems from the
N or E as follows:
(Last Updates: Weekly Edition No. 49 dated 5 December 2019)
(a) Crossing latitude 54°00′·00N
PAGE 146, GERMANY, EMS, diagram EMS VESSEL TRAFFIC (b) Crossing longitude through Lt buoy GW/TG (6°21′·35E)
SERVICE. (c) Crossing longitude through Lt buoy TG/B (7°00′·30E)
Delete legend “VTS Ems Traffic VHF Ch 21” in approximate position 53°20′·00N (2) The SP must contain the following information:
7°10′·00E and replace by “VTS Ems Traffic VHF Ch 74” ID Information Required
A Vessel’s name and call sign
WSA Emden 235(P)/19, (RSDRA2019000300625), 02/20
D Position
U Length (metres), beam (decimetres) and type
PAGE 146, GERMANY, EMS, diagram EMS VESSEL TRAFFIC
O Draught (decimetres)
SERVICE.
Delete legend “VTS Ems Traffic VHF Ch 18” in approximate position G Port of departure
53°40′·00N 6°40′·00E and replace by “VTS Ems Traffic VHF Ch 74” I Port of destination
Indication if liqueed gases, chemicals, or petroleum/petroleum products
WSA Emden 235(P)/19, (RSDRA2019000300625), 02/20 P are/were carried in bulk, and in case: type, quantity, UN number and if
tanks are not cleaned or if they are completely inerted
PAGE 146, GERMANY, EMS, diagram EMS VESSEL TRAFFIC Q Indication of deciencies, restrictions of manoeuvrability
SERVICE. T Names of the vessel’s owners or the latter’s agents
Delete legend “VTS Ems Traffic VHF Ch 20” in approximate position 53°30′·00N
7°00′·00E and replace by “VTS Ems Traffic VHF Ch 74” (3) Sailing Plan (SP) (in VTS Ems): An SP must be sent to VTS Centre Ems Traffic
VHF Ch 74 (if not already reported by SP inward-bound from the German Bight) as
follows:
WSA Emden 235(P)/19, (RSDRA2019000300625), 2/20
(a) Before entering the VTS area from the sea
(b) Before entering the VTS area from a harbour or berth within the VTS area
PAGES 147 to 149, GERMANY, EMS, Vessel Traffic Service. (c) To VTS Eemshaven on VHF Ch 01 before leaving Eemshaven (see
Delete and replace by: NETHERLANDS, DELFZIJL (NP286(1)) for additional information)
(d) To VTS Delfzijl on VHF Ch 03 before leaving Delfzijl (see NETHERLANDS,
DELFZIJL (NP286(1)) for additional information)
Vessel Traffic Service (4) The SP must contain the following information:
CONTACT DETAILS: ID Information Required
Call: Ems Traffic A Vessel’s name and call sign
VHF Channel: Ch 15 16 74
D Position
Telephone: +49(0)4927 1877281
+49(0)4927 1877282 U Length (metres), beam (decimetres) and type
Fax: +49(0)4927 1877287 O Draught (decimetres)
E-mail: [email protected]
G Port of departure
MMSI: 002113004
I Port of destination
HOURS: H24
Indication if liqueed gases, chemicals, or petroleum/petroleum products
PROCEDURE: P are/were carried in bulk, and in case: type, quantity, UN number and if
(1) This system is mandatory for the following: tanks are not cleaned or if they are completely inerted
(a) Inward-bound from the German Bight:
Q Indication of deciencies, restrictions of manoeuvrability
(i) Vessels of 40m LOA or more, including pushed or towed composite units
(ii) Vessels carrying dangerous goods in bulk (gas, chemicals, petroleum or T Names of the vessel’s owners or the latter’s agents
petroleum products)
(5) Position Report (PR): A PR must be sent to VTS Centre Ems Traffic on VHF Ch
(b) In VTS Ems area:
74 when entering the VTS area, when entering and leaving a harbour, lock, roadstead,
(i) Vessels of 40m LOA or more, including pushed or towed composite units
transhipment area or berth and when passing the Reporting Points.
(ii) Vessels carrying dangerous goods in bulk (gas, chemicals, petroleum or
(6) The PR must contain the following information:
petroleum products)
(iii) Nuclear powered vessels ID Information Required
(2) Vessels entering the VTS area must maintain a continuous listening watch on the A Vessel’s name and call sign
local VHF Channel of VTS Centre Ems Traffic (or on VHF Ch 16) as follows: B Passing time
Area VHF Channel
D Position
Lt buoy No 1 to Lt buoy No 35 (Westerems/Randzelgat) 74
F Speed
Buoy H1 to buoy No A5 (Hubertgat) 74
(7) Deviation Report (DR): A DR must be sent by vessels changing their Sailing
Buoy No A5 to Lt buoy No 35 (Alte Ems) 74
Plan (SP) e.g. when entering or leaving an anchorage.
Lt buoy No 35 to buoy No 57/Oterdum-Reede 74 (8) Incident Report (IR) (DG/HS/MP): An IR must be sent by all vessels when an
Buoy No 57/Oterdum-Reede to Lt buoy No 77 74 accident impairs safety or the environment. The IR must contain details of the incident
and in the case of a DG (Dangerous Goods Report), HS (Harmful Substances Report)
Lt buoy No 77 to Papenburg 15
or MP (Marine Pollutants Report) all data of the written pre-entry report.
continued on next column continued on next page

