Timothy Daly - 21st Century Playwriting, A Manual of Contemporary Techniques-Smith & Kraus (2019)
Timothy Daly - 21st Century Playwriting, A Manual of Contemporary Techniques-Smith & Kraus (2019)
Timothy Daly
21ST CENTURY PLAYWRITING
Timothy Daly
ISBN: 9781575259222
Library of Congress Control Number: 2017959939
Dawson Moore
Coordinator, Valdez Last Frontier Theatre Conference
11
,ඇඍඋඈൽඎർඍංඈඇ
A PORTRAIT OF THE YOUNG MAN AS AN ARTIST
or How I got to the writing of this book.
This book has been over a decade in the making. It didn’t start out
that way. In fact, it didn’t even start out as a book. It was an attempt to
VDYHP\FUHDWLYHHPRWLRQDODQG¿QDQFLDOOLIH
To explain that, I’ll have to go back a bit.
I was not born into a theatrical family. Very few people are. My
family was not particularly interested in theatre or the creative arts. My
own theatre career began when, in my mid-twenties, I decided that I was
DZULWHU1RVXGGHQEUHDNWKURXJK1RIDOOLQJR൵DKRUVHRQWKHURDGWR
Ephesus. I just woke up one morning and decided that I wanted to express
P\ZRUOGLQZRUGVUDWKHUWKDQPXVLF,ZDVDPXVLFLDQ¿UVWDQGWUDLQHG
professionally in music.)
After having beginner’s luck in writing a one-act play that was pro-
duced by Sydney Theatre Company, one of Australia’s most prestigious
theatres, I then entered the World of Writer’s Reality, where every new
play makes you a beginner again. This is doubly true when you really
are a beginner in writing. I struggled for several years, desperately trying
to maintain a relationship, income and to master the nebulous art of the
full-length play.
In the early 1990s, after years of trying to please theatre audiences
and the gate-keepers of modern theatre—the Artistic Directors—I decided
WRKDYHRQHODVWÀLQJDWWKHDWUHZULWLQJ%\ZULWLQJDSOD\WKDWZDVIXOORI
the things that had made me want to plunge my life into theatre—a play
full of chaos, pain, magic, hope, enchantment and virtuosity. Instead of
pleasing others, I decided to ‘delight myself’, as a friend advised me. I
wrote a play based on the bizarre attempt by my literary hero, Franz Kafka,
WRPDUU\WKHVDPHZRPDQ²WZLFH,¿OOHGLWZLWKZRUGSOD\WKHDWULFDO
devices, schtick, big speeches and fun. It was my ideal theatre. I was also
convinced that it would never be performed, being so unlike Australian
theatre of the time. After asking several people, “Would you go and see a
play called Franz Kafka Learns to Tap-Dance?”, and watching their eyes
glaze over, I settled on the simpler title: Kafka Dances.
Almost immediately, a miracle occurred: a theatre director called Ros
Horin, who ran a small theatre company in Sydney, Australia, had read
the script (I’d sent just one copy out), and despite the chaos of the play
(or perhaps because of it) Ros thought there was a play buried somewhere
inside it.
12 7ංආඈඍඁඒ'ൺඅඒ
&ඁൺඉඍൾඋ
WRITING FOR THE 21st CENTURY
Modernist New Wave. But there will be more. For it’s not only the wily
French that American playwrights have to fear. The British theatre indus-
try, while largely closed to outsiders (including American playwrights),
KDVDORQJKLVWRU\RIVHOOLQJVKRZVWR%URDGZD\DQG2൵%URDGZD\,Q
addition, the government-subsidized nature of British theatre (funded
VLJQL¿FDQWO\E\WKH8.ORWWHU\HDUQLQJVPDNHVWKHSOD\LQJ¿HOGPRUH
uneven than American writers realise. The international success of War
Horse in 2011 is a case in point: it grew out of a funded system of script and
VKRZGHYHORSPHQWZKRVH¿QDQFLDOEDFNLQJZRXOGPDNHPRVW$PHULFDQ
theatres weep with envy. Just as U.S. airlines are facing unprecedented
competition from oil-rich government-backed airlines, the international
competition for the American theatre market has never been stronger.
Once, it would have been enough for a young American playwright to
move to New York, where an exciting and viable career would await. But
the post-World War II New York theatre no longer exists. An actor playing
a character in a new play opening in New York would have needed a local
New York accent. That was because the plays that once opened in New
York were all about New York, its life and its people, whether that play was
a serious drama by Arthur Miller, or a light, skilful comedy by Neil Simon.
But that type of inward-looking New York theatre no longer exists. At its
highest levels, the New York theatre has become a sales clearing-house,
a type of ‘national marketplace for theatrical sales’, where plays from all
over the world are played to increasingly international audiences. Increas-
ingly, it doesn’t matter that the play or the playwright be American. A type
RIµLQWHUQDWLRQDOVW\OH¶RISOD\LVHPHUJLQJZKLFKLVSDUWO\LQÀXHQFHGE\
other national styles—French, German, British among them.
It’s at this point that the third issue confronting the on-going health
of American theatre has to be raised. It concerns the comparatively old-
fashioned theatre principles that govern the teaching of theatre craft in
the USA. I’ve seen enough American theatre, play workshops and theatre
conferences to realise that while the craft of the new ‘international’ con-
temporary playwriting has advanced, its teaching to a new generation of
American playwrights has not. No disrespect is intended here. It’s hard
to surpass the genuine love of theatre that the average American writing
professor, dramaturg or director has. But it is also true that there are not
enough practising and internationally successful playwrights working in
SRVLWLRQVRILQÀXHQFHWRPDNHDGL൵HUHQFHDQGWKHUHE\KHOSWREULQJWKH
teaching of contemporary American theatre craft into the 21st century.
There are honorable exceptions, of course, like Yale University, but fac-
ulties packed with internationally successful playwrights are much more
rare than they should be.
For all these reasons, the American playwright must come to terms
21st Century Playwriting 17
with the fact that he or she is less protected from international competi-
tion than ever before. Only the “regional factor” (where, for example, an
Atlanta theatre company tries to give priority to local Atlanta playwrights)
softens this harsh reality. Regional protection, however, is increasingly
LQH൵HFWLYHLQWRGD\¶VPRUHFRPPHUFLDOO\PLQGHGJRYHUQPHQWEDFNHG
star-driven and internationally-focussed theatre world. To paraphrase the
sign on the door of the Writers’ Hut at Warner Brothers’ studio, it’s not
enough to be American; you have to work around here.
Do you want to succeed nationally and internationally? Personally,
I’ve yet to meet an American playwright who does not want national and
international success. But many have no idea how to make this happen.
Writers always want to speak to as many readers or audience as possible.
By nature, we have a burning desire to communicate.
That’s what this book is all about: giving you the skills to compete
both nationally and internationally. The German poet Christian Morgen-
stern said, “Home is where you are understood”. Wherever your plays
are produced and loved, that is Home. And who said you couldn’t have
more than one home? I’ve had much success in France; just as much, in
fact, as in my birthplace, Australia. Do I care? Where would you rather
be produced? Paris or Pittsburgh? Why not in both places?
See this book as a primer for ‘how to write in such a way that national
and international success may follow’. Personally, I’d rather fail grandly
than succeed modestly. If you are excited by having a larger audience than
you currently have, then read on.
With all that said, it’s time to jump into the deep end of the pool, and
start to get a handle on the aesthetic background that operates in contem-
porary theatre. Much of what follows in this chapter will feel like a rapid
Cultural Studies program. This can’t be helped. If you already know all
that follows in the rest of the chapter, you can skip it. If you don’t, you
should just take the rest of this chapter in bite-sized portions, for it will
probably take some time to absorb; and the rest of the book beckons. But
gradually a strong sense of what I’m getting at will emerge. This book
doesn’t have to be read in any particular order. Let your creative instincts
guide you as to what’s important to learn next.
(POST)MODERNISM Vs HUMANISM
All over the world, and for many years, a Cold War has been raging
LQWKHDWUHWKHRU\DQGSUDFWLVH,WLVQRWFRQ¿QHGWR$PHULFD%ULWDLQRU
(XURSH,WLVDZRUOGZLGHSKHQRPHQRQ,WÀDUHVXSUHJXODUO\LQDQ\RI
the following ways: a hatred of what is (wrongly) called ‘linear plot’; a
disdain for text-based theatre; a ghettoising of performance theatre, and
18 7ංආඈඍඁඒ'ൺඅඒ
The one-time New York Times theatre critic Rex Reed said that “The
basis of criticism is comparison.” So, consider the following scene, from
the early moments of a play published in 1998:
1RZORRNDWWKHIROORZLQJVFHQHIURPDGL൵HUHQWSOD\,QWKHH[FHUSW
below, Diana has invited some friends round to meet an old friend from
WKHLUVWXGHQW\HDUV(YHO\QZKRP'LDQDKDVQHYHUPHWWXUQVXS¿UVW
Diana admires Evelyn’s infant baby:
More small talk ensues, before Diana gets to what is really troubling her:
DIANA: No, there are times when I think that’s the principal
trouble between Paul and me. I mean, I know now I’m
running myself down but Paul, basically, he’s got much
more go…
And on she rambles, until the doorbell rings, and more friends arrive.
PHILOSOPHY
,QLWVµDHVWKHWLFSKLORVRSK\¶PRGHUQLVPLVQRWVSHFL¿FDOO\UHOLJLRXV
rather, it is post-religious. It shares the same opportunity for largeness
of conception that the sceptical western mind feels now that it has been
‘freed’ from religious constrictions. But this freedom—like most things
in modernism—is not especially new. King Lear has some of the same
‘Man Vs Universe’ outlook and tone. For Shakespeare, the setting of this
play in a pre-Christian era provided much of the freedom of outlook that
post-Christian writers now feel.
The aesthetic philosophy of humanism, on the other hand, tends to
EHPRUHLQGLYLGXDORULHQWHG,WGRHVQRWDVSLUHWRDVSHFL¿FDOO\UHOLJLRXV
conception (far less an overtly Christian one) but the notion of God (even
if symbolised by authority, order or ‘the moral hierarchy’) is embedded in
its cosmology. But this is not an easy cosmology (any more than modern-
ism is). One of the chief preoccupations of humanist writing is the tortured
place of the individual in the scheme of things: the individual pitted against
his/her society (like Ibsen’s An Enemy of the People); or the relationship
that obsessively examines itself (like David Williamson’s The Perfectionist
or many Ayckbourn plays) in the middle of a changing society. Sometimes,
however, the individual relationship is content simply to look at itself.
(A ‘love story’ is usually just that: a decontextualised self-examination,
with society as little more than a backdrop to the main romantic event.)
INFLUENCES
FORMS
0RGHUQLVPLVDVPXFKLQÀXHQFHGE\GDQFHDVE\WKHWUDGLWLRQDOWKHDWUH
it often rejects, and so it is no surprise that many modernist pieces end up
as ‘performance theatre’ (a silly term, considering all theatre is meant to
be performed). A host of performance types emerge: installations, hybrid
artforms, especially using new technology, dance-cum-theatre work. A
variety of ‘relationships to text’ results: no text, use of text in quite for-
malist ways, a ‘sharing of theatre space’ between image and spoken word
(instead of the latter’s dominance, as with humanist writing.)
The text-based humanist theatre still has, as its basic aesthetic out-
come, a ‘play’; that is, a work that is ‘driven by text’, usually involving
WKHQDUUDWLYHFUHDWLRQRID¿FWLRQDOZRUOGZKHUHWKHDXGLHQFHFDQµORVH
LWVHOI¶LQDYLFDULRXVUHODWLRQVKLSWRWKDW¿FWLRQDOZRUOG,¶OOKDYHDORW
more to say on the notion of vicarious writing in Chapter 13.) Characters
are created who have a strong relationship to the social world we live in.
They have a personal psychology that is, ideally, rich and complex—
KHQFHWKHREVHVVLRQERWKLQKXPDQLVWWKHDWUHDQGPDLQVWUHDP¿OPZLWK
character motivation and ‘plausibility’ of character actions. Causality is a
crucial aspect of this writing (that is, ‘because of A event, she now does B
action’), whereas events in modernist theatre are rarely so neatly causal.
STRUCTURES
Modernist theatre has little time for what it calls ‘linear writing’
(though I will argue in Chapter 18 that there is no such thing). It prefers
the cyclic, the episodic or alternating forms that, in spirit, are very close
to the rigorous and profound formal enquiries of such great musicians and
theatre writers as Beethoven and Wagner. There is often a concentration
on the small, the tiny, the slowed-down, the enormously-expanded. This
IUHHGRPFRPHVIURPDGL൵HUHQWUHODWLRQVKLSWRtime. Because time is not
21st Century Playwriting 23
channelled through the powerful medium of ‘story’, it is freed up to be
used in a variety of ways—slowed down, sped up, re-iterated or reviewed
(almost like a theme-and-variations). This is not to imply that there is no
interest in narrative ordering. Most of the modernist theatre that I have
seen has a very strong interest in beginning, middle and end, but—as
Godard said—not necessarily in that order.
The structures of humanist writing are closely bound to the unravel-
ling of character through story—which is their strength and their weak-
ness. (See below). The segmenting of story into centuries-old phases (for
example, status quo, disturbance, major action etc) is extensively covered
in this book, but like all craft principles, they must be at the service of the
work itself, and should be used to the extent that they serve the unique
vision that your work is trying to impart.
LANGUAGE
FORMATIVE MATERIAL
RELATIONSHIP TO AUDIENCE
*HQHUDOLVDWLRQEHFRPHVGL൶FXOWKHUHEXWLQVRPHYHU\URXJKPHD-
sure, modernist writing seeks to provoke, to challenge or to engage its
DXGLHQFH RQ D GL൵HUHQW OHYHO WKDQ MXVW µHQWHUWDLQLQJ VWRU\WHOOLQJ¶7KH
great modernist texts—Strindberg’s Dream Play, Brecht’s best work and
much of Beckett—are questioning their own nature at the same time as
they are unfolding their structure and meanings to an audience.
Thus there is an ‘interrogative’ (self)-questioning thrust to the best
modernist writing; it seeks to analyze, to take old, tired motifs or stories,
and re-synthesise or re-invent them.
+XPDQLVWWKHDWUHE\DQGODUJHVHHNVWRHVWDEOLVK¿FWLRQDOZRUOGV
which the audience can ‘identify with’ (that is, place itself emotionally,
socially or imaginatively inside the world of the story) and then ‘go on
a journey’. There is nothing wrong with this—apart from it being an
incomplete exploration of ‘what can be done with/to a theatre audience’.
The problem is that even the best humanist theatre—Strindberg, Chekhov,
Ibsen, Miller etc—whilst astonishingly formally innovative for those
times, has come down to us now as a tract in how to live, love and build
the great society. The role of theatre in being an ‘aesthetic form interested
in its own form’ has been overlooked.
)LQDOO\,¶GOLNHWRR൵HUDWKRXJKWRQWKHQDWXUHRIWKLVERRNDQGKRZ
to get the most from it. This is a ‘How to write contemporary theatre’ book,
¿OOHGZLWKSUDFWLFDOZULWLQJSULQFLSOHVDQGXVDEOHGUDPDWLFWHFKQLTXHV<RX
should start anywhere \RXOLNHLQWKHERRNHVSHFLDOO\LI\RX¿QGRQHRI
the ‘Gateways’ indicated in the Chapter Contents more immediately use-
ful than others. Some playwrights will feel a need to understand dramatic
structure more thoroughly. (In which case, you should go through Gateway
ZKHUHLQ,PRGHVWO\EHOLHYH\RX¶OO¿QGPDQ\WKLQJVWKDWQRRWKHUERRN
on playwriting covers.) Others might feel a need to gain mastery in theatre
language and dialogue, in which case Gateway 5 holds the chapters you
could start with. But the more chapters you read, the more the circle of
understanding will be completed.
So let me state what the book is not. It’s not an academic survey of
‘modern theatre’. It’s not a personal manifesto on “Why I, Timothy Daly,
21st Century Playwriting 27
need to write plays.” (However I think you can assume that a deep love of
the medium is my main motivation.) Anything more would be between me
and my therapist—if I had one. Thus there’ll be no passages on “Why You
Should Be A Writer”, or “My Deepest Longings for Art and Life, Written
While Sipping a Macchiato in Greenwich Village.” I love the technical
challenges of writing for theatre and so do you, or you wouldn’t be reading
this book. So if your mother hated you, you feel deeply inadequate, your
VHFRQGPDUULDJHEURNHXSDQG\RXPLVV\RXU¿UVWWR\FDOOHG%RER²LI
any of these apply to you, please accept my sympathy. They may be part
of the complex motivations pushing you toward writing theatre, but this
book is pre-occupied with turning a ‘desire to write plays’ into a solidly-
based technical ability to write plays. To put it another way, the book
is all about turning the Literary Dreamer—and I’ve met thousands of
those—into the Dramatic Technician. I’ve only met a few of those. It’s a
small club. I invite you to join it.
29
&ඁൺඉඍൾඋ
QUICK START: OR “WHY AREN’T YOU HOME WRITING?”
The most startling and courageous lecture on play writing was de-
livered many years ago. Its lecturer/hero was an American to be awarded
The Nobel Prize for literature, Sinclair Lewis, who when confronted with
a hall full of would-be writers said only one thing: “Why aren’t you home
writing?” He then left the podium.
6RIRUWKRVHZKRGLGQ¶WXQGHUVWDQGWKH¿UVWFKDSWHU²RUZKRVLPSO\
GRQ¶WFDUH²,R൵HUWKLVQH[WFKDSWHU,W¶VDQLPSDWLHQWDJHZHOLYHLQ(Y-
erything has a ‘Quick Start’ manual. But such was the case over twenty
years ago when I started writing. I had no use for theories. All I wanted
was The Plan: How To Write A Fabulous Play.
If you’re reading this book and you’ve not written before, you’re
most probably reading it because you’re itching to write. You won’t be
ready to write, but that’s not the point. I wasn’t ‘ready’. Who is? It’s only
in writing—a lot—that one achieves any competence, and thus becomes
ready—to write some more.
Ignoring the subtleties and aesthetic complexities of the previous
chapter (which you should only revisit when you’ve had enough of The
Joy of Writing Blind), I’ll show you an approach (even a Plan?) that throws
you straight into the experience of theatre writing.
Here are four ‘play types’ that you can use to get you writing
quickly—and with reasonable results. From years of working with
writers, I found that many plays that seemed to work well— regard-
less of the talent or background of the writers— fell into the following
four categories.
Over the years, I’ve met, seen, read and worked on perhaps hun-
GUHGVRISOD\VWKDWUHJDUGOHVVRIWKHLUGL൵HUHQWSORWVKDGWKHVDPHEDVLF
scenario as I’ve just outlined. Why does this type of play work so well?
Many reasons: it combines the humanist interest in ‘how people behave’
with a big-picture modernism that dares to speak about life, the state of
30 7ංආඈඍඁඒ'ൺඅඒ
the world, or future dystopias. Perhaps the play type is both attractive (to
writers) and successful (with audiences) because it embodies a deeply
symbolic human state: waiting, that state of half-life we all experience
whether we’re waiting for death, God, Godot or just the bus.
But even on the level of story, such a play type allows for big and
clear dramatic stakes. That is, something important is going on, or about
to happen which matters to the humans in the room because something
vital and precious can be won or lost. And when dramatic stakes are in-
volved, the psychological desperation seems to release in writers a ‘go
for broke’ attitude which often brings out the best in them, especially
regarding their use of language. Faced with this no-holds-barred premise,
a writer gets daring/experimental/innovative in his/her use of language.
The writing is focussed because this situation allows ‘only the essential’.
No chat; no ‘How’s your father’ or ‘Did you hear what happened to So-
SKLHWRGD\¶2QO\WKHODQJXDJHWKDWH[SUHVVHVWKHVLWXDWLRQVHHPVWR¿W
Maxim Gorky’s The Lower Depths, Samuel Beckett’s Waiting For Godot,
Jean-Paul Sartre’s Huis Clos and Eugene O’Neill’s The Iceman Cometh
show the variety—and beauty—of this play type.
3HUKDSVWKLVSOD\W\SHVXFFHHGVEHFDXVHLWGLYHVKHDG¿UVWLQWRWKDW
complex, fascinating, bewildering, painful and passionate area—human
relationships. I deal with the concept of the Relationship Journey in Chap-
ter 18, but if you’ve already turned the laptop on, then all you’ll probably
want to know is that this play type is an excuse to ‘unleash’ (physically,
verbally) everything you’ve bottled up about love, hatred, desire, longing
and other people. Not to mention the Other, the one who no longer loves
you, the one you still love to the point of sickness. The plays which work
best tend either to have lots of short scenes where with every scene, the
relationship has changed and developed; or, alternately, the long scenes
DUHEURRGLQJGHHSO\IHOWDQGFUHDWHJUHDWDUFVRILQWLPDF\VX൵HULQJDQG
release. In other words, the characters in this play type tend to get closer
to each other than ‘people in real life’—but isn’t that the chief pleasure
of such stories? Again, just like the Life as a Waiting Room scenario,
WKH WZRKHDGHU WZR DFWRUV W\SH LV LPPHQVHO\ ÀH[LEOH DOORZLQJ ERWK
light, joyful social comedy and darker, more painful work. John Patrick
21st Century Playwriting 31
Shanley’s Danny and the Deep Blue Sea is a good example of the latter.
That’s my Dad. He’s not like any other Dad. This Dad’s insane.
And to prove it, they had me, his youngest daughter.
Many new writers are young. They are driven to write because, to
them, life is a maze of mysteries they don’t understand. It’s not only them-
selves they don’t understand. It’s ‘Other People.’ And the most infuriating
group of ‘Others’ is often the people they are closest to: friends and family.
The chief joy of this third ‘quick’ play type is the direct access an audi-
ence is given into the emotions, rituals and madness of a group of people
who otherwise would remain strangers to us. And the chief tour-guide
to this Mad, Mad World is the Narrator. He guides the audience into the
family/social group, introduces us to the inmates of this movable asylum
and sets up a story which shows that, beyond the apparent ‘madness’ of
the social and emotional world the family or group lives in, is a pattern of
life surprisingly close to our own. The audience both laughs at the bizarre
happenings and thinks, “That’s pretty close to how my family/group/clan/
gang acts.” And like the others, this type allows both for mad comedy and
darker work. Louis Nowra’s Summer of the Aliens is an example of this
type, as is Brian Friel’s Dancing at Lughnasa.
‘driving the events’ (that is, causing the plot to happen) or because the
events all seem to be happening to him or her.
It’s also possible to state, however crudely, a general plan for the
unfolding of this dramatic action. It goes something like this…
The Protagonist is ‘born’ into a World (a suburb, kingdom) that he or
she is not happy with. For convenience, let’s call this Protagonist by the
name of Richard. He lives with this unsatisfactory state of events for some
time (whether hours, months or years). But eventually, something happens
to disturb that World. Forced by his unhappiness at this Disturbance (or
encouraged by the opportunity), the Protagonist responds to the changed
circumstances. He states a goal or Dramatic Objective:
A Plan.
The Plan involves thinking about what he will do, and then carrying
it out. It involves lying to other people, cheating them, seducing them,
and ultimately, killing them. But always it involves interacting with them.
With each step of the Plan, there may be—
Of all the four types discussed in this Quick Start chapter, this fourth
play type most resembles the ‘traditional theatre’ we’ve come to know.
That is its attraction—and its trap. The Plan seems simple, but it’s not.
,¶YHVHHQPRUHEDGZRUNLQ¿OPDQGWKHDWUHLQYROYLQJWKLVSOD\W\SH
than with all the other three types combined. In other words, use this play
type at your peril, or simply stop writing and read the rest of this book.
As I’ve tried to indicate, there are limits to a Quick Start approach—and
we’ve just reached them.
35
&ඁൺඉඍൾඋ
SLOW START: DEVELOPING THE SKILLS YOU’LL NEED
+DYLQJUHDGWKH¿UVWFKDSWHU\RXPD\KDYHEHHQZRQGHULQJ³+RZ
should I write?” Having read the second chapter the answer should be
obvious: you write exactly the way you want to. You obey the impulses
of the moment, your sense of ‘what the play needs’. You also will be
responding to your own developing aesthetic.
A playwright’s ‘personal aesthetic’ is a complex and subjective thing.
)LUVWOHW¶VGH¿QHZKDWDQµDHVWKHWLF¶LV$QDHVWKHWLFLV¿UVWDWKHRU\RI
beauty, and second, a conscious set of creative principles as well as an
intuitive feel for the sort of drama you wish to create. Your aesthetic is
both personal (resulting from your own life, beliefs and artistic responses)
and communal (resulting from society’s impact on you and your art.)
I should say this—if it’s not already obvious— I will not be urging
you to write a certain way. I won’t be preaching just one school of thought
DW\RX$VWKH¿UVWFKDSWHUH[SODLQHGWKLVERRNLVFRQFHUQHGZLWKVKRZLQJ
you how you can create your own personal synthesis of the two dominant
aesthetics of our age—the humanist and the modernist. It is up to you how
that blend occurs. As far as possible, I will also refrain from pointing out,
like an irritating tour-guide, “This is a modernist technique”, “On your left
is an interesting humanist convention.” Your job, as a creative artist, is to
forget the label and respond viscerally to the imaginative potential of a
technique or concept, regardless of its historical or ideological provenance.
Put simply, there will be things that you, the creative artist, can use,
and some you can’t. There will be ideas you like, and some you don’t. If I
have one advantage in writing this book it is that I am basically self-taught,
which means that in my early years of learning, I welcomed everything
that might be useful. Nothing was excluded ‘on principle’. Similarly, you
should feel free to use creatively what you personally respond to.
Labels and historical analysis aside, the aesthetic that is developed in this
book is all about using the stage as an agent of communication about human
beings and the lives they lead. Or to put it more forcefully, it’s not just about
communicating, but communicating so powerfully, that theatre becomes an act
of mesmerism, a magic act—a carnival full of tricks and sleights of hand and
virtuosic diversions. But above all, I will be advocating that you, the writer,
aim high. Set out to astonish, and amaze, and move and shock profoundly.
Be brilliant. Push your actors to near-breaking point. Dazzle, disturb and prod
our often-lazy audiences way past their usual and familiar zones of comfort
and ease. I will be encouraging you to go for broke, to court failure by aiming
high, because it is often the only way to succeed.
36 7ංආඈඍඁඒ'ൺඅඒ
You’re a writer when you say you are. You’re a writer when you buy
the laptop. You’re a writer long before others tell you so. This chapter is
all about how to prepare yourself to write plays. In preparation, you’ll
¿QGWKDW\RX¶YHDOUHDG\EHJXQ
The greatest writing tool is your own mind. Many of the ideas in
this chapter are about the training of your own mind, so that you learn to
think dramatically.
Before you can train yourself to write plays, you need to know what
those skills are that you are acquiring. Don’t misunderstand this, however.
I’m not saying that you should go away and acquire these skills and then
come back and write plays. It is in starting to write immediately that you
ZLOOERWKGHYHORSWKHVNLOOVDQGUHDOLVHKRZPXFK\RXFDQEHQH¿WIURP
such a conscious and deliberate acquiring of these skills.
1. A LOVE OF THEATRE
This may seem an odd skill to have to ‘acquire’. Usually people fall
LQORYHDW¿UVWVLJKWRUWZHQWLHWK6RPHWKLQJPDNHVWKHPIDOOR൵WKHWUHHRI
reason and land in the mud of passionate involvement with theatre. It may
be an extraordinary play, an amazing performance that stayed in your head,
or simply the profound experience of seeing a community of strangers in
WKHDXGLHQFHPRPHQWDULO\XQLWHGE\WKHPHVPHULFH൵HFWRID6KDNHVSHDUHDQ
ending. Whatever it is that makes you love theatre and plays is probably the
reason you want to write them. Often there is a desire to duplicate the original
astonishing experience. If there is no ‘astonishing experience’, then you may
care to ask yourself why you actually want to write plays. It may be that the
H൵HFWRIWKHDWUHDQGSOD\VRQ\RXLVOHVVHOHFWULFEXWMXVWDVGHHSO\IHOW
In any case, test it. Go to plays, and see if it moves and excites you to be
in a theatre space. If it does, or if the idea will not leave you alone, it’s probably
not a passing thing, and you may as well acquire the remaining skills in this list.
2. A KNOWLEDGE OF AUDIENCE
$VSOD\ZULJKWVZHPD\ZULWHWKHSOD\VDQGFHUWDLQO\ZHDUHWKH¿UVW
audience for our work, but essentially, a play is an act of communication
with strangers. It’s drawn from a single imagination, but it is meant to
reach the hearts, minds and inner lives of people you’ve never met, but
who share one thing in common with you: they are human beings.
21st Century Playwriting 37
TABLE 1: A SUMMARY OF SKILLS YOU WILL NEED FOR
PLAY WRITING
7ඁൾඌංඅඅ ൺඇൽ ඌඈආൾ ඐൺඒඌ ඒඈඎ ർൺඇ
ൽൾඏൾඅඈඉංඍ
The desire to create theatrical/spatial Understand how the creation of exotic
‘magic’ yet universal Worlds helps make a play
magical. (See Chapter 23)
An understanding of theatre space When you’re at a play, watch the actors’
PRYHPHQWVDQGWKHLUH൵HFWLQWKHDWUHVSDFH
A knowledge of human psychology Both books and your own developing
understanding of people and their lives
will help you here
A hunger for amazing stories Consciously collect stories and examine
their patterns
A capacity & willingness to feel and cre- See Chapter 5 on the F-Buttons
ate characters who also feel
A deep & detailed knowledge of narrative, See Chapters 20-25
scene, act & phase structure
An ability to write & rewrite scenes over Read out your scenes aloud, or have ‘out
& over again loud’ workshops of your scenes
A love of language... Enjoy words and keep developing your
vocabulary and verbal articulateness
...& a detailed knowledge of realist See Chapters 10-13
dialogue techniques
...& a willingness to experiment with See the sections on "Performative States"
‘linguistic formalism’ as well as Chapter 12
A knowledge of audiences & a respect When you see a play, also study the
for them audience's reaction to various moments
A comic impulse Comedy can and should be practised.
Keep looking for the comic potential of
all your scenes
A comprehensive theatre aesthetic, (in- Read widely, and enjoy other arts like
cluding a decision on where you stand music, sculpture and painting. See also
on these aesthetic questions) Chapter 1 of this book for more ideas
A love of the ‘theatre game’and showbiz Spend time in theatre foyers, talking to ac-
tors, listening and questioning all and sundry
...and a knowledge of the ‘real politik’ of Develop a feel and even enjoyment of
the theatre business. professional networking. (See Chapter 29)
A non-ulcerous ambition to succeed... Be organised and know ‘What the next
step is’, and treat it like a delightful game
...& a sense of fun, play & creative joy Remember that it’s only a (wonderful)
part of your life
38 7ංආඈඍඁඒ'ൺඅඒ
But when human beings get together, they are not simply a clump
of individuals. They become one of the mobs that history calls an ‘audi-
ence’. Knowing what makes an audience tick, what puts them to sleep,
what keeps them awake, what fascinates them or repels them is our job as
playwrights. I devote a whole chapter to this, so all I’ll say at this point is
that the only way to get to know how plays are working on their audiences
is to go to the theatre and see lots of plays.
This is not as obvious as it might sound. You’d be amazed at the people
who never listen to radio drama but think they can write a radio play. A
short story writer I met once advised me: “Read hundreds of them.” For
SOD\ZULJKWVRXUWDVNLVFOHDU6HHDKXQGUHGSOD\V7DNHWZR\HDUVRU¿YH
to do so, but do it. And when you go to these plays, keep one eye (so to
speak) on the play, and one eye on what the play is doing to its audience.
<RXGRQ¶WMXVWJRWRDSOD\WRVHHLWVH൵HFWRQDQDXGLHQFH<RXDOVRJR
to see what the play is really doing, and what it’s really about. By ‘about’
I don’t mean what the story is really about. I mean, what deep aspects of
the human psyche are being dealt with tonight. You see, the truth is that
people don’t just go to a play to be entertained. They go for many reasons,
of which the deepest—or highest—is to learn about themselves and their
RZQLQYROYHPHQWLQWKHPHVV\D൵DLUFDOOHGOLIH7KHWUXHPDWHULDORISOD\V
is not ‘story’, but ‘humanity’. To know humanity you must ultimately have
a view of humanity, but before you have a view, and regardless of your
aesthetic inclinations, you will want to acquire some basic knowledge of
human psychology, individual and group.
How do you do this? Lots of ways. First, you live your own life to
the full. You examine it, and become aware of its nature, contradictions,
logic and illogic. You study other people’s lives, people you know as well
as those you can only read about. Develop an interest in ‘what makes
that guy tick?’ Speculate. Create an inner life for your neighbour. Watch
people and make observations about the way they may live, based on the
way they walk, talk or buy food. Read as much as possible about psychol-
ogy— normal and abnormal. Be as expert on the tortured inner life of a
VHULDONLOOHUDVWKDWRIDPXQGDQHR൶FHZRUNHU7KH\DUHERWKKXPDQ
WKH\PD\HYHQKDYHVRPHWKLQJVLQFRPPRQ7KHSD\R൵IRUWKLVVRUWRI
study should be obvious: You’ll eventually have powerful insights to of-
fer to people in your stories. And you may just understand yourself well
enough to be happy, and even save the occasional relationship or two.
Don’t misunderstand this point: you’ll still need to develop strong
actions for your characters—but what you learn from studying character
21st Century Playwriting 39
and characterization may provide the soul from which these dramatic
actions spring.
4. VIRTUOSITY IN LANGUAGE
This is obviously related to the last skill, but it’s also a development
of it. As playwrights we need to have a very strong sense of such things
as plot order, the building of incidents and dramatic momentum. Believe
it or not, dramatic instinct can be trained. Here are two ways:
Read as many plays as possible, acting out the play in your mind.
But most importantly, read each act in a play without interruption.
In a good play, Act I or Act II is a masterfully shaped whole,
and the only way to experience the whole is by reading each
DFWZLWKRXWVWRSSLQJ$IWHUDZKLOH\RXZLOONQRZWKHGL൵HU-
ence between those writers who can shape an act so that it is a
powerful, visceral and unstoppable experience—and those who
can’t. To save you time, I’ll give you a short list of dramatists
with a wonderful sense of form and act structure: Ibsen, Mamet
in his better plays, early Stoppard plays, the best work of Arthur
Miller, some Caryl Churchill plays, much Beckett (the shorter
pieces are masterly in their feeling for form), and, best of all,
Shakespeare. (No one can match him for his visceral unloosing
of theatrical energy; to understand what I mean, read the Forum
scene in Julius Caesar where ‘the dogs of war” are let loose.)
There are many writers, of course, from whom you can learn
this ‘feeling for formal rightness’, but if you start with the ones
I’ve mentioned, you’ll soon develop the instinct that you’ll need
for your own work.
$V , VDLG LQ WKH ¿UVW FKDSWHU , GRQ¶W UHDOO\ FDUH ZK\ \RX ZDQW WR
write. That’s your business. The job of this book is to help you say what
you want to, regardless of what that is. That said, however, your task as
a playwright is to become unique. The world doesn’t need a second Sam
Shepard, or another disciple of Harold Pinter. Your only hope is to become
more like yourself, in style, in the unique way you see the world, and in
the way you express that unique vision.
Occasionally people will tell you that “you need to develop your own
voice.” This is unhelpful advice, not least because those advising you usu-
ally have no idea as to how you should go about getting this “unique voice”.
/HWPHR൵HUVRPHWKRXJKWVRQWKLV9HU\IHZZULWHUVLQWKHLUHDUO\
years of writing have a particularly unique voice. Just as with opera sing-
ers, a ‘voice’ needs development. Before you can have something to say,
you need to know how to say it. And the reverse is also true. But to help
you along the path of discovering who you really are, creatively speaking,
try some of these practical steps:
Start developing your own philosophy about the way the world
runs. Use any belief, ideology, prejudice or personal passion
that speaks loudly to you. One of your values as a playwright
42 7ංආඈඍඁඒ'ൺඅඒ
will be a strong sense that audiences get from your work: “This
is how s/he sees the world. I may not agree with it, but it makes
for astonishing theatre.”
$IWHUDIHZPRQWKVRIFOLSSLQJDQG¿OLQJVWDUWDVNLQJ\RXUVHOI
ZKDWW\SHVRIVWRULHV\RX¶UHUHVSRQGLQJWR<RXPD\¿QGFHU-
tain themes common to them. For example, I’ve always been
interested in stories of people who lacked courage at the crucial
PRPHQWRUZKRSRVVHVVHGQRQHLQWKH¿UVWSODFHWKHµE\VWDQGHU¶
phenomenon. One day I found a story in a newspaper about
Kitty Genovese, a woman who was murdered outside a New
York apartment, and the neighbours all heard the screams, but
GLGQRWKLQJ6KHFULHGIRUKHOSIRUDORQJWLPHDQG¿QDOO\GLHG
No one helped her. No one even called the police. Others closed
their windows to shut out the sounds which may have been dis-
turbing their television viewing. This preoccupied me for some
years until I became a father. My love for my child created an
anxiety: “What if I lost her?” I wound this basic human anxiety
around the larger plot structure and theme of ‘the bystander’,
and suddenly found I had a strong, moving story which became
an award-winning radio play.
What does all this have to do with developing a voice? All the pre-
paratory groundwork I’ve listed above will give you both a great aware-
ness of your artistic preoccupations and thematic concerns, and also
will eventually equip you to express these preoccupations skilfully and
21st Century Playwriting 43
powerfully. And if you never develop a uniqueness of dramatic style? No
PDWWHU0DQ\VXFFHVVIXOSOD\ZULJKWVWHOHYLVLRQDQG¿OPZULWHUVKDYHQR
particular originality. They’re often just excellent craftsmen. They know
how to write a comedy, a farce or a thriller. They know what they’re good
DWDQGOLNHGRLQJLW,Q\RXUFDVH¿QGZKDW\RXOLNHGRLQJDQGVWXG\LW
and leave the development of a “unique voice” to time and circumstances.
be gestured, the line is un-actable. That is, when you are speak-
ing a line, unless you can feel an impulse to gesture (with arms,
head, trunk) there is little chance that the line is sayable by an
actor. Actors respond to the in-built rhythm of a line of dialogue.
They respond to the physical energy implicit in each line and each
phrase. Unless you get your voice and body moving in engaging
with great text, you won’t learn this art of ‘the physicalised text’.
You won’t learn the acting instinct either, unless you do some
acting. The end-result may be that you write stage language that
is lifeless because you ‘heard’ it exclusively inside your head.
That’s all right for novel and other prose forms, but not for theatre.
Good theatre language has to be heard and felt in the writer’s
body before it can be felt in the actor’s.
A writer has the proper equipment. This might mean that you make
a small investment and buy the computer and other writing tools that you
need to really do the job properly. There is specialised software for theatre
DQG¿OPZULWHUVWKDWPDNHVWKHMREDORWHDVLHU9LVLWDVSHFLDOLVHGWKHDWUH
RU¿OPVWRUH6FULSWVDQGVFULSWZULWLQJVRIWZDUHDUHDOVRREWDLQDEOHRQWKH
web. So don’t allow poor or non-existent tools to be the reason that you
don’t start writing. Don’t scratch away on a pad unless that’s the way that
\RXULPDJLQDWLRQJHWV¿UHGXS2QO\\RXNQRZZKDWHTXLSPHQW\RXQHHG
Take a chance. Hire it, buy it or borrow it. It needn’t cost a lot. Find the
equipment you need to write your play. Until you do, your desire to write
plays may only be a pipe dream.
45
&ඁൺඉඍൾඋ
BECOMING A STORYTELLER
µ6XSSRVH \RX¶UH LQ \RXU R৽FH <RX¶YH EHHQ ¿JKWLQJ GXHOV RU
ZULWLQJDOOGD\DQG\RX¶UHWRRWLUHGWR¿JKWRUZULWHDQ\PRUH
You’re sitting there staring—dull, like we all get sometimes. A
pretty stenographer that you’ve seen before comes into the room
and you watch her—idly. She doesn’t see you, though you’re
YHU\FORVHWRKHU6KHWDNHVRৼKHUJORYHVRSHQVKHUSXUVHDQG
dumps it on a table— ’
Stahr paused. He picked up his keys and put them in his pocket.
We all know that movies are like theatre—and they’re not. But what
WKHDWUHDQG¿OPKDYHLQFRPPRQLVDORYHRIVWRU\WHOOLQJ1RWHYHQSRVW
modernism’s arch ambivalence about ‘grand narratives’ can take away the
fascination that all of us have with narrative. It’s the key to our uncon-
scious. A story is both real and dream-like. It seems like fact and that it is
really happening, but everything also seems symbolic, even blurred, as if
reality has been shown to be just a surface layer, and there is something
else bubbling underneath...
It is my strong contention that stories are both wonderful things
in themselves—and they are also an ‘excuse’. An excuse to release the
‘something else bubbling underneath’. I spend a lot of time in Chapter
20 discussing how structure is the shaping of energy. But the energy is
¿UVWUHOHDVHGE\WKHHUXSWLRQRIDKXPDQQDUUDWLYH3HRSOHZDWFKSHRSOH
Action creates curiosity. Intention creates energy, and when that energy
is shaped, a play results.
%XW¿UVWFRPHVWKHVWRU\UHJDUGOHVVRIZKLFKDHVWKHWLFKXPDQLVWRU
modernist) the playwright comes from. Take this recent example of bravura
story telling, which mixes modernist brashness with a breathtaking speed
and economy of story telling.
Imagine this happening to you: You’re at home, after a hard day
at work. The doorbell rings. You open the door—and there’s a woman
standing there.
ROMY: Twenty-four years ago this man was the love of my life.
(Pause)
We were lovers then.
(Pause)
And we still are now.
(Pause)
CLAUDIA: What?
ROMY: Him and me—we were lovers then and we still are now.
Claudia slaps her husband’s face and slams the door in front of Romy
Vogländer.
This play, Die Frau von Früher (The Woman From the Past) by Ro-
land Schimmelpfennig, presses so many F-buttons simultaneously that the
audience is exhilarated, confused and taken somewhere both familiar and
VWUDQJH²DOODWWKHVDPHWLPH(YHQEHIRUHZHJHWWR&KDSWHU,¶OOEULHÀ\
list here the F-Buttons and how they work in this wonderful opening scene.
There is the F-Button of Familiarity. The audience thinks, “Oh, yes, I
get it. Just before dinner. Frank relaxing. Drink in hand. I do that regularly
myself.” The Familiarity Button is an underestimated level of audience
connection. It helps establish an initial level of understanding for the
audience. But the important thing is to move on from this level to other
F-levels—which, in this play, happens almost immediately.
There is the F-Button of Feelings. When a woman tells you, “You
were the love of my life”, she is obviously dealing with the level of human
feelings and emotions. When a stranger says this—we are dealing with fear.
The F-Button of Fear is a potent factor for the audience. Imagine
this happening to you! Your worst nightmare—a former lover turning
up; and just before dinner! I’ve seen this scene acted, and it’s so scary
and tense that the audience both laughs and worries at the same time. (i.e.
two F-buttons at once, Fear and Fun.) There is also the F-Button of Social
Frisson, which is pressed whenever strangers meet. Finally, there is the
F-Button of Fury, when Claudia, Frank’s wife, hears about this woman
IRUWKH¿UVWWLPH6KHVODSV)UDQN²WZLFH
Like I said; stories are wonderful. And this play has only just started.
In the next chapter, I have a lot more to say on the F-Buttons. But for
now, it’s time for another story. Imagine this. A young girl, about thirteen
years old, arrives at the house of a language teacher. She is let in by the
maid. “I’ll tell him you’re here”, the maid says, and leaves.
The girl is left alone. She gets an exercise book out of her school
bag and some pens. She waits for a moment, looking around the room
48 7ංආඈඍඁඒ'ൺඅඒ
before settling into that potentially endless state known to all students as
‘waiting for the teacher to arrive’.
A minute later the teacher arrives. He surprises us: he is not a domi-
QHHULQJ¿JXUH+HLVWLPLGDOPRVWSDLQIXOO\VK\+HJUHHWVWKHJLUODQGWKH\
sit down to begin the lesson. He is a model of politeness and friendliness.
He apologises profusely for having kept her waiting. She demurs, but he
will hear none of it. He kept her waiting. It is his fault.
Watching this we—the unseen observers of this fantasy—are very
impressed. He’s a very kind man, though a little fussy. She’s lucky to have
this man for a teacher. He is sure to be thorough and conscientious. With
this man as her teacher, she will pass the exam she is intending to sit for.
He begins a preliminary assessment of the state of her knowledge. But
he’s interrupted. The maid comes into the room, looking for something.
The teacher tries to continue, but the maid’s presence is disturbing him.
He asks her to leave. But before she does, she advises the teacher, “May
I suggest you not start with mathematics? It tires you.”
We are surprised that the teacher’s maid would say this. So is the
WHDFKHU +H LV ULJKWO\ D OLWWOH LQGLJQDQW 7KH LQWHUIHULQJ PDLG ¿QDOO\
leaves, the teacher apologises to his student for the interruption and their
ZRUNFDQ¿QDOO\EHJLQ
7KHWHDFKHUWKHQDSSURDFKHVWKHVXEMHFWIURPDGL൵HUHQWDQJOH
:HDUHÀDEEHUJDVWHG:KDWLVWKLVOHDGLQJWR":KHUHGLGWKDWFRPH
from? It’s clear that the atmosphere of this lesson has changed.