1
Wk02/20
6.6
 VI
VI
REPORTING POINTS: MARITIME ASSISTANCE SERVICE:
(1) Vessels should report when passing the following Reporting Points: (1) The VTS provides a Maritime Assistance Service as follows:
Reporting Points VHF Channel (a) In the event of an incident involving a vessel, the VTS will receive the reports,
consultations and notications
Lt buoy No 72 15 (b) If a report discloses an incident that may give rise to a situation where the
Papenburg 15 vessel is in need of assistance, the VTS will monitor the vessel’s situation
(2) The VTS will serve as the point of contact:
(2) Vessels should also report on the appropriate VHF Channel when they wish to use (a) Between the Master and the coastal state if the vessel’s situation requires
one of the following roadsteads: exchanges of information between the vessel and the coastal state other than
Roadstead VHF Channel a distress situation that could lead to a search and rescue operation
Emden Roads (Emden Reede) 74 (b) Between those involved in a marine salvage operation undertaken by private
facilities at the request of the company and the coastal state if the coastal state
Dry cargo Unloading Roads in Alte Ems 74
considers that it should monitor the conduct of the operation
Alte Ems Tanker Roads (Reede) 74
WSA Emden 235(P)/19, (RSDRA2019000300625), 2/20
Gas Tanker Roads (Reede) 74

(3) Other vessels may also use the Alte Ems Tankers Roads and the Gas Tanker ––––––––––––––––––––––––––––––
Roads with the prior permission of Emden Traffic Control, through Ems Traffic on VHF
VOLUME 6, PART 3, NP 286(3), 2019/20
Ch 74.
(4) Vessels over 50m LOA bound for Emskai or Emden Harbour, may navigate on the Published Wk 27/19
port side of the channel from Lt buoys Nos 68/69 as long as Ems Traffic Control is ––––––––––––––––––
informed immediately on VHF Ch 74.
(5) Exceptions to the right of way prohibition requires agreement by the Traffic Control (Last Updates: Weekly Edition No. 49 dated 5 December 2019)
on VHF Ch 74.
PAGE 385, TURKEY, ISKENDERUN KÖRFEZI, Pilots, PROCEDURE,
TANKERS ENTERING THE VTS AREA: section (2).
All tankers carrying gas, chemicals, petroleum or petroleum products and intending to Delete and replace by:
enter the VTS area must ensure the following:
(1) Radar and VHF radio in operational state. (2) Pilot boards in the following positions:
(2) Visibility more than 1000m. (a) 36°37′·20N 36°10′·00E (Iskenderun 1)
(3) Visibility between 500m and 1000m, only with permission of the VTS Centre. (b) 36°40′·70N 36°10′·50E (Iskenderun 2)
(c) 36°46′·50N 36°09′·60E (Iskenderun 3)
NAVIGATIONAL ASSISTANCE SERVICE:
(d) 36°48′·00N 36°05′·00E (Iskenderun 4)
(1) Provided on request or if instructed by the VTS Centre (in German or, in English on
(e) 36°52′·50N 35°58′·80E (Botaş 1)
request) on the appropriate VHF Channel for the areas stated in the table below.
Station Area VHF Channel
Turkish Notice 49/232/19, (RSDRA2019000300365), 2/20
16 and working
Ems Radar Whole of the Ems
Channels ––––––––––––––––––––––––––––––
Borkum Radar Lt buoy No 1 to Lt buoy No 35 18
VOLUME 6, PART 4, NP 286(4), 2019/20
Knock Radar Lt buoy No 35 to Lt buoy No 57 20
Published Wk 37/19
Lt buoy No 57 to Emden Hr
Wybelsum Radar 21 ––––––––––––––––––
entrance
(Last Updates: Weekly Edition No. 50 dated 12 December 2019)
(2) The service provides:
(a) Regular information, warnings and advice to individual vessels or shipping in PAGE 306, PHILIPPINES, above BASILAN STRAIT entry.
general to avoid dangers and to prevent accidents, or threats to the environment Insert new entry:
(b) Information about vessel’s position and surrounding traffic
(c) On-demand advice regarding course BANGAR, Luzon 16°53′N 120°24′E
(3) Requests should include vessel’s name, call sign and position for identication.
The service is provided as follows: Pilots
(a) When instructed by VTS Ems Traffic
(b) When visibility is less than 2000m PROCEDURE:
(c) When PV is in a sheltered position (1) Pilotage is compulsory for berthing for all vessels.
(d) When Lt buoys are withdrawn due to ice (2) Pilots are arranged via vessel’s agent.
(e) When required by traffic situation or when requested by a vessel (3) Pilot boards in position 16° 53′·07N 120° 22′·45E or as advised.