$QGWKHQWKHJLUODQVZHUVTXLFNDVDÀDVK
XVHRIODQJXDJH+LVWRULFDOO\LW¶VWKH¿UVWFRQWHPSRUDU\XVHRIµODQJXDJH
as a weapon’, and predates Pinter’s use of it by many years.) You can see
this play in Paris any time, as it’s run continuously for decades, a bit like
Agatha Christie’s The Mousetrap. But unlike Dame Agatha’s play, it’s a
dangerous, volatile piece that gets under the audience’s skin, and turns
XVLQWRIDVFLQDWHGDQGKRUUL¿HGRQORRNHUVZKRIHHOFRPSOLFLWLQWKHDFW
of watching. Suddenly the whole idea of being a ‘theatre audience’ takes
on a less neutral, passive meaning.
It doesn’t just make the audience feel uncomfortable. It transforms
reality. After seeing this play, I doubt an audience will ever view a private
lesson in quite the same way again. Why? Because reality has been af-
fected. It’s been interpreted, massaged, pummelled, lifted out of banality
and given a big shock. Our job as imaginative writers is to give reality a
big shake-down, to so confront it that the audience not only sees ‘reality’
in a new light, but also sees far beyond it.
You might think that this is the result of clever plotting? It is much
more due to language. From the moment the teacher begins his impos-
VLEOHHTXDWLRQ³WKUHHELOOLRQVHYHQKXQGUHGDQG¿IW\¿YHPLOOLRQQLQH
hundred and eighty-eight thousand”, the story has become something
else. And that something else is theatre. What was a mundane, everyday
WUDQVDFWLRQKDVµOLIWHGR൵¶RQWRDQRWKHUSODQH$QGLW¶VWDNHQXVWKHDXGL-
ence, along for the ride.
When the audience attends a performance of The Lesson, they are
not just in the grip of mesmerising dramatic language. They are also in
the grip of a structure. And the way that structure grips you is by being
framed in the familiar social metaphor of ‘recognisable story’. I’ll return
WRWKHFUXFLDODUHDRIKRZ\RXPXVWXVHODQJXDJHWRDFKLHYHµOLIWR൵¶LQWR
WKHVXSHUUHDOSODQHRQZKLFKWKHDWUHH[LVWVEXW¿UVWZH¶OOH[DPLQHWKH
social animals watching: the audience.
51
&ඁൺඉඍൾඋ
81'(567$1',1*7+($8',(1&(,+,77,1*7+()%877216
$1'27+(5%$6,&7(&+1,48(6
+HUH¶VDVKRFNLQJWKRXJKW<RXGRQ¶WDFWXDOO\ZULWHSOD\VIRU\RXUVHOI
<RXZULWHWKHPIRUWRWDOVWUDQJHUVZKRVHRQO\OLQNWR\RXLVWKDWWKH\
XVXDOO\OLYHLQWKHVDPHVRFLHW\DV\RXGR7KHFUHDWLRQRIDULFKSRZHUIXO
SOD\LVWKHXOWLPDWHJLIWDVXSUHPHFLYLOLVLQJDFWDNLQWRRSHQLQJDGRRU
IRUDVWUDQJHUEXWWHQWLPHVDVLPSRUWDQWDVWKDWVLPSOHDFWRIFLYLOLW\2XU
MREDVSOD\ZULJKWVLVWRRSHQWKHGRRURIDQDXGLHQFH¶VLPDJLQDWLRQ²DQG
OHDYHLWDMDU+RZ\RXDFFRPSOLVKWKDWLVWKHVXEMHFWRIWKLVFKDSWHU
'RHVLWPDWWHUZKDWSHRSOHWKLQN",VLWPRUHLPSRUWDQWVLPSO\WRZULWH
WKH SOD\ \RX ZDQW UHJDUGOHVV RI DQ DXGLHQFH¶V FXOWXUDORU LPDJLQDWLYH
SUHIHUHQFHV"7KHDQVZHULVDFRPSOH[RQH6RPHZULWHUVFDQEHDUWLVWLFDOO\
GHVWUR\HGE\OLVWHQLQJWRRPXFKWRDSHUFHLYHGDXGLHQFH¶VSUHIHUHQFHV)RU
RWKHUZULWHUVLWPD\EHWKH¿UVWWKLQJWKH\QHHGWRGR3HUVRQDOO\,KDYH
EHHQDVNLQJSHRSOHIRU\HDUVMXVWZKDWLWLVWKDWWKH\ZDQWIURPDQLJKWDW
WKHWKHDWUH,WGRHVQ¶WPHDQWKDW,WDLORUP\SOD\VWR¿WWKHVHH[SHFWDWLRQV
,VLPSO\OLNHWRNQRZZKHUHSHRSOHDUHFRPLQJIURPDQGWKHQJLYHWKHP
PXFKmoreWKDQWKH\WKRXJKWWKH\ZDQWHG
,QRQHVHQVHDQDXGLHQFHGRHVQ¶WKDYHDFOXHZKDWLWZDQWV,WRIWHQ
NQRZV ZKHQ LW¶V EHHQ VKRUWFKDQJHG EXW LQ WKH PDLQ$PHULFDQ DXGL
HQFHVDUHYHU\RSHQ7KH\¶GSUHIHUWKHLUWKHDWUHWREHIDEXORXVEXWZLOO
RIWHQVHWWOHIRUOHVV$1HZ<RUNIULHQG,VSHDNWRUHJXODUO\FRQVLGHUVWKDW
$PHULFDQDXGLHQFHVDUHµWRRNLQG¶,IWKDWLVWUXHWKH\VKRXOGQ¶WKDYH
WREH%HLQJLQDWKHDWUHDXGLHQFHVKRXOGEHDQDPD]LQJRYHUZKHOPLQJ
H[SHULHQFHQRWRQHUHTXLULQJNLQGQHVV
:KHWKHUWHDFKLQJZULWHUVRUVSHDNLQJWRDXGLHQFHV,KDYHVRPHWLPHV
SXWWRWKHPDJHQHUDOTXHVWLRQ³:KDWGR\RXUHDOO\ZDQWIURPWKHDWUH"´
7KHDQVZHUVDUHPDQ\DQGYDULHGEXWWKHLUYDULHW\VLPSO\UHLQIRUFHVDEDVLF
WUXWKWKDWLQDQLGHDOHYHQLQJDWWKHWKHDWUHDQDXGLHQFHZDQWVeverything.
µ(YHU\WKLQJ¶LVXVXDOO\H[SUHVVHGLQDQ\RIWKHIROORZLQJWKLUW\WZR
ZD\V)URP\HDUVRIWDONLQJWRDXGLHQFHVDVZHOODVZULWLQJSOD\VIRU
WKHP,TXRWHEHORZVRPHUHSUHVHQWDWLYHDXGLHQFHRSLQLRQVIROORZHGE\
VRPHVXJJHVWLRQVDVWRKRZWRVDWLVI\WKDWH[SHFWDWLRQ
“I want to be challenged.”
,I\RXZDQWWRFKDOOHQJHDQDXGLHQFHGRVRLQDQ\RIWKHIROORZLQJ
ZD\VPDNHWKHLGHDVRIWKHSOD\PRUHSURYRFDWLYH0DNHWKHLGHDVPRUH
52 7ංආඈඍඁඒ'ൺඅඒ
than truisms or motherhood statements. If all the play is saying is, “People
should be kind to each other”, then why bother writing it? In fact, I’d be
more fascinated by a play that proposed, say, “the best thing that lovers
can be is insanely cruel to each other.” Hearing that, I’d want to know why.
There are lots of other challenges an audience can respond to and
enjoy: in the speed of the writing, in the many levels that a character can
exist on: the physical, the sexual, the sensual, the emotional, the intellec-
tual etc. A character that is in touch with several of these levels will speak
from those depths and provide a challenging complexity for the audience.
This is not simply a matter of ensuring that the actor speaks more
loudly! The problem of inaudibility may be built into the writing. For
example, have you made both the character and the language so ‘tiny’ that
it’s better suited to TV than theatre? Are there no large emotions in your
21st Century Playwriting 53
characters? Is there a downward direction to your theatrical language?
(See Chapters 10 and 11 on dramatic language.) Have you made your
theatrical language so “realistic” that its very ordinariness makes for
small, unexciting, arrhythmic lines that can only be played small? Are
the characters just too dull?
What insights are you giving into human life and experience in the
play you are writing? Are you saying the obvious? Is your research so
VXSHU¿FLDOWKDWWKHUHLVQRWKLQJLQ\RXUSOD\WKDWFRXOGQRWEHOHDUQHGIURP
the average newspaper article? Where is the fact, the insight, the percep-
tion that few in the audience have ever read, heard, spoken or thought of
before? Is the ‘emotional research’ deep enough or thought-through (that
is, how a human being in that situation would respond)? What is the big
idea in your play? What are the big themes (love, revenge, passion, duty,
jealousy etc) that will not let go of you, and therefore the characters will
also not let go of?
“I want to be shocked.”
What shocked you in the writing of this play? What moved you?
What excited you? What made you cry out loud? What made you laugh
so much that you embarrassed yourself in a public place? If none of these
things happened, something may be wrong. My own experience is that if
,ZDVQRWODXJKLQJFU\LQJKRUUL¿HGDWDSDUWLFXODUVSRWLQWKHZULWLQJRID
play, then the eventual audience wasn’t either.
You might think this audience wish is a problem for the stage designer
WRVROYH7KLVLVODUJHO\WUXHEXW\RX¿UVWQHHGWRFUHDWHDVWDJHVSDFH
which has movement built into it (in the rhythms of your language, or
in the energy and physicality of the characters’ responses to each other.)
If there’s no inner life to the play, all the stage designer can do is create
impressive stage pictures in the hope that the audience will not notice that
there is no life to the play beneath its surface.
You’ve got two big choices here: the exotic and the familiar. You can
create a world that makes an audience think, “I’ve never seen this world
before.” The obvious way to do that is to set it in a place which actually is
quite exotic and foreign to its intended audience. To a Nevada audience, a
Parisian café is exotic. To a Parisian audience, Nevada is exotic. I’ve seen
or read wonderful (and occasionally bad) plays that were set on the moon,
the top of Mount Everest, the bottom of the Rhine River and other unusual
locales. But there’s another option: the familiar. Setting a play in a social/
physical location very familiar to the audience is tantamount to saying,
“Watch this space: I’m about to show you how strange your ‘familiar’ world
really is.” Your writing and its insights will suddenly make the audience see
their own world with new eyes. That, too, is exciting playwriting.
This is partly ‘the vicarious’ problem again. But it’s also asking you
WR¿QGZKDWLVZRUU\LQJ\RXDQG\RXUVRFLHW\QRZDWWKLVSRLQWLQLWVKLV-
tory. An older writer friend once suggested, to a young writer who asked
him “What is there to write about?” He said, “Find what the community
is most ashamed about, and write about that.” This is a variation on the
idea that an audience actually likes to worry when it goes to the theatre.
An audience likes to have its ‘hopes and fears’ buttons pressed. So decide,
quite early in the writing, what fear, anxiety, fantasy, hope or shame you
are thematically exploring, and then go in hard, pushing your characters,
story and theme to the limit.
“I want to laugh.”
A play is not just ‘a story told in the theatre’. Its narrative pattern
has an inbuilt form that is itself a statement about life and the universe.
The world in which a story is set is just as important as the story itself. A
director once told me that, more than anything, he asks of a playwright
that he or she “create a world”. What makes up this world is crucial. Is the
world benign? Is it malevolent? Is it godless? Is it narcissistic? In other
words, a story and its world is the excuse for a meditation on spiritual
and philosophical values. Remember that Western theatre came initially
from a volatile and shifting relationship with religion. The best theatre
still has something big to say about the deepest issues. Your job is not
necessarily to provide people with easy (or even clear) answers. Just show
them how complex the question is. Their hearts and minds will take the
question away and wrestle with it, dream about it, and brood on it. Show
them what’s incomplete, enigmatic and mysterious about life by imbuing
the dramatic world and your characters with those features.
know already.” After several days of pain, I realised she had taught
me a valuable lesson. A good play is an experience of shock for
the audience. They sit there and think, “My God, I never realised that!”
The shock might be informational (facts, insights and connections they
didn’t know or hadn’t made for themselves); emotional (a relationship
pushed way past the point of safety); social (posing a tough question to
a society reluctant to think about the answer); or philosophical (asking a
big question about life). You’ve got two choices: you either go broad or
deep. ‘Broad’ is where you read widely on an area, so that what you have
to say cannot be read in the average daily newspaper. ‘Deep’ is where
you think through the implications of an idea so that everyUDPL¿FDWLRQ
(however terrible) is made possible in your story.
“I want to be entertained.”
(QWHUWDLQLQJDQDXGLHQFHLVDVWKH¿OPGLUHFWRU-DQH&DPSLRQRQFH
said, a way of making people forget where they are for two hours.
Nothing wrong with that, though theatre has other higher, more exciting
and deeper roles to perform. They can also be mesmerised, lulled, made
WRZRUU\EHKRUUL¿HGGHOLJKWHGRUWHDVHG6HWRXWWRJLYHWKHDXGLHQFH
an experience that will demand the best of them, and they’ll soon forget
about the valid but highly comfortable desire just to be entertained. They’ll
be too absorbed in the world of your play to ask themselves such an
obvious question.
the character, the larger, deeper and more complex should be the range of
emotions that the character has access to. As a writer, you need to create
characters who are much more spontaneous than you probably are. I’ve
noticed that writers, compared to actors (and people generally) tend to be
less emotionally responsive, and less spontaneous and direct in the com-
munication of those emotions. It’s the down-side of being a writer. We
‘ferment’ stories, characters and ideas inside us, but sometimes they don’t
come out properly distilled; they’re just pickled from too much brooding
and introversion. And worst of all, it creates a habit of being constantly
complicated in our responses to many things (life, love, people). Some-
times simple (but powerful) is better, in life and literature.
An odd request, you might think. But historically, drama has always
been a multimedia event, full of sound, light, colour, costume and fury.
It’s only recently, with the advent of the well-behaved, middle-class
‘theatre of discussion’ (most prominent in the British theatre until recent
times) that we’ve got used to a ‘drier’ type of theatrical experience: a bit
RIVRXQGPRGHUDWHO\ULFKOLJKWLQJH൵HFWV«%XWZKDWHOVH"7KHLGHDORI
theatre is when its verbal richness is combined with the plastic physicality
of dance, mixed with the ceremonialism and visceral power of opera, and
given the transcendence of music, only to be brought back to earth by the
spontaneity of stand-up comedy, and then braced by the ritual uncertainty
and fear of blood sports. The ancient Greek theatre was closer to a Broad-
way musical than the talk-talk of much theatre today. The implications
DUHFOHDU¿OO\RXUSOD\ZLWKORWVRIPXVLFOLJKWVRXQGIXQIHDUIXU\
spookiness, weirdness, changes of pace, dashes of surprise and dollops
of outright perverseness.
7KLVRQH¶VVLPSOH\RX¶UHWKHUHWRVKRZR൵:ULWH\RXUSOD\VZLWKDW
least half the self-conscious cleverness that most other entertainers (pop
singers, footballers, self-help gurus and TV evangelists) take for granted.
This doesn’t mean that you should strain to be clever. Work at being subtle,
swift, dazzlingly ironic, verbally dexterous—and all for a higher cause
WKDQVHOIJUDWL¿FDWLRQ7KLVLVHDVLO\GRQHOHW\RXUFKDUDFWHUVGRWKHZRUN
Let them be wittier, cleverer, more intuitive, more emotionally powerful
than you ever are in real life—even if, on some other level (emotional,
social) they’re rather stupid.
21st Century Playwriting 59
“I want to see a play with issues that linger after the play’s over.”
Put simply, a play that lingers does so because it has not provided
answers so much as rich, paradoxical questions. I’ve already discussed this
idea, but mention it again because there’s another angle to this: the topical. A
contemporary political or social issue that is topical, burning and extremely
GL൶FXOWWRVROYHPLJKWZHOOPDNHDJRRGSOD\EXWGRQ¶WJHWWUDSSHGLQWR
the idea that plays must always be about important political or social issues
of the moment. A year goes by, and your play may be as stale as a week-
old doughnut. A debate doth not a play make. If you can debate the issues,
it could be that it’s better left as a debate (or a documentary) than a play.
:H¶UHQRWZULWLQJWKHDWUHWREHDWDPHSOD\WKLQJRIWKHERUHGEXWD൷X-
ent. We need to take on the toughest areas and give the audience the feeling
of exhilaration that comes from knowing it’s in dangerous and uncharted
territory. “Uncharted” is a key word here. Our job is to enter new territory,
narrative and thematic; to create the age rather than just retrospectively
UHÀHFWLW7KHFRPSRVHU.DUOKHLQ]6WRFNKDXVHQRQFHKHDUGWKDWKLVIHOORZ
composer John Cage was exploring a particular area of electro-acoustic
sound. He immediately cancelled his own projects in that area. I wish we
theatre writers had such a rigorous integrity (or vanity). It would mean far
fewer plays on tired or over-explored areas. The taboos are particularly dif-
¿FXOWLQWKLVUHJDUG,QFHVWIRUH[DPSOH,WZDVµQHZ¶SROLWLFDOO\VRFLDOO\
thirty or more years ago.
Satisfying this wish is easy: where are the ensemble scenes in your
play? Where are the rituals (social, religious, political, personal, emotional
or psychological) whose disruption makes for great theatre? (Look at all
21st Century Playwriting 61
the disrupted rituals in fairy tales and Shakespeare: weddings that go
wrong; banquets with uninvited guests, interrupted masques and other
volatile rituals). What about a scene or two set at night? (Film thinks like
this, but it’s amazing how few plays have a sense of day/night about them.
³0DJLF´ LV D KDUG WKLQJ WR GH¿QH EXW \RX NQRZ LW ZKHQ \RX VHH
it—and I make another attempt in Chapter 29, in my discussion on those
American plays which succeed internationally. There is literal use of magic
LQ6KDNHVSHDUHDQGPRGHUQ¿OPVZKLFKEULQJVPHWRDVNZK\WKHDWUH
writers—with the honourable exception of some Irish playwrights—are so
reticent to use the occult, the esoteric or ‘other’ when our age has probably
never been so open to it? We’ve probably never been as Jacobean as now,
where the horrors of the last century have bred an audience that relishes
a taste for the monstrous.) But magic can be gentler, too. Shakespearean
magic comes from a feeling that we, the audience, are being given a
privileged access to the inner life, most particularly the rich, sophisticated
inner lives of Shakespeare’s major characters. We can aspire to the same,
by remembering that drama is the unleashing of the characters’ inner lives,
and the story is just the key that opened the door. In theatre, as we’ll see in
the chapters on story, ‘story’ is a means, not an end. There might also be
magic, however, in the world that you’ve created. In all dramatic ‘worlds’
there is usually a dominant tone: a yearning for the past, a hope for the
future, an obsession with loss. Tennessee Williams and Chekhov are the
masters in creating such worlds.
It’s often said by the deep thinkers in our newspapers that we are
‘change weary’. But change is natural and mostly good. When an audience
asks to be ‘changed’ it is expressing the hope that, tonight of all nights,
they’ll see the best play they’ve ever seen, the one play that made up for
all the other nights of disappointment. Change is built into our very notion
RIµVWRU\¶$PHULFDQ¿OPDQGPXFKWKHDWUHDUHSUHGLFDWHGRQWKHQRWLRQRI
moral questioning, transformation and redemption. It’s a seductive formula,
though not all writers believe in it. An Arthur Miller certainly does, but not
so a David Mamet. You should decide your own relationship to the notion
RIFKDQJH'RSHRSOHFKDQJH"'R\RXFKDQJH":KDWH൵HFWGRHVLWKDYHRQ
your story? In writing your play are you trying to change your audience?
,¶YHQRWWULHGWRFHQVRUGH¿QHRUVPDUWHQXSWKHFRPPHQWVDERYH
They are typical of how audiences tend to feel.
62 7ංආඈඍඁඒ'ൺඅඒ
When I started writing plays, I had no idea what I was doing. I simply
wrote. Or to put it another way, I wrote simply. To me, it was wonderful.
But to others...
21st Century Playwriting 63
It took a while before I realised that the unconscious can be con-
sciously ‘stoked’ with aspects that the writing needs to deliver in order to
create rich, multi-layered theatre stories. Those ‘other’ aspects include the
FDSDFLW\WRD൵HFWWKHIHHOLQJVRIRXUDXGLHQFHWKHDELOLW\WRFUHDWHIHDULQ
them; or the power to ‘mess with the minds’ of the paying audience. All
WKHVHDQGPRUHZHUHWKLQJVRULJLQDOO\ODFNLQJLQP\¿UVWDWWHPSWVWRZULWH
6R,JUDGXDOO\GHYHORSHGDWKHRU\RIµKRZWRD൵HFWDQDXGLHQFHRQ
multiple levels’, and by pure coincidence, they all seemed to have an
F-word in them. I give you this list below, with comments on the use of
HDFKµ)%XWWRQ¶WKDW\RX¶OOQHHGWRSUHVVLQRUGHUWRD൵HFW\RXUDXGLHQFH
on more than one level.
1. FEELINGS
It’s easy to write without feelings. But the writing may not be any
good. John Osborne, the British playwright, considered his job was the
education of the audience’s emotions, to educate them in subtleties and
depths of feeling. But this point should not be misunderstood: it is not an
invitation to become sentimental or lachrymose.
To help an audience to feel deeply is one of the greatest gifts you can
give them. To do this, you need to create characters who feel. That is, they
have a feeling-life. They feel things. They feel contradictory things. Ideally,
your characters will live as many humans do: on the edge of their nerves,
on the adrenalin of their emotions. They will erupt, shout, scream for joy,
be ecstatic, furious, or all of the above. But they will feel something. And
they will constantly be dealing with the turbulent complexities of their
unpredictable, uncontrollable inner life. You don’t have to be that way
yourself (as, to some extent, Tennessee Williams was). But you should
create characters who are dominated by their emotions, their inner feel-
ings, doubts and yearnings. Tennessee Williams’ characters did—and his
plays are some of the treasures of American theatre.
2. FUN
Great art can be full of fun. Mozart’s music is. Shakespeare’s plays
are. ‘Fun’, to me is the expression of an inner life that is (even temporar-
ily) in a state of freedom. It may express itself as character playfulness,
or it may be the inevitable result of a plot whose bizarre paradoxes and
grotesque ironies cannot be held back any longer.
$OWHUQDWHO\ WKH FKDUDFWHUV FRXOG EH WHUUL¿HG²EXW WKH DXGLHQFH LV
enjoying the awkwardness, the looming embarrassment or the incipient
humiliation being delivered by the plot. Fun can be innocent, child-like
64 7ංආඈඍඁඒ'ൺඅඒ
3. FEAR
Fear is one of the most powerful tools you have in drama. The audience
JRHVWRZRUU\&KDUDFWHUVZKRDUH¿OOHGZLWKIHDUDUHDOVRWHOOLQJWKHDXGL-
ence: “You should be frightened too.” And only a bad writer fails to transfer
the fear to her audience. Dramatic stakes—where something universally
valued can be won or lost, are probably enough to create fear in both plot
and characters. It should then transfer to the audience. When characters are
victimised and/or manipulated (whether it’s Othello or Laura in The Glass
Menagerie) the audience feels fear on the character’s behalf.
Human beings are also social beings, and the pure pleasure that comes
from human’s getting together in a pleasurable social context should not
be overlooked. It creates an almost instant rapport with the audience.
Audiences like seeing characters being happy, however temporarily, and
for a legitimate reason. And experiencing pleasure in the company of other
people is one of the most legitimate reasons possible. So use this Frisson
Button when you need to create a temporary break in what might be an
otherwise oppressive and uni-tonal dramatic world.
5. FANTASY (Social/Emotional/Material )
:H¶YHDOOVHHQ¿OPVWKDWZHUHEDVHGRQD³:KDWLI"´IDQWDV\³:KDW
if you won a million dollars?”, or “What if you could manipulate reality
so that a stunningly handsome man fell in love with you, even though you
were obese?” In theatre, however, the Fantasy Button needs to be a little
more subtle and less craven. The best way to create the Fantasy level in
your dramatic world is to use any of the following three types of fantasy:
A writer friend of mine believes that plays are really ever only about
one of two things: either sex or death. Whether that’s true or not, it’s a good
place to start, for desire (bodily, carnal, guilty, libidinous or saturnine) is
one of the great dynamic forces we can bring into play when we release
our stories into theatre space. Don’t misunderstand this point: I’m not
advocating that our theatre be a type of ersatz soft porn. Quite the reverse.
The power of longing and desire lies precisely in the way it is bottled up,
suppressed to a state approaching boiling-point... and only then should it
be released. And sometimes, not even then. See it this simply: characters
who desire each other are, by nature, theatrically powerful. Don’t be afraid
to bring this desire into play and make it palpable in the language, the
interactions and the plotting.
7. The FANTASTICAL
7KHFXOWXUHDQGSRSXODULW\RI¿OPUHDOLVPKDVSUREDEO\LQWLPLGDWHG
us theatre writers into taming down the power of the theatre space, so that
ZHHQGXSFRPSHWLQJZLWK¿OPLQSUHFLVHO\WKHDUHDZKHUHZHDUHZHDN-
HVW²LQUHDOLVP)LOPZLOODOZD\VR൵HUDPRUHFRQYLQFLQJDQGDWWUDFWLYH
form of reality and representation than theatre, so our response should be
WRR൵HURXUDXGLHQFHVVRPHWKLQJWKDW¿OPRIWHQVWUXJJOHVZLWKV\PEROLF
IDQWDV\ERWKLQODQJXDJHDQGLQWKHW\SHRI¿FWLRQDOZRUOGVZHR൵HUWKH
theatre audience. The most amazing scenes in Shakespeare are precisely
those which are least “realistic”: the ghost scenes, or the mad, bedlamic
scenes, where bestial impulses (Titus Andronicus), paranormal phenomena
(Hamlet), bizarre miracles (The Winter’s Tale) and freakish feats of nature
(The Tempest) are unleashed on the awe-struck human witnesses of such
events. Imagining a world where miracles (demonic, celestial or simply
the inexplicable) occur could create plays that the audience wants to see.
66 7ංආඈඍඁඒ'ൺඅඒ
8. FRENZY (Dionysian)
Why should the devil and rock music have all the fun? Frenzy—that
ecstatic delight—that takes a dramatic character outside himself is a much
under-used Button in the writing of many contemporary theatre writers.
At one point in Brian Friel’s Dancing at Lughnasa, (a huge international
success, by the way), the women of the village put aside their humdrum
existence and hurl their bodies into a dance that is more than just ‘enjoy-
able’. Its energies are ecstatic and transporting. Similarly, I’ve seen more
than a few performances of Romeo and Juliet where the young lovers both
move and speak with an ecstatic abandon and energy. Could it be that
Shakespeare was aware of the power of frenzy as a dynamic and tonal
level in play writing? Of course he was. Even his comic characters (Sir
-RKQ)DOVWD൵$QGUHZ$JXHFKHHNJLYHZD\WRDEDQGRQDQGHFVWDV\DW
the slightest prompting.
9. FURY
The family is, and probably always will be, a powerful force in both
society and drama. Related to this F-level is one I will call the ‘Pseudo-
)DPLOLDO¶,GHDOZLWKWKLVPRUHLQ&KDSWHULQWKHVHFWLRQRQ¿QGLQJ
the Universalism in your play. In essence, this level deals with those
dramatic relationships that are quasi-familial in nature. In other words,
when two female characters form a relationship, it may resemble a sibling
or sisterly relationship. But because they are not sisters, it can only ever
be a quasi-sisterly relationship. But this is a strength. I’d almost say this:
a sisters-in-spirit relationship has even more powerful dramatic potential
than a set of real sisters, because the audience makes the bond itself (at
your prompting) and it adds yet another level of meaning to an already-
interesting relationship.
boding button) might also have a spirit of playfulness, however dark (the
Fun button). But soon, the Fear button is pressed (for example, by the
arrival home of a truly scary character). It’s not your job to ‘systematically’
press any F-buttons. Rather, your only task is to respond deeply to any
VWRU\\RXZULWH%\DOOPHDQVRQFHWKH¿UVWSDVVLRQDWHZULWLQJLVGRQH
you can set out to add other levels of meaning and richness, by checking
that a certain F-button or two has been pressed. But this should not be
too calculating. Just let your writing run free and wild, then review what
you’ve written a bit later. It’s then that you might want to consider what
actual buttons you’re pressing in the audience’s consciousness.
69
&ඁൺඉඍൾඋ
WRITING FOR THEATRE SPACE (I): FIRST PRINCIPLES
Theatre is hard. I wish it weren’t, but it is. You’re not required just
to tell a good story. You have to tell it in theatrical space in real time be-
fore people who will fall asleep or walk out if you haven’t done a good
job. This chapter and the next concentrate on showing you how to use
theatrical space.
To put it another way: when you write a play, you have two challenges
WRRYHUFRPHWKHFKDOOHQJHRI¿QGLQJWKHULJKWnarrative form, and more
LPSRUWDQWO\¿QGLQJWKHULJKWtheatrical form. But you will only solve the
problem of theatrical form, by understanding the phenomenon of theatre
space. Incredibly, information on how to write for theatre space is hard
to come by. The reason is that how-to-write books are often written by
non-writers who’ve never had to solve such practical problems.
/HWPHVWDUWE\EUDYHO\SURSRVLQJDGH¿QLWLRQRIGUDPD“Drama is
WKHFRPPXQLFDWLYH¿FWLRQDOIRUPFUHDWHGE\WKHUHOHDVLQJRIHQHUJ\LQD
social context (people, groups, relationships) which uses narrative patterns
(myths, story) to express itself through the medium of time and space.”
A story is the excuse to release a great deal of energy. There are lots
of energy ‘types’— physicalised, verbalised, acoustic, sensory, visual,
emotional even mental energy. The social context is whatever human
situation you are dramatising or embodying. The time aspect has to do
with whatever plot techniques you use. For example, a “fast scene” is a
manipulation of time. (It’s amazing how many of our plotting strategies
have to do with altering time.) And what of space?
It’s the Cinderella of our dramatic technique. The poor cousin that
we writers don’t clothe well enough, leaving it to directors and actors to
³GUHVVWKHSOD\XS´WKHDWULFDOLVHLWPDNHLWOLYHPRUHH൵HFWLYHO\LQWKHDWUH
space than we managed to in our initial writing.
Let’s establish a few basic principles.
First, there are really only ¿YHZD\VWR³¿OOWKHWKHDWUHVSDFH´7KH\
are—
2. HEIGHTENED LANGUAGE
It’s not enough just to have a strong intention. Iago doesn’t simply
glare, whisper and hint. That will not support his evil intention and carry
it across the big theatrical space. He uses a very muscular, rhythmic, even
operatic language, as does Othello. The language dips and dives, now it
soars, now it whines. It’s a real performance. Most importantly, when
needed, it goes up and up and up...
3. PHYSICALITY
It’s also not enough to have a muscular, highly rhythmic and expres-
21st Century Playwriting 71
VLYHODQJXDJH$MHDORXVPDQKDVDµMHDORXVERG\¶$ZRPDQ¿OOHGZLWK
discontent (like Hedda Gabler) has a panther-like restlessness built into
her actions, her personality, her speech, even her syntax.
There’s an interesting ‘chain of command’ happening here. It goes
like this—
Notice how space is ‘shared’ between word and image here. The alter-
nation between spoken and physicalized is almost balletic. (It’s certainly
musical, deriving as it does from the ancient technique of ‘antiphony’ or
‘call and response’, a texture used in styles as diverse as Gregorian chant
and Venetian polyphony.) Similarly, Beckett’s Rockabye is mesmerising
(almost literally) in performance due to the constant, obsessive image of
an old woman bobbing back and forth continuously in a rocking-chair.
5. SENSORY IMPACT
&ඁൺඉඍൾඋ
THEATRE SPACE (II): THE SPATIAL AXIS
5HDGHUVRIWKLVERRNPD\VHHP\DWWHPSWVWRGH¿QHDQGFDWHJRULVHDV
DQDWWHPSWWRPDNHSOD\ZULWLQJDGH¿QDEOHORJLFDODFW7KHWUXWKLVTXLWH
the opposite. Playwriting is an act of intuitive ‘unleashing’. But there is an
important place for being objective about your work. You should try and
understand your writing so you can communicate as strongly as possible,
DQGEHDEOHWRFRQWURODQGVKDSHWKHH൵HFW\RXDUHKDYLQJRQ\RXUDXGLHQFH
My approach is simple: to learn to write, you simply start to write.
But having done this, you then look at what you’ve done. After you’ve
ZULWWHQVWDQGEDFNFRROR൵JHWVRPHVOHHSRUJRRXW$IHZKRXUVODWHU
look at what you’ve done. It’s at this moment that all the principles, rules
RIWKXPEDQGJHQHUDOJXLGHOLQHVR൵HUHGLQWKLVERRNPD\EHXVHIXO
:ULWLQJOLQHVWKDWDUHDFWDEOHGUDPDWLFDOO\SRZHUIXODQG¿OOWKHDWUH
space is, to some extent, an act of intuition. You “feel” what is right for a
certain moment. It’s an instinct, but you can train this instinct.
There are many things you can do to give you a feel for theatre space.
Some of them are obvious.
Both the northern and southern areas of the space around the actor’s
body are part of a vertical axis, and that vertical axis is the domain of
the personal.
The vertical axis can best be understood by comparing it to its op-
posite, the horizontal axis. The horizontal axis governs the realm of the
21st Century Playwriting 77
social. When an actor speaks a line to another actor on stage, he is basically
using the horizontal plane. Energy is “pushed” toward the other actor. The
amount of energy he pushes depends on the line, and what emotionally is
happening at that point of the scene and the story.
This axis-theory is not just an explanation of where actors project their
voice, though that is an important part of it. It helps to explain how theatre
space is bodily created, as actors push energy, intentions, lines of dialogue
and physical movement in a complex, three-dimensional space. As soon
as the actor moves, the third dimension—breadth, or depth—is created.
See it like those revolving carriages you’re strapped into at amusement
parks that then turn you round, sideways and upside down. That is close
to how an actor uses body and voice to send verbal and physical signals
to all parts of the pleasure dome we call theatre space.
This theory is not as new or eccentric as it may sound. Baroque theatre,
opera and music all recognised that there was a physical rhetoric to the
public expression of emotion, an organised system of physical movements
and their verbal correlation. Each emotion had its own ‘body geography’,
which in turn created its own space. I’m not suggesting that a system of
¿[HGPRYHPHQWVRUSRVLWLRQVEHXVHG%XWRWKHUSHULRGVKDYHUHFRJQLVHG
that such a geography exists.
Although there are only four cardinal ‘compass points’ (up, down, and
the horizontal planes) there are hundreds of gradations, perhaps thousands,
because the actor’s body moves not just along the vertical and horizontal
dimensions. An actor is like a swimmer who can twist and twirl, and aim the
line or the emotional intention in absolutely any direction. But there is always
a relationship with the horizontal and vertical. Otherwise, a line of theatre
dialogue would mean nothing, or rather, would always mean the same thing.
To understand this more fully, let’s imagine an actor is performing
onstage. Being a typical actor—with a low boredom threshold—he keeps
KLPVHOI LQWHUHVWHG E\ WU\LQJ GL൵HUHQW ZD\V RI VD\LQJ WKH VDPH OLQH RI
dialogue. The line in question is, “The truth is, I’m not what you think I
am.” It’s not a great line, but it’s not a great play either. It’s a job.
On opening night, because the playwright, the director and the critics
are there, he gives it a very strong but straight reading. He ‘aims’ the line
around shoulder-height of the actress he’s supposed to be addressing. It
seems to work. The next night, still a bit seedy from the opening night
party, he looks directly at her when saying this, and aims the line right
to her forehead. It doesn’t work as well. It needs more of an emotional
“push” to feel right. So over the season, he tries a variety of spatial posi-
tions and emotional weightings. Every night, it means something slightly
GL൵HUHQW7KHOLWHUDOPHDQLQJRIWKHOLQHLVD൵HFWHGQRWMXVWE\KRZKH
said it, but by where he said it.
78 7ංආඈඍඁඒ'ൺඅඒ
As well as the general ideas I’ve just outlined, I’ll list some very practical
ZD\VWKDW\RXFDQPDNH\RXUZRUNXVHWKHDWUHVSDFHH൵HFWLYHO\,WDOOVWDUWV
with your original text. Look for, or create, a story that has the following—
This is one of the most confused areas in the thinking of many new
SOD\ZULJKWV0DQ\¿UVWWLPHZULWHUVEHOLHYHWKH\KDYHDWHUUL¿FSOD\LQ
the making because “the set will be amazing.” The truth is, your play may
not even need a set at all.
/HWPHR൵HUDURXJKFODVVL¿FDWLRQRIVHWW\SHV,WPD\EHWKDW\RX
recognise your play in one of these.
$V,VDLGWKHDWUHGRHVQRWUHTXLUHDVHW$SOD\LVHVVHQWLDOO\D¿FWLRQ-
alised and physicalised encounter between actors and audience, using the
medium of imagination. If an actor says, “I am Cleopatra”, the audience
will believe it. They have come to the theatre to use their imagination
and watch the actors pretending. If the play is intense enough, or funny
enough, or sad enough, the audience will even forget that there is any
pretence. Why? Because while audiences always ‘suspend their disbelief’
in order to watch a play, they never suspend their belief in the power and
integrity of their own imaginations. An audience believes in the vitality
DQGLPSRUWDQFHRILWVRZQLPDJLQDWLRQ,QJRLQJWRD¿OPRUWKHDWUHDQ
audience is asking for that imagination to be engaged. If a play and its
actors succeed in turning on the imagination of the audience, the question
of belief becomes irrelevant. So does a set. Work on the power of your
story and its theatrical communication before you worry about what type
of set you need.
80 7ංආඈඍඁඒ'ൺඅඒ
This is where a specially constructed set is used for the entire dura-
tion of the play. This can be a trap for the playwright. The audience has
to look at it all evening, so the set had better be interesting. Often it isn’t.
The reason for this is because many writers do not understand a bizarre
but important fact, which is that theatre does not do interior space es-
pecially well.
Historically, the great theatre has always been an outdoor event—the
Greek, the Elizabethan, the medieval, the modern epic theatre. They are
all more concerned with the social experience of human life. So they put
their plays outdoors, or into a neutral ‘public space’, where the big issues
and the big ideas could be dealt with. It was only in the nineteenth century,
when theatre turned predominantly middle-class that a love of interior
design and domestic themes came to the fore. (Restoration comedy does
not alter this fact. The salon where the wits gathered was really the inva-
sion of private space by all of society.)
,KRSHLW¶VFOHDUWKDWZKHQ,VD\µ¿[HGVHW¶,GRQ¶WQHFHVVDULO\PHDQ
a nicely designed living room. In fact, if I had a dollar for every bad play
I’ve read that was set in a kitchen, living room, bedroom or study, I’d be
a very rich man. Something about interior space tends to stultify. Equally,
setting a play outdoors tends to open up the imagination. We relax. We
breathe more easily. Our senses are more stimulated. But what about Ib-
sen, you say, and his numerous drawing-room plays? Two things should
EULHÀ\EHVDLGDERXWWKDW,EVHQKDGWRDFFHSWWKHPLGGOHFODVVQRWLRQVRI
his time. But he progressively moved away from them. His last play ends
with an avalanche in the great outdoors.
/HWPHR൵HUDUXOHRIWKXPEKHUH,I\RXUVWRU\GHPDQGVWKDWLWEH
set indoors, then extraordinary things should happen in that indoor space.
Look at Who’s Afraid of Virginia Woolf?RU-XOHV)HL൵HU¶VLittle Murders,
where the family takes pot-shots at passers-by from their living room
window. Or Mackerel (Israel Horovitz), where a giant mackerel lands
smack in the middle of the family’s living room. Now, that’s something
to do with the living room. Demolish it.
The reverse also applies: because the outdoors is so alive, you can
often get away with a quietness, an intimacy that would be plain boring
in an interior space. Put it this way—if your play is domestic, small in its
themes, or simply acoustically quiet, then put it outdoors!
This is a type of play that requires two or three main locations. I’m
21st Century Playwriting 81
not a big fan of this type, as it dilutes the power of the space into several
mini-spaces, each weak and lacking the spatial power of the full theatrical
space. I’m not saying it can’t be done. The trick is probably to keep your
writing economic, powerful and brief, so that it’s precisely the interrela-
tion between the spatial areas and the accumulating story that is the main
interest.
People who write this sort of play are often writing a type of wide-
screen television. “Lights up on Fred’s study...Back to Marj on the
porch.” You can often tell a closet TV writer who thinks s/he is writing
for theatre. The give-away is the detail of the scene directions. Fred’s
study is described in such detail that it’s clear that the Theatre Company
is meant to build Fred’s study, piece by piece. (The writer makes it clear
in the dialogue, as there’s some “really funny” by-play as Fred opens and
shuts numerous desk drawers.) Same for Marj’s porch, because she sits
down on it, bashes the back door closed and faints against the awning.
What is really being prescribed here are two separate TV locations. The
writer is simply designing a ‘location’ or set, which is the way TV works.
Television pretends to simulate reality, whereas theatre has to treat reality
as symbolic, because they are in a theatre space whose very raison-d’etre
is the imaginative contract drawn up by audience and actors. There are
no desks in Shakespeare.
Thus, be wary of your own play if it calls for several locations, all
of them indoors. Another clue to this ‘disguised television writing’ is the
smallness of the dialogue and its closeness to social reality. A third clue
LVVWDJHGLUHFWLRQVWKDWDUHVPDOODQGVSHFL¿F(J³)UHGVFUDWFKHVRXWD
ZRUGDQGFXWVWKHSDJHLQWR¿YHXQHTXDOSRUWLRQV´:KRFDUHV",W¶VVR
VPDOODQGKDUGWRVHHWKDW)UHGZRXOGQHHGWRFXWKLPVHOILQWR¿YHVPDOO
portions before the audience would even notice.
Another problem of the multi-set play is the way it can divide the
stage into small spaces that have no cumulative impact. They’re just
small, uninteresting spaces. But this type of set can, of course, be made to
work—and brilliantly. The Season at Sarsaparilla by Patrick White uses
three simple, iconic domestic residences. It works well because it is based
on one major principle: each stage location is a world in itself (moral,
VSLULWXDODQGLPDJLQDWLYHUDWKHUWKDQDPDWHULDOSODFH7KHGL൵HUHQFHV
and similarities of each of the three domestic worlds are continuously
on display.
4. ‘DIVIDED STAGE’
very point that the play is making. Ayckbourn’s How The Other Half Loves
has characters enter the two spaces in a dance of love and desire. Early
productions of Death Of A Salesman used an expressionist set design to
VKULQNWKHXSVWDLUVEHGURRPDQGGRZQVWDLUVNLWFKHQ7KHH൵HFWLVHHULH
Are these people giants in a small house? Is the house collapsing in on
them? Or are they pygmies in a doll’s house that the world will soon crush?
This is, I admit, not a pretty term, but the sort of play that results is
often impressive. It is a character-based and structural approach, where
the writing is so fast and tight, that the whole question of set becomes
secondary. Concentrate on writing brief and highly focussed scenes, where
characters enter with a clear and powerful intention, and the stage design
and set will look after itself. Shakespeare uses this conception of space
brilliantly in Antony and CleopatraZKHQWKHHEEDQGÀRZRIEDWWOHLV
VKRZQZLWKHFRQRP\DQGSRZHU7KHÀXLGVFHQHDSSURDFKVXLWHGWKHRSHQ
Elizabethan stage, but it also suits the modern. Many writers use it: David
Mamet (in Edmond); Nick Parsons (in Dead Heart); Stephen Sewell in
The Blind Giant Is Dancing, Welcome the Bright World and Traitors.
— Make your set part of the plot. Look at A Doll’s House, and how the
audience is watching like mad for that dreadful letter to get popped in
the mail-tray attached to the front door. Imagine the physical impact
being made by that damaged spiritual giant, John Gabriel Borkman,
as he paces about upstairs, while downstairs the women engage in a
deadly battle of wills over ownership of the man upstairs.
— Eliminate all props that are not symbolic of something more than their
materiality. Use a single chair, and make that chair mean something
more than ‘something to sit on’.
— Consider placing your props and set under great pressure. Look at how
in Sam Shepard’s Fool For Love, half the set gets blown away with a
shotgun by a jealous husband (or his hit-woman), while the cowering
lovers hide behind a bed.
MAY: Somebody’s sitting out there in that car lookin
straight at me.
EDDIE: What’re they doing?
MAY: It’s not a “they”. It’s a “she”.
21st Century Playwriting 83
(GGLHGURSVWRWKHÀRRUEHKLQGEHG
— Start writing your play with only a sense of ‘space’, and allow only
vital, indispensable props to be used as the story demands them.
²5HPHPEHUWKDWOLJKWLQJDQGVRXQGDUHIDUPRUHH൵HFWLYHSURSVWKDQ
PDWHULDOWKLQJV7KHUHDVRQIRUWKLVEULHÀ\LVWKDWWKHDWUHLVDW\SHRI
dramatising of the inner life, which usually involves transcendence
of some sort. Light and music are, by their very natures, transcendent
things, both suggestive and evocative, but impossible to precisely
GH¿QH 7KHLU XVH ZLOO RIWHQ GR PRUH IRU \RXU SOD\ WKDQ WKH PRVW
expensively built set.
I write the following not to give you a history lesson, but to stimulate
your own interest in theatre space. As this chapter has tried to show, if
you’ve no understanding of theatre space, you won’t be able to write for
theatre. So let’s look at the four basic theatre designs in use today.