INFORMATION BROADCASTS: Port

(1) Ems Traffic broadcasts every H+50 on VHF Chs 15 and 74 (on VHF Ch 15 for CONTACT DETAILS:
Papenburg to Gandersum and die Leda) in German, or in English on request. VHF Channel: Ch 16
(2) The broadcast includes the following:
(a) Information relevant to the safe passage through the VTS area HOURS: HJ
(b) General fairway and traffic situation (e.g. weather conditions, casualties,
PROCEDURE:
dredging operations and Pilot information)
(1) Vessels are berthed during daylight hours only.
TRAFFIC REGULATION SERVICE: (2) Tug assistance is required for all vessels.
(1) The VTS provides regulatory measures to prevent accidents and/or threat to the
NOTE:
environment, and to control traffic ow.
Port is operated by SEAOIL Philippines Ltd.
(2) Such information will be promulgated by information, warning, advice or instructions
to vessels. H102 - MV Atlantic Rose, (RSDRA2019000297485), 2/20
continued on next coulumn
––––––––––––––––––––––––––––––

2
Wk02/20
6.7
 VI
VI
VOLUME 6, PART 6, NP 286(6), 2019/20
Published Wk 3/19

––––––––––––––––––
(Last Updates: Weekly Edition No. 1 dated 2 January 2020)

PAGE 102, CHINA, QINHUANGDAO, Vessel Traffic Service,

PROCEDURE, section (1), table.
Delete:

15 n miles from Nan Shan Vessel’s name, nationality,

Entering VTS Area
Tou Lt and intended navigation

and replace by:

19 n miles from Nan Shan Vessel’s name, nationality,

Entering VTS Area
Tou Lt and intended navigation

Chinese VTS Guide 2019, (RSDRA2019000295153), 2/20

––––––––––––––––––––––––––––––

3
Wk02/20
6.8
 VII

UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS

There are no updates to miscellaneous Nautical Publications this week

7.1
Wk02/20
 VIII

ADMIRALTY DIGITAL SERVICES

1. ENC / ECDIS and AVCS

a) Safety Notice

For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information. ECDIS Systems have been required to
use Presentation Library edition 4.0 since 1st September 2017 and previous editions are no longer SOLAS compliant.

b) ENCs temporarily withdrawn from AVCS

To review a cumulative list of ENCs temporarily withdrawn from AVCS, please visit the ‘Updates’ tab on:
admiralty.co.uk/AVCS

c) ENC Readme.txt file

The README.TXT file located within the ENC_ROOT folder on the latest AVCS discs contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the support tab at admiralty.co.uk/avcs.

This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.

d) Temporary & Preliminary Notices to Mariners (T&P NMs) in ENCs

The use of T&P NM information is considered an essential part of keeping navigational charts up to date.

The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs

ADMIRALTY Information Overlay (AIO) shows ADMIRALTY paper T&Ps where they are not already included in the ENCs. Most
countries now include temporary information in their ENCs.

Further guidance can be found in the INFO folder on AIO discs.

e) Important notice regarding AVCS CD Service

From WK14/19, AVCS is only available by download or on the weekly DVDs.

For more information, please contact your ADMIRALTY Chart Agent.

f) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)

The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.

Email calls to AVCS OUS will receive an auto-response that asks the customer to resubmit their data request online by http. Please
contact your ADMIRALTY Distributor if support is required for use of the http service.

Due to the technology updates at UKHO, the ARCS Online Updating Service was withdrawn in July 2019.

2. ADMIRALTY Products Supporting Digital Navigation

i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.
iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.