84 7ංආඈඍඁඒ'ൺඅඒ
This is a design that is several centuries old. It was based on the de-
sign of the old French Royal tennis court, the space of which was simply
used for theatrical and ballet performances at the French court. One end
of the tennis court became the stage, and the performance took place on
a raised platform. The performance was ‘projected’ from one end to the
other. The proscenium arch theatre suits tableaux and dance theatre, special
H൵HFWVSURGXFWLRQVDQGPXVLFDOVEXWLVRIWHQDGUHDGIXODQGXQV\PSDWKHWLF
space for plays. The reason is that theatre, as I’ve already said, is about
WKHWUDQVIHUHQFHRIHQHUJ\LQDVSDFHDQGWKHPRVWH൶FLHQWµYHVVHO¶WRGR
this is a circle, not a large rectangle. It’s an interesting fact that theatre
that relies just on the spoken word contains much less in-built energy than
WKRVHDUWVWKDWXVHPXVLFRSHUDEDOOHWRUSXPSHGXSVRXQGH൵HFWV¿OP
Thus, the trick is to get the audience as close as possible to the stage
and the actors. This is often impossible for most of the audience sitting
LQDSURVFHQLXPDUFKWKHDWUHXQOHVV\RX¶UHVLWWLQJLQWKH¿UVWIHZURZV
Historically, some audience members who paid enough or were born into
the right class got to sit onstage with the actors, thereby getting very close
to the action—and the energy.
What sort of plays work well in this space? Sadly, not the sort of plays
that most writers can write in the early years of their artistic development.
Big spaces require big plays. By ‘big’ I mean plays that use the
sensual and acoustic impact of a big cast, and deal with ambitious and
epic themes. Theatre space has to be used to the limit to overcome the
limitations of the rectangular space. The language also has to be big in
some way—intense, highly musical. Racine’s passionate and lyrical
poetic dramas grew out of this space. Brecht also works well in this type
of space, where his iconic characters such as Mother Courage have great
mimetic and visual power. Ideally, the large space of most proscenium
theatres will suit big plays. But where there is a shortage of excellent
and ambitious new work (and there usually is), the stage space is simply
reduced in size. Thus, you will often see quite intimate plays for two
RU WKUHH DFWRUV ¿OOLQJ D ODUJH WKHDWUH ZLWK KDOI WKH SURVFHQLXP VWDJH
VLPSO\¿OOHGLQE\WKHVHW7KHUHDVRQKDVPRUHWRGRZLWKHFRQRPLFV
and down-scaling than artistic imperatives.
The thrust stage is where the stage comes out to meet the audience.
The Elizabethan stage works in this way. Modern variants have also at-
tempted to overcome the problems of the proscenium by bringing the stage
21st Century Playwriting 85
forward. I won’t dwell on the perfection of the Elizabethan theatre space,
except to say that it permitted a dazzling blend of intimacy and epic sweep.
3. THEATRE-IN-THE-ROUND
4. AMPHITHEATRE
DVZLPPLQJSRRODFDYHDFU\SWDFOL൵IDFHDEHDFKDQRSHQDUHD
surrounded by fences, boundaries and borders; a riverbank; a lighthouse;
under the pylons of the world’s largest bridge; the top of a mountain; a
deserted railway station at midnight; another planet.
The implications of this spontaneous list should be clear: that theatre
space is best used when there is a dialogue between interior and exterior
space; that materiality (rocks, concrete etc) is powerful when it is sugges-
tive of human will, intention and ambition (hence the suggestive power
RIWKHµEULGJHS\ORQ¶PHQWLRQHGDERYHDQG¿QDOO\WKDWQDWXUHLWVHOILV
highly suggestive, being itself a type of metaphor for the human soul.
Many books on play writing deal with space at the end of the book,
if at all. This is surprising, because ‘space’ is the only thing that is unique
WRWKHDWUHDWOHDVWZKHQFRPSDUHGWR¿OPUDGLRDQG798QOLNHWKHVH
three media, theatre uses live space to tell its stories. If you can’t under-
stand and use space properly, then you may be a wonderful story-teller,
but you’re not a playwright, because your story doesn’t need to be—or
can’t be—told in theatre space.
$¿QDOWKRXJKWRQWKHDWUHVSDFH,¶YHVSHQWPXFKRIWKHFKDSWHU
R൵HULQJUHDVRQVZK\\RXVKRXOGLJQRUHWKHLGHDRIDµVHW¶DQGWKLQNLQ-
stead of ‘theatre space’. But if it turns out that your play requires a built
set, then ask for it. If the play is good enough, you’ll get it. Making dif-
¿FXOWGHPDQGVLVSDUWRIWKHMRERIDWKHDWUHDUWLVW$GLUHFWRURQFHWROGPH
WKDWKHORYHVSOD\VZKHUHDW¿UVWKHKDVQRLGHDKRZKHFDQVWDJHLW6HW
everyone—actors, stage designer, director, sound and light designer—a
ELJFKDOOHQJH-XVWPDNHVXUHWKHFKDOOHQJHLVZRUWKWKHH൵RUW2QHRIWKH
best plays of the post-war period is Wolfgang Borchert’s Draussen Vor
'HU7ĦU. (The Man Outside).
It starts with a man on a wharf about to suicide.
(The wind is moaning. The River Elbe slaps against the pontoons.
It’s evening. The Undertaker. The silhouette of a man against
the evening sky.)
He jumps, and the scene changes to... the bottom of the Rhine River.
Where else? This is what I call an exciting spatial challenge.
87
&ඁൺඉඍൾඋ
CLASSICAL STORY SHAPE: A DEFINITION (OR TWO) OF
‘STORY’
7KHZRUGµVWRU\¶FDQQRWEHGH¿QHGDWOHDVWQRWVLPSO\IRUQRRQH
GH¿QLWLRQFDQHQFRPSDVVWKHGR]HQVRIIXQFWLRQVWKDWKXPDQVRFLHW\NHHSV
DVNLQJLWVVWRULHVWRIXO¿O,W¶VZKDWPDNHVWKHLGHDRIµVWRU\¶LPSRVVLEOH
WR GH¿QH SUHFLVHO\7DNH WKH IROORZLQJ GLFWLRQDU\ GH¿QLWLRQ RI D VWRU\
IURPWKH0DFTXDULH'LFWLRQDU\³$QDUUDWLYHHLWKHUWUXHRU¿FWLWLRXV
in prose or verse, designed to interest or amuse the hearer or reader”, and
“A narration of events in the life of a person or the existence of a thing,
or such events as a subject for narration.”
$VDZULWHUDQGFUHDWRURIGUDPDWLF¿FWLRQV,EHOLHYHWKDWWKHRQO\
value of dramatic theory—even the theory contained in this book—is to
KHOSXVZULWHEHWWHU7KHDERYHGLFWLRQDU\¶VGH¿QLWLRQVDUHRIOLWWOHXVHWR
a writer seeking to learn the craft of how stories are made. Why? Because
a story is a complex historical and cultural construction, and is the sum
of many things—an entertainment, a meditation on some deep truth, a
JDPHDÀH[LQJRIWKHLPDJLQDWLRQDQH[FXVHWRODXJK$V,VDLGµVWRU\¶
LVLPSRVVLEOHWRSUHFLVHO\GH¿QH$OO,FDQGRLVR൵HUDVHWRIGHVFULSWLRQV
ZKLFKDUHUHÀHFWLRQVRIWKHLUIXQFWLRQV+HUH¶VDTXLFNOLVW
7KHODVWGH¿QLWLRQWKRXJKDVVSRQWDQHRXVO\LQYHQWHGDVWKHRWKHUV
has just enough of a ring of classical authority to allow me to throw a
¿QDORQHRQWKH¿UH
All the above raise big issues that a humble, practical dramatist’s
workbook like this cannot hope to answer, so I’ll simply suggest that you
must decide for yourself what a story is, because the only thing that really
PDWWHUVLVWKDW\RXPDNHDZRUNLQJGH¿QLWLRQIRU\RXUVHOIDQGWKHQget
writing, as soon as possible.
7RKHOS\RXVHHWKHULFKQHVVWKDWDVWRU\FDQR൵HU,VXPPDULVHEHORZ
an analysis by J.L. Styan, from his book, “The Dramatic Experience”.
Styan lists six levels to narrative, and uses the example of King Lear,
to illustrate.
The level of plot and narrative. At its ‘simplest’, King Lear is a story
of a domestic quarrel which has implications for the family and state. The
interest for the audience is, “What will happen?”
The level of the psychological. The interest here is our speculation
as to basic personality, motive (“Why did s/he behave like that?”). We
watch as several characters, not least Lear, grow in their understanding
of themselves through the course of the play.
21st Century Playwriting 89
The level of morality. This level recognises that good and bad exist
as realities, even though the sophistication of the play doesn’t reduce
characters to simple ‘goodies’ and ‘baddies’. For the audience, the play
becomes an allegory about confronting such realities.
The level of the philosophical. For Styan, this level of the play is a
GHEDWHRQ*RGDQGWKHSUREOHPRIVX൵HULQJ:DWFKLQJWKHSOD\ZHDUH
constantly being stimulated by Shakespeare as he studs each incident with
meanings much bigger than could be contained by mere plot.
The level of the poetic. Styan considers this level to be a dirge or la-
ment on humankind’s ambiguous position, somewhere between angel and
animal, which is communicated by the play’s powerful images, linguistic
rhythms and musicality.
The level of the dramatic pattern, as Styan calls it, where the audience
responds on the aesthetic level to the play’s coherent tying of meaning to
a tight dramatic structure.
To Styan’s list, I would add the following:
The level of the sensual. Humans live as sensual beings, however
dulled they may sometimes be. In Lear, the role of the senses is strong.
There is much for the ear, the eye and every other sense to relish, not to
mention the visceral revulsion in Gloucester’s eyes being gouged out.
The level of the social and political. A play is often a statement about
the deliberate, intentioned organisation of society, whether political or
not. In King Lear, the role and power of politics and the dominant group
is obvious.
The level of the physical. A play will often deal with the impact of
living on our physical selves. Comedy is frequently a celebration of the
FROOLVLRQRIERGLHVDQGPDWWHU3HRSOHIDOORYHUGRQ¶W¿WWKURXJKGRRUV
Their lives, energies and imaginations are constantly at war with the
material world, and it shows on their damaged bodies.
The level of the metaphysical. A play is ultimately about ‘what im-
plications this story has for our own inner lives.’ Styan partly deals with
this in his poetic and philosophical levels, but there is a point at which
a description of this function as ‘philosophy’ is not adequate. This is the
OHYHODWZKLFKDSOD\EHFRPHVDPDQGDODVRPHLQGH¿QDEOHWKLQJEH\RQG
words, but which allows us to brood on multiple meanings and implica-
WLRQVIRUXVDVKXPDQEHLQJV7KHFKLHIEHQH¿FLDU\RIWKLVOHYHOLVQRW
our consciousness but our other ‘selves’—our intuition, our instinct and
our dreaming self.
Having discussed these various levels of a rich play, how do we go
DERXWHQVXULQJWKDWRXURZQSOD\VKDYHWKHVHOHYHOV"7KH¿UVWVWHSLVWR
know that the levels exist. The second is for us as writers to apply these
levels to each major character (and each major relationship), asking very
90 7ංආඈඍඁඒ'ൺඅඒ
VSHFL¿F TXHVWLRQV RI WKDW FKDUDFWHU7KH H൵HFW RI WKHVH TXHVWLRQV LV WR
‘mesh’ levels together (as indicated in the following brackets). Here are
several questions you could apply to almost any major character:
— What physical life does he lead? (This question explores the relation
between the social and the physical.)
²:KDWLVWKHH൵HFWRQKLVERG\RIWKHOLIHKHOHDGV"7KHUHODWLRQEHWZHHQ
the moral and the physical selves of a character.)
— What does he dream of at nights? (The social/conscious meeting the
intuitive/unconscious.)
— What does he do for a living—and to what extent is this a sign of his
success/failure in the economic and social world? (This question
explores the idea of ‘the job as symbol of the character’s social
position’, involving consideration of a range of levels—economic,
PRQHWDU\¿QDQFLDOVRFLDOHWF
— What is his Achilles heel? (Is he, emotionally-speaking, a child? Does
he lack compassion? This weakness or ‘lack’ would have clear con-
sequences in the character’s public or private life.)
— How does he see human life? As a game? A mad farce? A pointless
routine? A joyful romp without consequences? (Whatever way that
this character sees life would have clear implications for how he treats
himself and all those around him.)
+HUHZHJHWTXLWHEDVLF6KDNHVSHDUHGLGQ¶WVWDUWR൵E\ZULWLQJKing
LearDQGQRUFDQZH$QRUWKRGR[EXWQRWVLPSOHVWRU\µVKDSH¶LVR൵HUHG
EHORZ5HJDUGLWDVDEDVLFWKHPHRQZKLFK\RXZLOO¿QGPDQ\YDULDWLRQV
And remember, our job as storytellers is to know this narrative pattern so
well that we can do anything with it—turn it around, leave parts out, skip
back and forth, or reverse the order.
I should also state at this point that I use the words ‘plot’ and ‘story’
interchangeably. Some theorists will try and convince you that the two
DUHYDVWO\GL൵HUHQW)RUH[DPSOH(0)RUVWHU¶VQRWLRQLQKLVArt of
the Novel) “Story is when a King dies, and then the Queen dies. But plot
is ‘The Queen died, and the King died of grief.’ ”
21st Century Playwriting 91
The problem to me with Forster’s tempting distinction is that his
‘story’— ‘The King dies, then the Queen dies’— is not even a story. It is
a quasi-statistical register of births and deaths (which is, admittedly, part
of his point.) Story, like plot, is imbued with human motivation, intention,
morality etc…or it is nothing.
Having said that, however, there is one distinction between the two
words that I personally use and recommend: the word ‘story’ implies that
the ordering of events is symbolic—of something deep and important to
human life and experience, and therefore we’d better pay attention to the
story or else we’ll be the poorer for it. ‘Plot’ on the other hand has the
implicit and highly useful notion built into it of structural ordering. That
is, ‘plotting’ is the art and craft of putting these symbolic events into a
certain order, and this order makes for the communication of a rich and
powerful set of meanings relevant to our human existence. Without the
ordering of the symbolic story elements, the meanings would be less clear,
and less convincing.
With that in mind, let me outline a generic story shape.
1. THE BEGINNING
2. DISTURBANCE
3. 1ST MAJOR ACTION/PROBLEM/DILEMMA BEGUN
4. COMPLICATIONS OCCUR; involving SURPRISES and TWISTS
5. REVERSAL
6. NEW ACTION/NEW DECISIONS/NEW REACTIONS (Change of
direction)
7. TURNING POINT (for good or ill)
8. NARRATIVE CLIMAX
9. EMOTIONAL CLIMAX, CLIMAX OF MEANING
10. ENDING.
I repeat: The above is NOT a strict order. In fact, it’s amazing how
ÀXLGHDFKHOHPHQWLV/HW¶VH[DPLQHVRPHRIWKHVH
1. BEGINNING
2. DISTURBANCE
²$VWRUPIRUFHVDJURXSRIWUDYHOOHUVWR¿QGUHIXJHLQDQHZZRUOGZKLFK
is much stranger than the old world they left behind. (eg The Tempest)
— A new pupil arrives. Drama loves new characters. What makes the bril-
liant play by Eugene Ionesco so wonderful is that a normal event—the
DUULYDORIDQHZSXSLODWKHU¿UVWSULYDWHOHVVRQ²EHFRPHVDZHLUGO\
sado-masochistic relationship whose ending I won’t spoil. (Ionesco’s
The Lesson)
— A visitor from the past returns. (A big favourite of Ibsen: Hedda Gabler,
The Pillars of Society, The Master Builder)
— A newcomer arrives in town, in the apartment block, or in the family.
(Entertaining Mister Sloane)
— A relationship is in trouble, or simply appears so unstable that explo-
sion is imminent. (Who’s Afraid of Virginia Woolf?)
— A political threat must be dealt with, arising from the return of a far-
too-popular leader. (Julius Caesar)
²$NLQJPLVXQGHUVWDQGVD൵HFWLRQEHWZHHQKLVZLIHDQGKLVEHVWIULHQGDQG
ZURQJO\FRQFOXGHVWKDWWKHWZRDUHKDYLQJDQD൵DLU. (The Winter’s Tale)
²$JKRVWKDVEHHQVHHQ²DQGZRUVHKDVVSHFL¿FLQVWUXFWLRQVIRURQH
man in particular. (Hamlet)
— A competent but unpredictable king surprises his retinue with a bizarre
succession plan. (King Lear)
²$URPDQWLF\RXQJPDQIDOOVLQORYHDW¿UVWVLJKW(Romeo & Juliet)
²$UHDOHVWDWHR൶FHLVDERXWWREHEURNHQLQWRGlengarry Glen Ross)
The latter example is a good instance of the notion that simply the
threat of change (to what is, in that play, an unstable, volatile and nasty
world) shows that exactly when a disturbance occurs can vary. Sometimes
a disturbance can be delayed—and the Disturbance in Glengarry Glen
Ross is really about setting up Act 2, not Act 1. But beware! The longer
\RXGHOD\WKLV¿UVWPDMRUGUDPDWLFHYHQWWKHPRUHSUHVVXUH\RXSXWRQ
yourself. Action is much easier to write than ‘glorious inaction’, a la
Beckett. (Even with Beckett, there is lots of sub-surface action despite
an apparently static surface—quite apart from the fact that it’s held
together by mesmeric, musical language.) Alternately, you may have
WR FRPH XS ZLWK ZKDW DUH HVVHQWLDOO\ PDJQL¿FHQW FKDUDFWHU VNHWFKHV
DV'DYLG0DPHWGLGLQWKH¿UVWDFWRIGlengarry Glen Ross. Act II of
94 7ංආඈඍඁඒ'ൺඅඒ
that play opens with a burglary having been committed. It’s almost a
one-act play in itself.
So try and disturb the setting as soon as possible. But there are other
possibilities: You can disturb the action—
— Just before the play starts. The best writers (eg the writer of Hamlet)
often begin the play with a disturbance that has happened before the
events that are recounted in the play.
— Years before the play starts. This is the great Norwegian dramatist
Henrik Ibsen’s method, and useful for all societies and cultures that
enjoy guilt as part of their evening’s entertainment. A ‘dark secret’ may
haunt the characters. You can often sense this in an Ibsen play. The
setting and character relationships look normal, even domestic... but
something isn’t quite right. (See Chapter 15 for more on the concept
of The Guilty Secret.)
— Through a series of graded disturbances. The pastor in Rosmersholm
always avoids going round by the bridge. (“Why?” the audience asks.)
But today, to the maid’s astonishment, he’s taken that path! Two shocks,
and all within a few pages of the play’s starting. Shakespeare does this,
also. There are several disturbances implicit or explicit in Hamlet: the
murder of the king, weeks before the play opens; the appearance of
the Ghost; the immense shock (to Hamlet) that not only is this ghost
that of his father, but this ghost has a special job which only Hamlet
can do. And then there’s the matter of Claudius marrying his mother.
— Within a few pages of the start of the play. Either the disturbance
should happen then, or there should be a sense that “something is going
to happen.” Give the audience a reason to keep watching by planting
clues and hints that all is not well.
So, what is a major action? Put simply, it is the action which domi-
nates a play and its characters. But there are many types of actions. To
understand this, we need to revisit what ‘plot’ is—or could be. In its most
basic meaning, ‘plot’ is that exact sequence and order of events that drive
a story to its rightful and necessary conclusion. After the event, it all seems
clear. But for writers involved in plot-making, the creation of a rich plot
involves widening the conception of plot as much as possible. Thus—
PLOT IS—
$OOWKHVHPD\FRQVWLWXWHWKH¿UVWPDMRUDFWLRQRI\RXUVWRU\<RXZLOO
notice one thing about the above list, however. They are all quite active
traits. Usually a central agent (hero, protagonist, central character) gets
RXWRIKHUFKDLUXVHVH൵RUWDQGPDNHVWKLQJVKDSSHQ7KDWLVZK\,FDOO
these type of actions ‘active’ traits. A character is creating situations, doing
things, driving events, or trying to.
%XWWKHUHLVDWKLUGDUHDRISORWZKLFKPD\FRQVWLWXWHWKH¿UVWPDMRUDFWLRQ
Plot can also be—
Thus, when a character falls in love with another, that is plot (or a
SDUWRILW$FRXSOHIDOOLQJLQORYHPD\EHWKH¿UVWPDMRUDFWLRQRIWKH
play. When a character falls out of love with another, that is plot. When
characters are growing closer to each other, or growing apart, that too is
plot. Remember, however, that it’s usually not enough for two characters
to say “I love you”, or look lovingly into each other’s eyes. They need a
joint action. For example, they may be practising their dancing—but the
true dance is that of courtship and love. There is an inner action (‘getting
to that place of deep connection called love’) to match the outer action
(that is, ‘practising for the dance contest’) and the intertwining and tension
between these two actions creates what we call ‘plot.’
<RXFDQRIWHQ¿QGZKDW\RXUPDMRUDFWLRQLVE\FRPSOHWLQJDVHQWHQFH
21st Century Playwriting 97
that begins with “To”. Thus, major action might be any of the following—
,W¶VFXULRXVKRZVRPDQ\PDMRUDFWLRQVLQERWKSOD\VDQG¿OPVDUH
based on words starting with W. Even in smaller structural units like the
play scene or the movie sequence, the “W” words are often useful.
Here are some examples, with the movie or play that illustrates this.
WHEN
:KHQZLOOWKHERPEJRR൵"7KHPRYLHSpeed)
98 7ංආඈඍඁඒ'ൺඅඒ
WHY
WHERE
:KHUHLVWKHKLGGHQVHFUHWWUHDVXUH"0RUHXVHIXOIRU¿OPVWKDQSOD\VDV
‘the search for the material object’ is more central to what, in my view,
DUHWKHFUXFLDOSDUDGLJPVRI¿OP7KDWLVLIWKHDWUHXVHVµWLPH¶DQGµVSDFH¶
DVLWVPDLQPHGLDIRUVWRU\WHOOLQJWKHHTXLYDOHQWFRRUGLQDWHVIRU¿OP
are ‘time’ and ‘place’. It’s why the idea of ‘locations’ are so crucial for
¿OPZULWLQJ
WHO
WHAT
Knowing that stories often work on a ‘W-principle’ will get you into
a way of thinking whereby you conjure up stories that are imbued with an
urgent central narrative question. In one sense, a story can be reduced to a
single question (Will Hamlet succeed in solving the mystery of his father’s
death?) But one question leads to many others. What will Hamlet do, now
that he’s been given his assignment by the ghost? What will his strategy
be? What dangers does he face? In fact, it’s not going too far to say that
every scene of your play will be driven by a question central to that scene.
(For example, your character wants X in this scene.) When the question
has been ‘answered’ (“Bad luck, he doesn’t get it.”) then the scene is over.