8.1
Wk 02/20
 VIII

v. ADMIRALTY Port Approach Guides. Information from a range of official ADMIRALTY charts and publications on one
chart, helping bridge crews to plan for particular approaches and to support Master Pilot Exchange. Expanding coverage of
some of the world's most complex approaches, including Antwerp, Rotterdam and the Panama Canal. More information is
available at admiralty.co.uk/port-approach-guides

3. ADMIRALTY Digital Publications (ADP)

ADP V19 is available on the ADP Weekly Update DVD.

The UKHO only supports ADP V18 and V19. Users of older versions of ADP should upgrade to a supported version at their earliest
convenience. ADP V18 and V19 are the only versions that allow users to receive tidal updates as they are made available.

ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT

The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.

For information: Please note that there will not be a 2020 ADP release.

Historically we have made new versions of the ADP software available in December of each year however, there will be no commercial
release of ADP this year. Previous versions have been released with yearly updates to tidal data and non-essential bug fixes however, as
tidal data is now updated weekly there is no need for us to release a new version of the software at this time.

The supported ADP versions continue to remain at V18 and V19.

The ADP software and the Data updates can still be downloaded from weekly ADP and AENP Update DVDs.

Users can also download ADP directly on the Distributors FTP Site at ftp://ukho.gov.uk

For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to [email protected]

4. Status of ADMIRALTY Digital Services

Update status table

Product Last issue date/Week Reissue Date/Week

i. ADMIRALTY Vector Chart Service (AVCS) Base CD download 05 December 2019 - 49
ii. ADMIRALTY Information Overlay (AIO) Base CD 04 October 2018 - 40
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 01 August 2019 - 31 23 January 2020 - 04
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 31 October 2019 - 44
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 12 September 2019 - 37
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 26 September 2019 - 39
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 12 December 2019 - 50
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 22 August 2019- 34 06 February 2020 - 06
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 18 July 2019 - 29 20 February 2020 - 08
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 17 October 2019 - 42
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 21 November 2019 - 47
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 23 May 2019 - 21
23 August 2018 – 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts

ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.

8.2
Wk 02/20
 VIII

5. Supported ADMIRALTY Software Versions

Product Supported Versions

ADP V18, V19
ADMIRALTY e-Reader 1.3
ADMIRALTY Planning Station 3.4
ADMIRALTY gateway 4.2, 4.4
NavPac and Compact Data 3.4, 4.0

If you are using an unsupported version, contact your Chart Agent to upgrade to the latest version as soon as possible.

8.3
Wk 02/20
 HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

Reporting Port Information affecting ADMIRALTY Products

NAME OF PORT

APPROXIMATE POSITION Latitude Longitude

GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.

Number of ships or tonnage handled per

year.

Maximum size of vessel handled.

Copy of Port Handbook (if available).

ANCHORAGES
Designation, depths, holding ground,
shelter afforded.

PILOTAGE
Authority for requests.

Embark position.

Regulations.

DIRECTIONS
Entry and berthing information.

Tidal streams.

Navigational aids.

TUGS
Number available.

WHARVES
Names, numbers or positions & lengths.

Depths alongside.

CARGO HANDLING
Containers, lighters, Ro-Ro etc.

REPAIRS
Hull, machinery and underwater.

Shipyards.

Docking or slipping facilities.

(Give size of vessels handled or
dimensions)

Divers.
 HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

RESCUE AND DISTRESS

Salvage, Lifeboat, Coastguard, etc.

SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)

Fresh water.
(with method of delivery and rate of
supply)

Provisions.

SERVICES
Medical.

Ship Sanitation.

Garbage and slops.

Ship chandlery, tank cleaning, compass

adjustment, hull painting.

COMMUNICATIONS
Nearest airport or airfield.

Port radio and information service. (with

frequencies and hours of operating)

PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.

VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.

ADDITIONAL DETAILS

NOTES:

1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.

2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
 HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
 HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.

2. Objective of GNSS Data Collection

The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.

It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.

It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.

3. Details required

a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.

b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).

c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.

d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
 Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services

For emergency information affecting safety of life at sea forward to: [email protected]
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: [email protected]
This form H.102 and instructions are available online: admiralty.co.uk/msi

Date Ref. number

Name of ship or sender IMO number
Address and general locality

E-mail / Tel / Fax of sender

Subject

Position
Latitude Longitude
(see Instruction 2)

GPS Datum Accuracy

ADMIRALTY Charts affected Edition

Latest Weekly Edition of

Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected

Latest update disk applied Week:

Make, model and or age of ECDIS if

applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:

Name of observer / reporter

H.102A submitted Yes No H.102B submitted Yes No

Tick box if not willing to be named as source of this information

Alternatively use our H-Note App located here:

admiralty.co.uk/H-note