21st Century Playwriting 99
4. COMPLICATIONS OCCUR
²$FKDUDFWHUFDQFKDQJHKLVKHUPLQGDQGWKXVFKRRVHDGL൵HUHQWJRDO
to achieve. Colin in Emerald City decides he’s sick of art, and in a
100 7ංආඈඍඁඒ'ൺඅඒ
It’s important to realise this: that a change of direction means that the
plot has developed. If you’re ever stuck, and are asking yourself, “How
can I develop my plot?”, simply consider making the various actions,
fortunes and fates go in an opposite GLUHFWLRQ,QWKH¿UVWKDOI)UHGLVRQ
top of the world. In the second, it’s his partner. I’d even go so far as to
VD\WKDWLI\RX¶UHZULWLQJDWZRDFWSOD\DQGWKHUH¶VQRVLJQL¿FDQWFKDQJH
of direction in several ways, then you probably don’t have a second act
at all. Your second act is simply more of the same, an extension of what
\RXZHUHWU\LQJWRGRLQ\RXU¿UVWDFW
A good story has both surprises and twists built into it. A ‘surprise’ is,
not surprisingly, that which comes out of nowhere. A few thoughts on this,
EDVHGRQZKDW,¶YHQRWLFHGLQZRUNVWKDWXVHGUDPDWLFVXUSULVHH൵HFWLYHO\
So, a twistLVVRPHZKDWGL൵HUHQWIURPDVXUSULVH$WZLVWLVµPXFKPRUH
or much less than what was expected.’ If nothing is expected, then it is a
surprise. If a killer walks in your door, then it’s a surprise. But if you already
know there’s a killer on the loose, and your mother enters, and it turns out
that she’s the killer, that is technically known as a ‘twist’ (quite apart from
it being a personal disappointment to you.) It’s not a surprise. After all, you
knew there was a killer, but you weren’t expecting it to be your own mother.
That’s the rub. There’s often an element of karma or poetic justice to the
twist, where the evil that men do comes back to haunt them. Or to put it more
ironically, think of the phrase, “Let no good deed go unpunished”. You do a
favour for someone, you even love them for a while—and they enter your
life and proceed to ruin it. (See Chapter 3 and The Woman from the Past.)
0\SHUVRQDOGH¿QLWLRQRIµWXUQLQJSRLQW¶LVVLPSOHa turning-point
is that still, (often quiet) moment of recognition on the part of a major
character. The nature of the recognition is often deeply personal and
KXJHO\VLJQL¿FDQW³7KLVLVWKHPRPHQWVKHUHDOLVHVWKHLUPDUULDJHLVD
sham.” Or, “this is the moment that the banker realises his most trusted
secretary has been lying to him.”
The structural truth is that twists and turning-points often end up in the
102 7ංආඈඍඁඒ'ൺඅඒ
same phase of a play. Sometimes they are part of the same beat. A twist
in the narrative direction of the play creates, in turn, a new direction to
the story... and the moment where the old direction stopped and the new
direction started—that is the actual moment of the turning-point. The
example below from A Doll’s House FRQ¿UPVWKLVDQGLW¶VVRPHWKLQJ
I’ll return to shortly.
%XW¿UVWOHWPHH[SODLQWKHWZRW\SHVRIQDUUDWLYHWXUQLQJSRLQWV
7KH ¿UVW W\SH RI WXUQLQJSRLQW LV ZKDW , FDOO WKH ,QIRUPDWLRQDO
Turning-point . This is where the twist in the story is provided by way of
information—often from the malefactor herself. In the following excerpt,
from David Mamet’s Glengarry Glen Ross, Levene talks himself into
trouble, by mentioning something that only someone who’d robbed the
UHDOHVWDWHR൶FHWKHSUHYLRXVQLJKWZRXOGNQRZ
SOLNESS: All this you told me must have been something you
dreamt.
Hilde makes an impatient gesture.
Oh... Wait a moment.... There is something mysteri-
RXVVRPHWKLQJED৾LQJDWWKHERWWRPRIDOOWKLV
I must have had such thoughts in my mind... I must
have wanted such a thing to happen... desired it to
come about... have a yearning for it... Could that be
the reason for it?
As I’ve just discussed, there is more than one type of turning point.
One of the two theories of scene form, which I’ll be discussing later, states
that “the climax of every scene is a turning-point, so that the climax of a
scene always results in the reversal of whatever was being striven for or
fought over during that scene.” This might mean that if two characters,
$DQG%DUH¿JKWLQJRYHUVRPHWKLQJDQG$LVTXLWHGRPLQDQWWKHQWKH
climax is that moment where B wins.
7RUHSHDWP\GH¿QLWLRQRIDWXUQLQJSRLQWThe still, (usually quiet)
moment of recognition on the part of a character. The turning point is
usually a moment of great pleasure for the audience, after which events
start moving toward or away from a character. One of the best turning
points in modern theatre is in Arthur Miller’s The Crucible. In that story,
John Proctor, has been accused of consorting with witchcraft and other
heinous things, but after a bit of 17th century plea bargaining, it looks
OLNHKH¶OOJHWR൵DVWKHDXGLHQFHZDQWVKLPWR)RUWKH¿UVWWLPHLQWKH
21st Century Playwriting 105
play, the audience can breathe freely. The mood among characters and
audience is one of relief. The hard work has been done and compromise
has been made on all sides. John Proctor will publicly admit that he was
involved in witchcraft, and is therefore spared from public hanging. There
just remains one small detail; a small matter of paperwork.
Reversal is not simply ‘not getting what you want’. It may also be
the temporary frustration of that want; or, worst of all, you get the exact
RSSRVLWH&KDUDFWHUVDQGUHODWLRQVKLSVFDQVX൵HUUHYHUVDOVLQVHYHUDONH\
106 7ංආඈඍඁඒ'ൺඅඒ
areas: fortune (that is, wealth, material prosperity etc); morals (from ‘good
guy’ to black-hat-wearing ‘bad guy’); values and beliefs.
As I indicate below, reversal is built into both scene structure and
play structure. A good scene climax often reverses the whole momentum
of a scene. (For example, she enters the room planning to sack him; but
by scene’s end, she is the one who has lost her job.) And as the section on
climax and resolution indicates, there is often a balancing tension between
these two, frequently involving reversal.
It’s not enough for lovers to die, for armies to be routed, for a person’s
goals to be achieved or end in failure. Those things may have driven the
SOD\WRLWVWHQVLRQ¿OOHGFOLPD[EXWWKRVHDFWLRQ¿OOHGFOLPD[HVDUHRIWHQ
108 7ංආඈඍඁඒ'ൺඅඒ
9. ENDING
7KHHQGLQJLVXVXDOO\DFRQ¿UPDWLRQRIWKHWKUHHFOLPD[HV,¶YHMXVW
discussed. Occasionally, however, there is a moment which actually
reverses the whole thrust of the play and even the story’s climax. Some-
thing may happen in the closing moments (or seconds) which threaten to
undo the good or bad work that constituted the climax. Paranoid thrillers,
vampire movies, and some operas work like this. In the movie, Three
Days of the Condor, Robert Redford’s character has spent most of the
PRYLH¿JKWLQJWKH&,$KLVIRUPHUHPSOR\HUV+HGHIHDWVWKHPDWWKH
end, and not only gets out of it alive, but is about to take his story to the
New York Times, so the whole world can learn about this villainy at the
heart of U.S. government. But the last words of the nasty CIA boss are,
“How do you know they’ll print it?” Redford freezes. The fear in his
face tells us they probably won’t. “They’ll always get you in the end”
is the real climax of meaning here.
Similarly, when all is lost, and Lohengrin (in Wagner’s opera of the
same name) has to take the next swan back to the land of the Holy Grail,
he leaves. But then something unusual (even for a Wagnerian opera)
happens: when the swan has delivered Lohengrin to a waiting boat, it
then returns... and turns into a young boy with a big sword, whom we
suspect will turn into a great hero even mightier than the one who just
left. In a moment, the tragic fatalism has turned into symbolic redemp-
21st Century Playwriting 109
tion. The story has been turned on its head. That is what a ‘climax of
meaning’ usually does.
111
&ඁൺඉඍൾඋ
NARRATIVE TYPES: OR KNOWING WHAT STORY YOU’RE
WRITING
the limitations of this chapter, even knowing what narrative area you’re
working in will assist you to gain greater consciousness of the imagina-
tive task ahead of you.
It is in that spirit that I give you a ready-made list of ‘play types’.
You may be able to add more to this list. I hope you do. If you add even
one more, then the aim of this chapter is achieved, for my real hope in
this chapter is that it changes your thinking about stories and their use
in stage plays, and that you end up being much more aware about these
narrative patterns and what, structurally, needs to happen in your play.
32 PLAY TYPES
Type 11: SET-DRIVEN PLAY. This is where the set plays a big
LQÀXHQFHRQWKHSORWDQGWKHFKDUDFWHUV(JPXFKIDUFHLQFOXGLQJ
Taking Steps. Ayckbourn, the author of that play, in particular
seems to enjoy the challenge of having a story unfold within an
idiosyncratic and highly restrictive set.
7\SH,112&(1&('(6752<('7KLVLVZKHUHWKHFRQÀLFW
in the story results in the destruction of the most valued, most
innocent member. Eg, The Wild Duck (Ibsen)
Type 19: THE VISITOR. Here, the visitor is often from the past,
EXWQHHGQ¶WEH5HJDUGOHVVWKHLUH൵HFWLVXVXDOO\FDWDVWURSKLF
whether comic or tragic. Eg, The Man Who Came To Dinner
(George S. Kaufman), The Nerd (Larry Shue), The Pillars Of
Society, Master Builder (both by Ibsen). The Visit of the Old
Lady (Friedrich Dürrenmatt). The visitor might, in allegorical
terms, be someone’s conscience or muse, or might be sinister, as
in Disappeared (Phyllis Nagy), a play about people who vanish
and is dominated by a mysterious stranger who seems to know
way too much about the people who have disappeared.
21st Century Playwriting 115
Type 20. DOCUMENTARY PLAY/VERBATIM THEATRE.
Where characters, closely drawn to real life, tell their stories
ZLWKOLWWOHRUQR¿FWLRQDOµGUHVVLQJXS¶(JAftershocks (Paul
Brown), The Laramie Project (Moisés Kaufman). There are also
HOHPHQWVRIWKLVVW\OHLQ6DUDK'DQLHO¶V¿QHSOD\Masterpieces,
DERXWSRUQRJUDSK\DQGLWVH൵HFWVODUJHDQGVPDOO
Type 31. THE LIVING ROOM PLAY. To write this type is often
an act of theatrical suicide, as there is nothing more dull than an
‘ordinary’ play set in that deadest of spaces, the ordinary living
room (from which most theatre goers have escaped to watch
something far more interesting.) In Chapter 6, I discussed how
SRRUO\WKHDWUHGHDOVZLWKLQWHULRUVSDFH6X൶FHWRVD\WKDWLI\RX
must set your play indoors, and in a living room, then extraordi-
nary things should happen there. Examples: Little Murders (Jules
)HL൵HU Abigail’s Party (Mike Leigh), and the living room play
to end all living room plays, Who’s Afraid of Virginia Woolf?
(Edward Albee).
In providing you with this working list, my aim has been to encourage
you to get your own structural antennae working, and get a feel for play
types and the narrative patterns that usually accompany them. If you’re
writing a particular ‘play type’, for example, you could do a lot worse
than study other plays of a similar type. The writers who’ve done it all
EHIRUH\RXPD\KDYHVRPHFOXHVDQGWHFKQLTXHVWRR൵HU
Doubtless, there are more types of plays. As I’ve said, a rich play
RIWHQ¿WVLQWRVHYHUDO2XUMREDVFUHDWRUVLVXOWLPDWHO\WRWUDQVFHQGWKHVH
types, or subvert their inbuilt expectations, so that what looked like a
predictable journey becomes strange and wonderful.
I’ll return to story and dramatic structure later in the book, but now
it’s time to tackle one of the biggest challenges of all: dramatic language.
119
&ඁൺඉඍൾඋ
DRAMATIC LANGUAGE (I): THE BASIC CONCEPTS & THE
DIFFERENCE BETWEEN THEATRE AND FILM DIALOGUE
not, you’ll never be told them. Your play will simply be rejected as “not
quite right for our theatre.” There are some unique features to dramatic
language. I spent several years writing in ignorance of them. This chapter
might save you a few such years of bad writing.
They are—
1. DIRECTIONALITY
“So anyway?, he went down the shop?, and when he got there, I wasn’t
there?, so he just went crazy?”
Music and language are closely related. The rhythms and lyricism of
language are used in varying ways in the examples we’ll look at.
“He lay on his back beside Leonie, holding her hand, his eyes
shut. She no longer saw secret promises in his face. She knew
what he promised and the secret involved the two of them. With
her hand he wasn’t holding, she touched his face. She followed
ZLWKWKHWLSVRIWZR¿QJHUVWKHFRQWRXURIDQH\HEURZDQGWKHQ
down the side of his nose, past the corner of his mouth, which
twitched when she passed it, to his chin. By touching his face in
this way she could make her feeling of familiarity more natural
and destroy a little of its mystery. She could localise the feeling
RIIDPLOLDULW\LQZKDWVKHIHOWLQKHU¿QJHUWLSV$QGWKXVVKHZDV
less overwhelmed by it.”
Let’s analyze this passage using the four tools I outlined. In terms of
directionality, it’s clearly ‘downward’. To prove this, simply read the pas-
sage out loud to yourself. The voice drops at the end of every sentence,
and often at the end of phrases. It is quite cool in its temperature, being
a highly introspective piece of writing. This is not atypical of the novel.
As a form, the novel is at its richest when it examines a small aspect of
human life in minute detail, placing every action or thought under a mi-
FURVFRSH7KHODQJXDJHLVGHVLJQHGWREHUHÀHFWLYHDOPRVWPHGLWDWLYH
:RUGVZRUWK¶VGH¿QLWLRQRIDUW³DUHFROOHFWLRQLQWUDQTXLOOLW\´VSULQJVWR
mind. The language is quite formal and elegantly constructed. Its rhythms
are gentle and subtle. The sentences are long, the phrases helping to extend
the meaning. The sentence ending is delayed, a bit like the way a Wagner
orchestral piece delays its cadence or resting points. There is a rich verbal
music at play here.
ALVY
(Sighing) Annie and I broke up and I— I still can’t get my mind
around that. You know, I— I keep sifting the pieces o’ the relation-
ship through my mind and— and examining my life and tryin’ to
¿JXUHRXWZKHUHGLGWKHVFUHZXSFRPH\RXNQRZDQGD\HDUDJR
we were... tsch, in love. You know, and-and-and... And it’s funny,
I’m not— I’m not a morose type. I’m not a depressive character.
I-I-I, uh, (Laughing) you know, I was a reasonably happy kid, I
guess. I was brought up in Brooklyn during World War II.
CUT TO:
INTERIOR. DOCTOR’S OFFICE. DAY.
MOTHER
(To the doctor) He’s been depressed. All of a sudden, he can’t do
anything.
DOCTOR
Why are you depressed, Alvy?
MOTHER
Tell Doctor Flicker. (To the doctor) It’s something he read.
DOCTOR
Something he read, huh?
YOUNG ALVY
The universe is expanding.
DOCTOR
The universe is expanding?
YOUNG ALVY
Well, the universe is everything, and if it’s expanding, someday it
will break apart and that would be the end of everything!
MOTHER
What is that your business? (To the doctor) He’s stopped doing
his homework.
YOUNG ALVY
What’s the point?
21st Century Playwriting 123
It (almost) goes without saying that this passage is very funny. But
WKHUHDVRQVZK\LWLVIXQQ\DUHWKHVDPHUHDVRQVLWLVKLJKO\H൵HFWLYHDV
dramatic writing. Note the informality and spontaneity of Alvy’s opening
speech. It is not so much dialogue as a record of a conversation, which
LVKRZLWDSSHDUVLQWKH¿OP,WVHQHUJ\LVUHOD[HGGHVSLWHWKHOHJHQGDU\
tension of its protagonist and authorial mouth-piece. There is a feeling
that Alvy is using language to work out the problem. The novel excerpt,
on the contrary, uses language as the FXOPLQDWLRQRIUHÀHFWLRQ (on the part
RIWKHDXWKRU7RRYHUVWDWHWKHSRLQWVRPHZKDWWKHQRYHOLVWUHÀHFWVDQG
WKHQH[SUHVVHVWKDWUHÀHFWLRQLQODQJXDJHZKHUHDV$OY\XVHVODQJXDJHWR
try and work out what the hell he means. It’s as if he is speaking in order
to discover, rather than speaking with full knowledge (and consequent
composure).
:KHQWKHÀDVKEDFNFRPHVLQWKHGRFWRU¶VR൶FHWKHUHLVDVLPSOLFLW\
here as well. There is an informal functionality. The language is designed
to convey simple statements of meaning: “He’s stopped doing his home-
work.” That is its main function. Not to convey emotion, or the struggle
of an inner state so much as to state facts or judgments: Alvy has been
depressed. The universe is expanding.
down you” take the piece well away from the cosy quasi-satirical realism
of the earlier Woody Allen excerpt. It is more colloquial, more vulgar than
WKH$QQLH+DOO¿OPH[FHUSWZKLOHLWVOLQJXLVWLFIRUPDOLVPVUHSHWLWLRQV
inversions, motivic fragments etc) approach the considered language of the
novel. And crucially, the direction is “up”. By this I don’t just mean that the
language is excitable and angry. Look at Carol’s line (No.73):
73. CAROL: Oh God, you’re crude. How could I have let you bring me
XS)OLQJPHXSPRUHOLNH,ZDVÀXQJWKURXJKWKH\HDUV
You need only say it to yourself to understand how the actress would
OHWWKHVHOLQHVKLWWKHURRI7KH\¿OOWKHVSDFHFRPSOHWHO\ZLWKWKHLUEUDQG
RI(DVW(QGUKHWRULFDOH[WUDYDJDQFH³,ZDVÀXQJWKURXJKWKH\HDUV´
This is, of course, not the only way to write theatrical language, or its
only form. There’ll be lots of times when you have to write cooler, more
meditative language, that is situated low down in the body and the theatre
VSDFH%XWLI\RXQHYHUWUDLQ\RXUVHOIWRZULWHELJH[WUDYDJDQWHQHUJ\¿OOHG
language, you’ll never really master writing for theatre. It’s that simple.
Once you know how to write “big”, you can always go down in scale,
LQWHPSHUDWXUHDQGLQDFRXVWLFDOLPSDFW<RXFDQDOZD\VVRIWHQDQGGL൵XVH
WKHGLUHFWLRQDOH൵HFWRI\RXUZULWLQJ%XWLI\RXGRQ¶W¿UVWSUDFWLVHWKHVH
techniques in a very direct manner, you’ll never reach the point where
\RXFDQXVHWKHPPRUHVXEWO\ZLWKHYHQPRUHH൵HFW
To put this whole point bluntly, I am encouraging you to get very
‘operatic’. Don’t treat theatre language as an exercise in social realism,
or gentle exercises of literature, or banally functional TV dialogue, or
HYHQVKRZR൵OLQHVRIZLWXQOHVV\RX¶UHDQ2VFDU:LOGH*RIRUEURNH
Write very big, and unruly. Let your language be an excitable, volatile and
almost untameable thing. Shakespeare’s ‘dialogue’ is like this. So is the
badly-behaved language of Mamet, Molière, Caryl Churchill, Jack Hib-
berd, John Romeril, Stephen Sewell, John Patrick Shanley, Sam Shepard
DQG6DUDK.DQHDQGPDQ\RWKHU¿QHWKHDWUHDUWLVWV
7KHWKHDWULFDOODQJXDJHRIWKHVHZULWHUVLVXQSUHGLFWDEOHDQG¿HU\
It is a weapon of great power. In the next chapter I’ll be discussing some
VSHFL¿FWHFKQLTXHVWKDWZLOODOORZ\RXURZQWKHDWUHZULWLQJWRJDLQLQ
power. This ‘power’ principle has been understood for centuries, both in
music and drama. When the Emperor said to Mozart, “Too many notes”,
he was expressing his distaste at Mozart’s rich extravagance. Think of
Arthur Miller. Why else do audiences queue round the block for the major
plays of this writer? It’s not because Miller’s plays are full of ‘themes of
VRFLDOVLJQL¿FDQFH¶,W¶VEHFDXVHWKH\¶UHH[FLWLQJWRKHDUWRZDWFKDQG
experience in theatre space.
21st Century Playwriting 127
Remember: audiences don’t mind intensity, emotion, excitement, char-
acters at white-heat speaking strongly physicalised language. They don’t
mind that in the least. It’s very rare that an audience says, “I’m sorry, I won’t
watch this. It’s too exciting.” But they’ve been known to say the reverse.
Line 4 lowers the energy hardly at all. Her answer is no match for
the insistent force of the question. (Strangely, in life and drama, repeated
questions retain their power, where as repeated answers often don’t.)
Line 5 raises the energy still further—and the actor will make sure
of that, if only to make the next line work.
Line 6 takes the full force of the energy of the previous line at its
peak, absorbs it, delivers it at full pitch, and lets the energy dissipate in the
space and the silence. But not for long, as Brenda has another question!
Without understanding the use of energy here, you will never be able
to create the crucial linguistic structure called the ‘build’. This is where
tension and energy are used to create invisible structures like Brenda and
Carol’s exchange. A build is a very exciting thing. It can go for a page or
more, achieving such an unbearable tension that the audience is all-but
screaming for relief. It is usually so grateful that it listens like mad to the
21st Century Playwriting 131
next part of the play. (I examine the ‘build’ in more detail in Chapter 14.)
,W¶VWLPHWRORRNDWVRPHVSHFL¿FWHFKQLTXHVWRLPSURYH\RXUDELOLW\
to write powerful dramatic language.
133
&ඁൺඉඍൾඋ
DRAMATIC LANGUAGE (II): S Y N TA X, P U N C T U AT I O N,
RHETORIC AND OTHER TOOLS OF DRAMATIC LANGUAGE
Emotion is the key that opens the door to the inner lives of charac-
ters in drama. Emotion belongs to the inner life, but for it to dominate
the drama, it must also dominate the language. Thus, every linguistic
aspect—syntax (sentence structure), word order and punctuation—
must serve to let the emotion communicate directly, with power and
ÀH[LELOLW\
Let’s put this another way: the easiest way to create exciting theatrical
language is to have the emotion so strong that it is in danger of wrecking
the language itself. The feelings and passions aroused are so powerful
that meaning itself is threatened.
There are two simple steps to this.
First, decide the nature of the inner life. Decide its dominant emo-
tions. Second, choose those linguistic devices that most directly express
those dominant emotions.
For example, let’s say a woman is driven by anger. Your creative job
is how to express that anger linguistically. You could write lines like, “I’m
really, really angry!”, but for reasons I’ll go into in the chapter on acting,
the audience will not believe her.
Here are some practical ways that you might ‘build anger into the
language’ of her scene:
— Toy with word order (syntax), which tells the audience that the emotion
LVVRVWURQJDQGVRGHHSWKDWLWLVD൵HFWLQJHYHU\SDUWRIKHU
— Use punctuation to express the inner chaos. This, along with a mixed-up
word order, will show that the emotion is in charge of the character,
rather than the reverse.
— Show the character struggling with the power of her own emotions.
Make it uncertain as to which force will win: emotion or reason;
rationality or incoherence.
134 7ංආඈඍඁඒ'ൺඅඒ
“I was driving to Las Vegas to tell my sister that I’d had Mother’s
respirator unplugged. Four bald men in the convertible in front
RIPHZHUHSLFNLQJWKHVFDEVRৼWKHLUVXQEXUQWKHDGVDQGÀLFNLQJ
them onto the road. I had to swerve to avoid riding over one of
the oozy crusts of blood and going into an uncontrollable skid.
I manoeuvred the best I could in my boxy Korean import but my
mind was elsewhere. I hadn’t eaten for days. I was famished.”
that time you went back that last time to look was the ruin still
21st Century Playwriting 135
there where you hid as a child when was that (eyes closed) grey
day took the eleven to the end of the line and on from there no
no trams then all gone long ago that time you went back to look
was the ruin still there where you hid as a child that last time not
a tram left in the place only the old rails when was that
In this excerpt from his short play That Time, Beckett dispenses with
the idea of character as a sociological ‘type’. The language with its many
motifs (that time, still there, all gone etc) becomes a direct meditation on
human experiences such as memory, loss, reiteration and recovery through
ODQJXDJH,W¶VDGL൵HUHQWGUDPDWLFH[SHULHQFHIURPSOD\VZLWKDVWURQJ
and immediately recognisable social surface. Beckett does not ask his
audiences to socially identify with the characters. His dramatic language
triggers deep emotional and psychological responses in its audience. Its
PHDQVDUHPRUHGLUHFWWKDQVD\DVRFLDOFRPHG\ZKLFK¿UVWVHHNVWRSODFH
the audience in the middle of its social landscape (e.g. upstate New York).
In essence, Beckett says that none of that matters. If you feel the same way,
then all you need to do is create a dramatic language that is as musical,
imagistic, linguistically-controlled and mesmeric as his. Simple really.
Another way to see theatrical language is as a type of verbal opera,
where the inner rhythms of sentences and the lyrical, imagistic power of
ZRUGVDOOFRPELQHWRPDNHDSRZHUIXOH൵HFWTXLWHRXWVLGHWKHOLPLWDWLRQV
of realistic plot and socially-recognisable characters. If you accept my
view that the purpose of drama is to dramatize the inner life more than the
social outer layer, then language which speaks directly to a non-rational,
pre-conscious imaginative self is crucial.
²'ൺඌඁൾඌ
Interrupted energy is exciting. To have an actor rushing toward a
point, only to pull up short makes for a suspenseful moment. The audience
wonders what was going to be said, or better still, it tries to work out the
end of the sentence. A crucial factor comes into play with fragments of
language and uncompleted sentences. No example is needed—I hope—at
least, if you’re like me—and if you’re reading this book I think you are—
I mean, like me—or enough at least to be interested in the topic—then
your own writing—your own thinking—will be full of it. Enough said.
'ඈඍඌ(අඅංඉඌංඌ
Davies, in Pinter’s The Caretaker, speaks frequently in a type of
halted or semi-paralysed English:
21st Century Playwriting 137
DAVIES: Well, I… I never done caretaking before, you know… I
mean to say… I never… what I meant to say is… I never
been a caretaker before.
7ඁൾ&ඈආආൺ
The comma extends the sentence. To use a musical term, it ‘delays
the cadence’, and prevents the energy in the sentence from petering out
too soon. This excerpt from Tom Stoppard’s Jumpers uses the comma to
mark the inner phrases (and thus the performing contours) for the actor:
3ൺඋൾඇඍඁൾඌൾඌ
'UDPDWLFODQJXDJHµLQSDUHQWKHVHV¶LVTXLWHXVHIXO,WLQGLFDWHV¿UVW
to the actor (and then, the audience) that there is another level, another
LQÀHFWLRQRI PHDQLQJSRVVLEOH ZKLFK KHOSV WR FUHDWHWKHQHFHVVDU\ LO-
lusion of character complexity. Edmond, in David Mamet’s play of the
same name, is talking to his wife, who is visiting him in jail, where he
languishes as a murder suspect:
(එർඅൺආൺඍංඈඇආൺඋ
$QDFWRUWROGPH\HDUVDJRWKDWWRKLPWKHJRRGSOD\VµOHDSR൵WKH
138 7ංආඈඍඁඒ'ൺඅඒ
page’. I spent some time puzzling over what he meant, before realising that
he was talking about the way that good dramatic language has something
‘locked’ inside (energy, tension, rage, comic frenzy, innate physicality
etc) which can be sensed even on reading. The exclamation mark, by its
very nature, contains a locked-up energy which even the reader can see is
straining for release. A brief but powerful moment from Stephen Sewell’s
The Blind Giant is Dancing illustrates this:
"4ඎൾඌඍංඈඇ0ൺඋ
As I indicated earlier in the book, simply asking a question creates
tension. Shakespeare knew this. The opening of Hamlet, already tense
and exciting, is made more so by the number of questions.
In a more introspective sense, a character who questions himself is
already on a higher plane of awareness. He is a ‘bigger’ character, simply
by the act of self-questioning.
CAPITAL LETTERS
An example is Sam Shepard’s A Lie Of The Mind, where Beth, beaten
to a brain-damaged state, declares her love:
MIKE: This guy tried to kill you! How can you still want a man
who tried to kill you! What’s the matter with you! He’s
the one who did this to you!
BETH: HEEZ MY HEAAAAAAAAAAAAAAAART!!
)ඎඅඅ6ඍඈඉඌ
Be careful with full stops. A full stop, by its very nature, tends to stop the
energy dead in its tracks. Sometimes, however, that very abruptness and cur-
tailing quality is what you want to express the particular dynamic of your lines.
21st Century Playwriting 139
Then again, there are always the amazing and dynamic speeches from
David Mamet’s Oleanna:
7ඁൾ&ඈඅඈඇ
7KHFRORQLVXVHIXOZKHQ\RXZDQWWRFUHDWHDVSHFL¿FIRFXVZKLFK
says to the other character (or audience): “Listen very hard to what I am
about to say.” An example is from my play, The Moonwalkers, where
Joseph is, in his own spaced-out way, trying to assist a woman’s search
for understanding of the relationship between fertility and the universe.
-26(3+ $VKRUWOLVWRIHৼHFWV2QHWKHJUDYLWDWLRQDOHৼHFWRQ
ÀXLGVIURPDWHDFXSWRDNLQJWLGH7ZRWKHYDULDEOH
light shining on the earth from raging light to utter
darkness. Three: the electrical charging of atoms, espe-
FLDOO\LQDVWRUP)RXUWKHHৼHFWRQWKHKRUPRQHVDQG
the endocrine system of the female body. It’s all there.
There are other punctuation signs such as the semi-colon; but despite
\HDUVRIH൵RUW,¶YHSHUVRQDOO\QHYHUIRXQGDGUDPDWLFRUOLQJXLVWLFXVH
for the semi-colon; it’s one of the failures of my professional life; I wish
you better luck.
/LNHDOODUWIRUPVWKHDWUHLVµDUWL¿FLDO¶,WLVEDVHGRQFXOWXUDODQG
KLVWRULFDORSLQLRQVZKLFKFKDQJHVLJQL¿FDQWO\RYHUWLPH,I\RX¶UHQRW
sure of that, just look at 18th century drama and see how ‘old’ the language
feels.) The following common, contemporary dialogue patterns are those
ZKLFKDUHH൵HFWLYHLQWKHHDUO\\HDUVRIWKHst century. In a century, or
less, they will also feel old; but for now, study them and use them to the
extent they serve your creative purposes.
3ൺඍඍൾඋඇ4ඎൾඌඍංඈඇ$ඇඌඐൾඋ
The Q & A is probably the most common pattern in all drama. The
ability to ask a question—and receive an answer is fundamental to human
140 7ංආඈඍඁඒ'ൺඅඒ
experience and society. It’s one of the reasons the ancient Greeks added a
new character to their tragic drama. Look again, at the wonderful moment
from Jim Cartwright’s Road:
3ൺඍඍൾඋඇ4ඎൾඌඍංඈඇ4ඎൾඌඍංඈඇ
A question, by nature, raises the tension level in most human encoun-
ters. It is intrinsically dramatic.
Sometimes, the powerful person is the one who does not answer.
1RWLFHKRZWKHµQRUHVSRQVH¶SURYLGHVDUK\WKPLFQHDUPHVPHULFH൵HFW
on both page—and theatre space.
3ൺඍඍൾඋඇ4ඎൾඌඍංඈඇ'ංൿൿൾඋൾඇඍ$ඇඌඐൾඋ
This is a very useful pattern, because it creates complexity and richness.
ALAN: What do you think I am? Do you think I like being treated
like that?
BOB: So much misery. So much unhappiness.
It’s not simply the fact that ‘two characters are not on the same
wave-length’. One of the characters (Bob) is, in fact, on the M-Level, the
Metaphysical, while the other, Alan, remains on the E-Level, that of the
Psychological. So many nuances, levels and subtleties are possible with
WKLVVLPSOHGHYLFHZKHWKHUXVHGEULHÀ\RULQDPRUHH[WHQGHGEHDW6HH
Chapter 17 for more on how to mix these levels in your writing.
3ൺඍඍൾඋඇ6ඁඈඋඍඊඎൾඌඍංඈඇඅඈඇൺඇඌඐൾඋ
Unbalanced texture is our friend. Unbalanced texture gives both
freedom to the actors, and mental space to the audience.
3ൺඍඍൾඋඇ/ඈඇඊඎൾඌඍංඈඇඌඁඈඋඍൺඇඌඐൾඋ
This pattern is the reverse of the previous one.
There are two ways to ‘see’ characters who speak more than other char-
acters: either they have a lot of power—or they have very little power at all.
(Curiously, the former tends to be the American choice; the latter tends to be a
more British characteristic.) Either the character is talking because he is weak,
or because he is strong, and his dominance of the conversation is his way of
showing that he is in charge. Or not. Pinter uses both approaches. So can you.
3ൺඍඍൾඋඇ$ඌඌൾඋඍංඈඇ5ൾൻඎඍඍൺඅ
It’s a little-known fact that human conversation is not innately the-
atrical, let alone dramatic. Unless conversation is invested with either
dramatic stakes (in the more realist modes) or irony, paradox and wit (in
the less realist, more modernist theatrical modes), the more dangerous it is
to have your characters ‘just talking’. It’s a peculiarly American problem,
I think, because of the strong humanist focus in our theatre writing. At its
most banal, it comes across simply as ‘nice people talking about ordinary
things’. It’s usually not enough to engage the audience.
So, at the very least, raise the dramatic stakes of every engagement.
3ൺඍඍൾඋඇ$ඌඌൾඋඍංඈඇ$උൾൾආൾඇඍ
7KLVSDWWHUQDOVRR൵HUVDZD\RXWRIWKHFKDUDFWHUVµMXVWWDONLQJ¶WR
each other.
21st Century Playwriting 143
MIRANDA: I’m, like, so dumb! So stupid! So jackass ignorant!
JACK: You are, my sweet. But so are my enemies. You, on the
other hand, have more than just me as a friend. You
have me, my total authority and scholarly integrity, all
working for you. On your side. As your ally.
&RQÀLFWLQGLDORJXHQHHGQRWDOZD\VEHWKH¿UVWDXWRPDWLFUHVSRQVH
Sometimes, if a character asserts that something is true (as in the above
example), your second character can surprise by agreeing with her.
3ൺඍඍൾඋඇ6ඍൺඍൾආൾඇඍ4ඎൺඅංൿංർൺඍංඈඇ
Statements are a little dull, dramatically speaking. They usually need
some ‘edge’ to them. One way is to make your other character qualify or
DGGQXDQFHWRWKHEDOGVWDWHPHQWWKDWWKH¿UVWFKDUDFWHUPDNHV
JACK: I think I’ve got it, you know. The rights, for translation.
LINA: For Derrida’s book?
JACK: I spoke to him. In person.
LINA: In Oslo.
JACK: Copenhagen.
LINA: At the dinner.
JACK: The forum.
LINA: You ran into him at the lift.
JACK: The escalator. I told him: “I’d love to translate that
book of yours.”
This type of linguistic exchange is innately paradoxical, and can be
ERWKFRPLFDQGVHULRXVLQLWVH൵HFWGHSHQGLQJRQWKHQDUUDWLYHFRQWH[W
3ൺඍඍൾඋඇ2ඉංඇංඈඇ&ඈඎඇඍൾඋඈඉංඇංඈඇ
Like the last couple of patterns, an opinion is not innately dramatic.
It needs more.
In this case, if you have one opinion, then try ironising that single opin-
ion by even more opinions. Stoppard does that frequently in his later plays.
144 7ංආඈඍඁඒ'ൺඅඒ
4. $QVZHUDGL൵HUHQWXQDVNHGTXHVWLRQ
6. Do an action-in-response.
10. Give a rhetorical answer (especially useful when dealing with a literal
question, as in this case.)
(SHPERO\LQVHUWLQJDGL൵HUHQWWKRXJKWLQWRWKHPDLQLGHDZKLFKHQGV
up reinforcing that main idea.)
$QDSKRUDRU/LWDQ\(൵HFWUHSHDWLQJWKHVDPHLGHDWKURXJKRXWDOLQH
Why should the white man be running all the stores in our com-
munity? Why should the white man be running all the banks in our
town? Why should the whole economy of our community be in the
hands of the white man?
(Malcom X)
Hyperbole (Over-the-top exaggeration.)
Give it to us yesterday—and that’s not fast enough!
(Malcom X)
Ask not what your country can do for you; ask what you can do
for your country.
(John F. Kennedy)
Antonomasia
The last example brings me to one of the best ways to create rich
theatre language: by use of the techniques of imagistic writing.
IMAGISTIC WRITING
This beautiful moment comes out of quietness, and takes the audience
deeply into the inner life of Enid. This is not simply a travel description
of Athens. Enid has responded deeply to what she saw, and she has a
deeply personal reason for speaking. Her father was killed in Salonika.
The present is merging with the eternal past.
There’s a great deal of rich writerly technique in this apparently
‘simple’ speech. Nearly every linguistic device that goes to create imagistic
writing is present here.
—Imagistic writing uses the sense of sight, in particular that of colour.
The very mention of “white”, for example, will have the audience
imagining their own version of white.
—Imagistic writing uses, not just colours and sight, but intensities of light.
“The dark of doorways… brown eyes… white teeth”.
—Imagistic writing uses the sense of sound. Sound is implied by the
city being described. There’s an acoustical component that our mind
recognises when, for example, we hear of a “past crumbling.” Think
of the storm and thundering built into Lear’s line on the heath: Blow,
winds, and crack your cheeks.
—Imagistic writing uses the sense of touch. Statues crumble. We’ve all held
something in our hand and felt it disintegrate and crumble. Good imagistic
21st Century Playwriting 149
writing calls on our sensual memory to make the moments come alive.
—Imagistic writing uses nature, culture and civilisation as its metaphorical
building-blocks. Often there is a dialectical opposition, a paradox, an
imperfection. Monumentalism is fragmented (with chipped statues).
Nature is stunted or dying. There is a ‘canker in the rose’, or the
buildings may be crumbling before our very eyes.
—Imagistic writing uses VSHFL¿FLW\,PDJHVWHQGWREHLQWHQVHO\VSHFL¿F
To write, “The statue had parts missing” is too abstract, too general.
2XUDWWHQWLRQLVIRFXVVHGRQWKHQRVHVWKH¿QJHUV6LPLODUO\WKHLPDJH
of people in doorways is made memorable because it is not the young
boys who are looking out from doorways, it is as if their brown eyes
and white teethKDYHDOLIHRIWKHLURZQ7KHWHFKQLTXHRIVSHFL¿FLW\
has a lot in common with the movie camera that pans in for a close-up.
It is as if the mystery of lives are revealed in their tiny, incomplete
details. Thus, imagistic writing uses an almost cosmological sense
of the “whole”, ironically by showing its opposite. Note the sense
of perfection contrasted with imperfection; completeness contrasted
with fragmentation: gods and goddesses with their noses chipped.
—Imagistic writing uses the rhythms of poetry, such as word repetitions
(white, white teeth) and motivic repetitions (“everywhere... everywhere”)
—Imagistic writing has a cast of (epic) characters with implicit dramatic
stakes. In the speech quoted above, danger lurks in every dark
passageway: are the smiling boys just friendly—or are they potential
thieves and assassins?
HEIGHTENED LANGUAGE
If language is a type of displaced music, then, like music, it has its own
notation. Sometimes the notation is simple—a full-stop here, a comma there.
21st Century Playwriting 151
%XWDWRWKHUWLPHV\RXZLOOZDQWWRFUHDWHDPXFKULFKHUPRUHFRPSOH[H൵HFW
&DU\O&KXUFKLOORIWHQFUHDWHVWH[WXUHVZKLFKFUHDWHYHU\VSHFL¿FDQG
detailed instructions to the actors. For example, when one character starts
speaking, Churchill marks the point at which she should be interrupted
by the next speaker (usually indicated by a /). At other times, a character
continues speaking right through another’s lines, as Jake does here:
JAKE: No, it’s just... I’m in a spot of bother with the authorities/
but it’s no problem. I’m sorting it/
SCILLA: What have you done?
JAKE: /out, it’s more what the sorting might lead to.
(from Serious Money)
The point to this ‘notation’ is to encourage you to think both richly and
ambitiously. It’s not just a matter of “A asks a question, and B answers.”
0DQ\PRUHYHUEDOH൵HFWVDQGWH[WXUHVFDQEHFUHDWHGZKHQ\RXUHDOLVH
WKDWODQJXDJHFDQEHSLOHGRQWRSRILWVHOIMXVWDVFRQÀLFWLQJHPRWLRQV
can. In fact, the two often appear together.
Here is a rough list of the types of spatial and dialogue directions you
can create in your plays.
1. The most common direction of all—a two-way channel. Character
A talks to character B, who replies.
4. Characters A and B talk to each other, but A also talks to the audience.
5. &KDUDFWHUV$DQG%¿UHOLQHVDWHDFKRWKHUZKLOH$DOVRDGGUHVVHV&
6. &KDUDFWHUV$%DQG&DUHDOOZRUNLQJR൵HDFKRWKHU
21st Century Playwriting 153
7. Characters A and B are both talking at each other, while C is dealing
ZLWKVRPHWKLQJRUVRPHRQHR൵VWDJH
Many combinations are possible, and the list above is not exhaustive.
The spatial richness of theatre can be increased by having a variety of
dialogue directions operating, and these can be happening simultaneously.
A lot of things happening at once can make for very exciting theatre.
When you are writing your scenes, ask yourself how you can increase this
simultaneity. It’s often just a matter of bringing more plot on, and more
characters on at the one time. This helps with the problem of endless two-
header scenes; for one of the things to avoid in play writing is a play that
is full of scenes where only two characters appear who talk to each other
and then disappear, only to be replaced by another two characters that do
the same. A succession of two-header scenes is a sure guarantee of dull-
ness—unless the dramatic stakes are very high—and maybe not even then.
CAUSALITY IN DIALOGUE
AMBIGUITY IN DIALOGUE
VERSION 1:
Let me give two versions of how you might eliminate the overwriting
in this excerpt.
VERSION 2:
VERSION 3:
times, you will want to create a rhythmic texture that uses such repetitions
as I’ve shown here. Or you may want to have a build that requires more
indirectness and parrying on the part of the characters. The context will
determine how much overwriting you use. But the audience should be
aware of the context: for example, if a character is speaking little because
he is guilty about something, make sure that’s clear (or clear enough to
be surmised by the audience.)
In a rich play, language shares the theatrical space with other as-
pects—physicality, gesture, action, sound and lighting. To allow room
for these other aspects, try the following.
²+DYHDFKDUDFWHUVSHDNRQO\µWKHLPSRUWDQWVWX൵¶7KLVLQWURGXFHVDQRWKHU
XVHIXOSULQFLSOHWKDWWKHEHVWGLDORJXHLQ¿OPDQGWKHDWUHLVthe line
as culmination of a thought. This means that a chain of reasoning is
set up, but only the crucial part of the line is spoken. See much of your
dialogue as the culmination of a powerful and complex thought-life.
— Suggest a powerful emotion, and let that emotion do the work. (See
next point.)
— Make the emotion too strong for words, or at least too strong for full, measured
sentences. “I really think we should... Oh, God!” is more emotionally pow-
erful and suggestive than “I really think we should just calm down and look
at the situation as calmly and honestly as possible.” Seeing the actor unable
to complete the sentence and trying to calm himself is more interesting.
21st Century Playwriting 159
— Front-cut and end-cut. I use this term to describe how the true essence
of a line can be found by cutting away from the front and back of the
dialogue. Imagine a line like this: “You know, when all’s said and
done, I really think that the problem is that I can’t stand being in the
same room as you. I really can’t. I’ve felt this for a while, and I’ve
¿QDOO\ZRUNHGXSWKHFRXUDJHWRVD\LW´
The real essence of this over-wrought line is: “The problem is, I don’t
like you.” He may illustrate this startling observation with something even
crueller: “I can’t (even) stand being in the same room as you!”
DISCORDANT DIALOGUE
0RVW GLDORJXH LV FRQÀLFWEDVHG 5HPHPEHU WKH 0DPHW SULQFLSOH
³8QOHVV\RXKDYHWZRFKDUDFWHUVZKRZDQWVRPHWKLQJGL൵HUHQW\RXGRQ¶W
have a scene.” This is nearly always true. Simple opposition between char-
acters is the easiest way to learn how to write powerful theatre language.
It teaches you to become and stay focussed. It forces you to concentrate
on one issue/problem at a time.
But once you’ve done that, you’re then ready to do really interesting things.
CONCORDANT DIALOGUE
The danger with having too much of your theatrical language built
around confrontation, is that, at its heart, oppositional dialogue is built
around morality. “You’re a son-of-a-bitch!”, “No, I’m not.” What writers
sometimes call “exciting dialogue” is often just a series of angry, moral
exchanges. But as we’ve seen, theatre works best when it is working on
multiple levels. In the above example, there is eroticism, imagination
and myth at work. Just as with Shakespeare, Ibsen’s work is constantly
reaching toward the metaphysical. Note how the shared vision is assisted
by the push of both characters. Great ‘acting waves’ can be built up by
exchanges such as these. They are theatrically very exciting. (For more
on the Acting Wave, see Chapter 14.)
PARALLEL DIALOGUE
Rather than have two angry characters shout at each other, you can
FUHDWHDVXEWOHUDQGULFKHUGUDPDE\EXU\LQJWKHSDLQDQGFRQÀLFW:KHUHDV
concordant dialogue has the characters share in the vision being created,
SDUDOOHOGLDORJXHDOWHUQDWHVWZRFRQÀLFWLQJYLVLRQVDVLQWKHIROORZLQJH[-
change from my play The Don’s Last Innings. A man is obsessed with the
myth and memory of a famous Australian cricketer, and each night replays
WKHGHDGPDQ¶V¿QDOLQQLQJVLQDEL]DUUHVSRUWLQJDQGPDULWDOULWXDO
JOHN: When I see you, I’m speechless. When I see you, it’s
all I can do not to cry out with joy.
The structure is this:
Peter Kenna’s play A Hard God ends magically, not least because it
invokes the ancient verbal/religious formalism of the litany.
7KHSUD\HUIDGHVRৼWRDPXPEOHDQGULVHVDJDLQIRUWKHVHFRQGSDUW
(She pauses. Her lips cannot frame the words ‘our death’. With a great
HৼRUWVKHPRXWKVWKHPVLOHQWO\DVWKHOLJKWVGLH
162 7ංආඈඍඁඒ'ൺඅඒ
+HUHLVDOLVWRISRVVLEOHÀDZVDQGPDQQHULVPVWKDWPD\EHXVHIXOLQ
drawing up your character.
21st Century Playwriting 163
— Stuttering.
— Spoonerisms and other malfunctions of word order.
— Lisp.
— Unusual rapidity or slowness of speech.
— Malapropisms, such as Sheridan uses (with Mrs. Malaprop).
— Clichés and favourite expressions. Ibsen has the dull, unimaginative
Tesman (Hedda Gabler’s husband) say, “Eh?” as a stock response
to widely varying situations. Beware of over-doing this, however.
— Pretension in choice of language (Think of Malvolio here.)
— False modesty in the use of language.
— A voice quality unusual for its thinness, thickness, breathiness, harsh-
ness, loudness, softness, a sing-song quality or a monotone state.
ing of value in their actual words. But a lot is being communicated about
the person herself.
WILLS: They’ve just taken a turn against the whole lot of them,
I tell you. Male elbow adaptors, tubing nuts, grub
screws, internal fan washers, dog points, half dog
points, white metal bushes—
FIBBS: But, not, surely not, my lovely parallel male stud
couplings.
WILLS: They hate and detest your lovely parallel male stud
FRXSOLQJVDQGWKHVWUDLJKWÀDQJHSXPSFRQQHFWRUV
DQGEDFNQXWVDQGIURQWQXWVDQGWKHEURQ]HGUDZRৼ
FRFN ZLWK KDQGZKHHO DQG WKH EURQ]H GUDZ Rৼ FRFN
without handwheel!
),%%6 1RWWKHEURQ]HGUDZRৼFRFNZLWKKDQGZKHHO"
WILLS: And without handwheel.
&ඁൺඉඍൾඋ
DRAMATIC LANGUAGE (III): MODERNISM AND ITS TECHNIQUES
7KLV FKDSWHU GHDOV ZLWK VRPH WHFKQLTXHV VSHFL¿F WR PRGHUQLVP LQ
particular, six aspects of language that are central to modernist dramatic
technique. These should also be of interest to writers whose technique is
founded on individual psychology and ‘representation’ (that is, showing
PRUHRUOHVVVRFLDOO\LGHQWL¿DEOHSHRSOHLQUHDO¿FWLRQDOQDUUDWLYHVLWXDWLRQV
This should not be misunderstood, however. The techniques are not
separate from linguistic and dramatic technique covered in the previous
two chapters. As I’ve said repeatedly in this book, our job as writers is
to blend the dominant aesthetics of our time—humanism and modern-
ism—into an exciting and formidable expressive tool.
This chapter should also provide further evidence of a central part of
my approach: that is, that language creates characters, who then re-create
language to suit the needs of the (dramatic) moment. For the ‘secret’ of
DFKDUDFWHULVXVXDOO\IRXQGLQOLQJXLVWLFPHDQV¿QGLQJWKHULJKWSKUDVH
searching out the verbal motif that is expressive on many levels—psycho-
logical, physical, rhythmic) and once found, the character’s ‘secret lan-
guage’ becomes the means whereby the deep secrets of self are uncovered
and sought to be expressed. See it this way: if a character can express her
innermost thoughts, she can understand them. As the proverbial old lady
said, “How do I know what I think (or feel) until I hear what I say?” That
is a quintessential dramatic condition. The dramatic character owns his
VRXORUDWOHDVWXQGHUVWDQGVLWZKHQKHFDQ¿QGWKHULJKWZRUGV2QO\
then can he ‘own’ both the words, and his soul. But ownership does not
come easily. Part of the psychological struggle (and joy for the theatre
audience) is “how to express what I feel”. The struggle is, at times, so
strong that language itself is in danger of being demolished. As I’ve said
before, the inner life should be so strong that it is in danger of wrecking
the only means (physical or verbal) to express that inner life. Emotion
GRPLQDWHVODQJXDJH(PRWLRQZUHFNVODQJXDJH%XWODQJXDJH¿JKWVEDFN
One of the greatest dramatic and linguistic weapons the writer has at
her disposal is the power of repetition. Beckett is one of its great exponents.
But Beckett, along with Ionesco, the greatest of the modernists, did not
discover it. It is centuries old. It is a basic musical stylistic resource. The
basis of Western music’s ‘theme and variation’ lies in the same aesthetic:
168 7ංආඈඍඁඒ'ൺඅඒ
that some things are repeated and give the work unity, and others are
varied and give the work variety.
:HPLOGHUZULWHUVVFKRROHGLQWKH¿OPGULYHQµ3HRSOHGRQ¶WWDON
like-this’ aesthetic, would have stopped there. But not Shakespeare:
Having warmed up, Shakespeare pushes on, reaching its peak with this:
(It’s worth noting, in passing, that this word was fairly new in Shakespeare’s
time, and moreover, was pronounced ‘bani-shed’ with an emphasis on the last
V\OODEOH7KHH൵HFWLQSHUIRUPDQFHLVGHYDVWDWLQJIXUWKHUHYLGHQFHIRUP\YLHZ
WKDW6KDNHVSHDUHLVWKHRQO\GUDPDWLVWZKRFRPSOHWHO\¿OOHGWKHDWUHVSDFHWR
its maximum. Even a great writer like Beckett ‘scaled down’ the cosmos of
21st Century Playwriting 169
theatre space until it was airless and of a near-terrifying claustrophobia. In
6KDNHVSHDUH¶VFRVPRVWKHUHLVDLUHDUWKIUHHGRP²DQGWKHYROFDQLF¿UHRI
language that appears spontaneous but hits several levels of meaning at once.)
For an example of Beckett’s use of motivic repetition, see the excerpt
from That Time in Chapter 11. Caryl Churchill, however, uses repetition in
a more literal way, in her play A Mouthful of Birds, but disperses it so that
WKHH൵HFWLVERWKUHSHWLWLYHDQGFKRULF1RWHDOVRWKHXVHRIOLWDQ\WHFKQLTXH
Excuses: III.
LENA: I can’t come in for a perm, my sister’s been kidnapped.
<9211( ,FDQ¶WJRWRWKHGLVFRWKHDUP\¶VFORVHGRৼWKHVWUHHW
DOREEN: I can’t come to dinner, there’s a bull in the garden.
DEREK: I can’t play tonight, my house has blown down.
'$1 ,FDQ¶WVHHWKHELVKRSWKHYHVWU\¶VRQ¿UH
PAUL: I can’t meet the deadline. The chairman’s been struck
by lightning.
MARCIA: I’ll have to see the dentist another time, my aunt’s
gone crazy.
LENA: So I just stayed in all day.
In the rich theatrical aesthetic of the 21st century, an actor is both char-
acter and performer. This might be temporary and situational (for example,
if a character momentarily imitates another character in the play) or it might
be embedded in the play’s very structure. The latter is the case with Sarah
Kane’s play Crave. The play uses four performers. They do not represent
¿[HGFKDUDFWHUVVRPXFKDVDµ¿[HGVWDWHRIPLQG¶,WLVDVLIWKHUHDUHIRXU
voices (A, B, C and M) inside a single personality or mind. At various times,
performer/voice A is in despair or exultant, then its B’s turn etc. Its total ef-
fect is highly musical, as linguistic motifs, ideas and sentiments are shared
URXQGFUHDWLQJDQH൵HFWVRPHZKHUHEHWZHHQVFDWVLQJLQJDQGDVWULQJTXDUWHW
5$&(&$//(5$QGWKH\¶UHRৼDQGUDFLQJKH¶VGURSSHGLWKH¶VGRQH
his lolly, just two laps to go, the ball’s in the air, it’s long
and high, if it’s straight, she’s turning, a good run, it’s
LQWKHEDJD¿YHPHWHUSHQDOW\KHZRQ¶WFRSWKDWDZ
fair go, ref!, he’s sin-binned, but it’s way too late, as the
full-time hooter sounds, and she’s gone for gold,and the
winners are grinners…
The above excerpt, reconstructed from scribbled notes, gives only a
21st Century Playwriting 171
IDLQWLGHDRIWKHWRWDOH൵HFW6RPHRIWKHIRONMDUJRQLVLQFRPSUHKHQVLEOH
even to Australians. But that is half the point and the pleasure. Words
were dispersed, tossed in the air, chopped, mangled and diced till even
the familiar clichés had a ring of strangeness. It was as if the audience
was being taught to listen—as well as see—all over again. Surely that’s
the idea of theatre, to aesthetically educate even as it entrances. Had
the clichés been presented realistically, in social realist fashion, no such
transformation of understanding would have occurred.
This technique has a link to the fourth linguistic feature of modernism:
:KHQD¿VKLVRXWRIZDWHULVLWVWLOOD¿VK"$QGIRUKRZORQJ":KHQ
the familiar cliché is placed in an unfamiliar context, is it still a cliché?
The point I am suggesting here is that the art of ‘making an audience see
anew’ is easily brought about when familiar language is stripped of the
social/emotional context it usually occurs in.
The great French-Belgian dramatist Eugène Ionesco knew this. His
¿UVWSOD\La Cantatrice Chauve (usually translated as The Bald Prima
Donna) has the matriarch of a ‘typically English’ family sitting around
sprouting clichés of language (and language-learning):
MRS . SMITH: Goodness! Nine o’clock! This evening for supper we had
VRXS¿VKFROGKDPDQGPDVKHGSRWDWRHVDQGDJRRG
English salad, and we had English beer to drink. The
children drank English water. We had a very good
meal this evening. And that’s because we are English,
because we live in a suburb of London and because
our name is Smith.
On and on she goes, creating an over-explained reality that is so
RUGLQDU\DQGEDQDOWKDWLWLVLQH൵HFWUDWKHUPDG6LPLODUO\ODWHURQLQ
the play when Mr and Mrs Smith have a conversation about people, all
of whom are called Bobby Watson.
MRS. SMITH: You know, don’t you, they have a boy and a
girl? What are their names?
MR. SMITH: Bobby, and Bobby—like the parents. The uncle of Bobby
Watson, the older Bobby Watson is rich and he’s very
fond of the boy. He may be given charge of Bobby’s
education.
05660,7+ 7KDW¶GEH¿WWLQJ$QGWKHROGZRPDQ:DWVRQ%REE\
Senior, she could be asked to look after the education
172 7ංආඈඍඁඒ'ൺඅඒ
GEORGE: When you made that gesture with your hand I suddenly
QRWLFHGWKHULQJVRQ\RXU¿QJHUVDQGWKRXJKWWRP\VHOI
Ah, rings! Look at that, rings! Indeed: rings! And then
I saw the rings again, and when what I thought and
what I saw coincided so magically, I was so happy for
a moment that I couldn’t help but put the cigar box in
your hand. And only then I noticed how ridiculous I had
seemed to myself speaking all that time about kidneys
ÀDPEp,ZDVQ¶WHYHQP\VHOIDQ\PRUHP\KDLUVWRRG
on end when I spoke about them. And only when I saw
the rings and thought: Ah, the rings!, and then cast a
21st Century Playwriting 173
second glance at the rings, did it seem to me as if I were
no longer confused.
%XW*HRUJHLVQRW\HW¿QLVKHGZLWKWKHVXEMHFWDV-DQQLQJVSXOOVWKH
ULQJVIURPKLV¿QJHUV
(He holds the rings in the light so they sparkle. He caresses them
and touches each individually with his lips. He plays: points with
the ringless hand at something, then points with the ringed hand at
the same thing; places the ringless hand on his heart, then places the
ULQJHGKDQGRQLWZDYHVVRPHRQHWRZDUGVKLPZLWKWKHULQJOHVV¿QJHU
WKHQZLWKWKHULQJHGRQHWKUHDWHQVVRPHRQHZLWKWKHQDNHG¿QJHU
then with the ringed one. He is intoxicated by the idea of ownership.)
W: More.
(Pause. Rock and voice together.)
V: till in the end
the day came
in the end came
close of a long day
when she said
to herself
whom else
time she stopped
time she stopped
going to and fro
all eyes
all sides
high and low
for another
21st Century Playwriting 175
another like herself
another creature like herself
a little like
going to and fro
all eyes
all sides
high and low
for another
till in the end
close of a long day
to herself
women else
time she stopped
time she stopped
going to and fro
all eyes
all sides
high and low
for another
another living soul
going to and fro
all eyes like herself
all sides
high and low
for another
another like herself
a little like
going to and fro
till in the end
close of a long day
to herself
176 7ංආඈඍඁඒ'ൺඅඒ
whom else
time she stopped
going to and fro
time she stopped
time she stopped
(Long pause.)
W: More.
In the above example, the Woman stands outside the very process by
which she is dominated. Language is a tool of psychological torture and
metaphysical speculation. The character observes the verbal punishment,
then asks for more. She is both the tortured, the torturer and (in typical
Beckett fashion) the paralysed observer. Again, however, Shakespeare is
the great prototype of this type of theatrical technique. Hamlet is both the
architect, the wrecker and observer of his fate. He is probably theatre’s most
super-aware character, running a modernist commentary on the play even as
it proceeds, even to the extent of staging (and directing) his own show in the
middle of Shakespeare’s. (The man will do anything to catch his stepfather.)
These multiple functions of language reinforce a central view in the aes-
thetic of this book: that dramatic characters are both characters within a story as
well as standing outside of it. The multiple functions can be summarised thus:
PERFORMATIVE STATES
I’ve already indicated that we have long since lost our naïve belief that
“we are not in a theatre” when we see a play. My theory of ‘Performative
21st Century Playwriting 177
States’ extends that to the dramatic characters themselves.
Modernist theatrical practise relies upon the audience’s knowledge
that ‘we are watching a play/performance’ in order to achieve much of its
formalist power. In other words, it is only through our knowledge that we
DUHZDWFKLQJDSHUIRUPDQFHRUSDUWLFLSDWLQJLQDVRFLDOQDUUDWLYHDUWL¿FH
that we can fully experience the power of contemporary theatre. The fact
is, however, that the dramatic characters should also have this knowledge.
By this I don’t just mean that characters should be puppets of an authorial
consciousness like Pirandello, whose aesthetic as well as his dramatic
characters constantly remind us that ‘this is just a theatrical performance’.
By performative states, I mean an array of conventions, narratives
and procedures which place the dramatic character into a context that is
both larger than him/her, and requires a performance from that character
which cannot help but reveal the inner life. (And as I’ve said several
times in this book, revealing the inner life of characters to an audience is
the primary task of theatre, to which even such powerful and ‘theatrical’
elements as dialogue and story are subservient.)
7KHVHSHUIRUPDWLYHVWDWHVUHO\RQSODFLQJSHRSOHLQ¿FWLRQDOLVHGDQG
formalised situations where even though they are narrative characters, they
must do something, read something, create something. They must use the
rules of one form (for example, lecture, letter writing or performance itself)
to successfully accomplish the dramatic moment that they are confronted
with. In having to perform they must stand outside their own performance
as characters. They become meta-characters.
Put simply, they are characters who perform. The performance might
be social, emotional, intellectual or physical. The point is that the character
is required to do something beyond the spontaneous act of simply ‘being’.
3. The Art of the Phone Call. This might seem a dated theatrical conven-
tion, but it depends on how it is used. The dullest phone conversations are
when we hear (or can completely imagine) the other end of the conversa-
tion. Thus, rather than show one conversation, and both parties, create some
VSDWLDOIRUPDOLVPE\KDYLQJWZRRUWKUHHGL൵HUHQWSKRQHFRQYHUVDWLRQV
5. The List. This is a personal favourite of mine. One of the easiest ways
to materialize a physical universe is to list it. A character in search of the
VHFUHWVRIKHUPDWHULDOZRUOGPXVW¿UVWPDNHDQLQFOXVLYHOLVWRIWKHP
LIGHTS.
'RRUÀLHVRSHQ²GD]]OLQJOLJKW
No one is there.
BLACKOUT.
LIGHTS.
Man 2 standing
by black
window—
hat, trenchcoat,
sunglasses.
Looking out sideways.
Puts hand inside coat, feeling in inner
pocket.
'RRUÀLHVRSHQ²GD]]OLQJOLJKW
No one there.
Man 2 turns to
face front.
BLACKOUT.
GL൵HUHQWFRQWH[WVVRWKDWWKHLUXQLTXHQDWXUHPD\EHSHUFHLYHGHYHQDV
these same elements are used in the service of the entire play. You will
also notice how it uses the Interrupted Form of Performative State No.9
by its series of ‘false starts’ and ‘returns to the beginning’.
15. The Mime. The mime is a banquet for the eyes. It is useful because it
gives the over-talked-to ears a rest, and makes the audience use its eyes. Both
senses (eyes and ears) are uncertain and distrusted mechanisms of informa-
tion gathering—it’s well known that people believe less than half of what
they hear or see—and the use of them in theatre makes for a delicious sense
of uncertainty on the part of the witnesses (audience) using those senses. So
consider using the mime as a scene in itself. It might even start your play.
19. The Ensemble. As this chapter has shown, a group of actors on stage
need not just be a socialised group of characters, existing only in terms of
the play’s story. An ensemble can be a chorus, a set of meta-performers,
ZKRSHUIRUPLQDQGRXWVLGHRIWKH¿FWLRQDOVHWWLQJRIWKHSOD\2QHRI
the great modern uses of ‘the ensemble as performers’ is Max Frisch’s
Biedermann und die Brandstifter (Known in English as Herr Biedermann
and The Arsonists) where the Fire Brigade acts as a mock chorus, intoning
in poetically-scanned horror at the events to come. It is hilarious.
20. The Ritual. I have left the ritual until last, though it’s probably the
most creatively fruitful of all. A ritual is any activity which has a series
RIVLQJOHDFWLRQVDQGZKLFKWRJHWKHUDVVXPHDQDJUHHGDQGVLJQL¿FDQW
meaning. Time is important to a ritual (fast, slow); order is important
(there is a pattern); meaning is crucial (‘this ritual allows us to grieve,
and for that we hold it sacred’). Traditionalism allows the ritual to
proceed, but modernism disrupts it. (Let’s not forget, however, that the
greatest use of the ‘disrupted ritual’ was made not by Strindberg but
by Shakespeare. Think of all the interrupted ceremonies in his plays;
banquets that go wrong, masked balls that go badly; performances
that get stopped.)
&ඁൺඉඍൾඋ
:RUGVPDWWHU,QIDFWZRUGVarePDWWHULQWKDWWKHLUUHSUHVHQWDWLRQLQ
SULQWWDNHVXSSK\VLFDOVSDFHRQWKHSDJH7KLVSULQWLVWKHQSK\VLFDOLVHG
E\ DFWRUV WKHLU YRLFHV DQG ERGLHV WR PDNH WKH SOD\ WR FUHDWH LWV
SHUIRUPDQFHLQWKHDWUHVSDFH7KHUHLVWKHQDUHODWLRQVKLSEHWZHHQ
WKH SULQWHG SDJH DQG WKHDWUH VSDFHWKDW¶VQRWRIWHQWDONHGDERXW,W¶V
ZKDW,¶OOWU\DQGGRLQWKLVFKDSWHU
,¶PSUHVXPSWXRXVHQRXJKWRFODLPWKDWDORWRIZKDW\RXUHDGLQWKLV
FKDSWHUZRQ¶WEHIRXQGLQRWKHUERRNV7KLVLVQRWRQO\EHFDXVHVRPH
ERRNVRQZULWLQJLQERWKWKHDWUHDVZHOODVLQWKHZRUOGRIVFUHHQSOD\
ZULWLQJDUHQRWZULWWHQE\FXUUHQWO\SUDFWLVLQJSURIHVVLRQDOV%XWWKHUH
LVDPRUHSHUVRQDODQGSDLQIXOUHDVRQIRUWKHOHVVRQVRIWKLVFKDSWHU)RU
HYHU\SULQFLSOH,RXWOLQHEHORZ,¶YHXVXDOO\KDGWRZUHFNDVFHQH²RUHYHQ
DZKROHSOD\²WROHDUQ$QG,¶YHXVXDOO\OHDUQHGLWEHFDXVHNLQGDFWRUV
KDYHSRLQWHGRXWWKHIDLOLQJV,W¶VVXUSULVLQJKRZPDQ\RIWKHZHDNQHVVHV
LQRXUZRUNRYHUZULWLQJORVVRIIRFXVODFNRIWKHDWULFDOLW\HWFKDYHWR
GRZLWKQRWNQRZLQJKRZPXFKZRUGVµZHLJK¶DQGZKDWGL൵HUHQWW\SHV
RIWH[WXUHVDQGGHQVLWLHV\RXKDYHDW\RXUGLVSRVDO
)LUVWDGH¿QLWLRQµ'UDPDWLFWH[WXUHLVWKHFRPELQHGHৼHFWRIODQJXDJH
DQGSK\VLFDOLW\LQWKHDWUHVSDFH´0DQ\WKLQJVJRWRPDNHXSWKHFRPELQHG
WH[WXUDOH൵HFWQXPEHURIZRUGVXVHGWKHW\SHRIZRUGVXVHGWKHLUFRORXU
VSHHGRIGHOLYHU\UK\WKPVDQGJHQHUDOWHPSRWKHUHODWLRQVKLSEHWZHHQ
VSRNHQWH[WDQGXQVSRNHQVXEWH[WDQGWKHLQWHUDFWLRQRIODQJXDJHZLWK
JHVWXUHPRYHPHQWDQGRWKHUIRUPVRISK\VLFDOLW\
%XWDGH¿QLWLRQLVRQO\DVJRRGDVWKHVSHFL¿FH[DPSOHV,FDQR൵HU
/HW¶VVWDUWZLWKZKHUHZHPRVWO\DUH
7+(7(;785(2)62&,$/5($/,7<&217(67('32:(5
&ROLQWKHZULWHULVWDONLQJZLWK(ODLQHKLVSURGXFHUDERXWKLVPRYH
WR6\GQH\IURP0HOERXUQH$XVWUDOLD
(/$,1( ,GLGQ¶WGUDJ\RXXSKHUHWKHQ"
&2/,1 1R,ZRXOG¶YHFRPH\HDUVDJREXW,FRXOGQ¶WSHUVXDGH
.DWH6KH¶VFRQYLQFHG6\GQH\LVIXOORIFRQPHQFURRNV
DQGKXVWOHUV
188 7ංආඈඍඁඒ'ൺඅඒ
Theatre does not need words (at least not as many as most of us
writers use). Here’s a riveting opening from Stephen Sewell’s The Blind
Giant is Dancing:
)DGHXSOLJKWVRQDKHDYLO\FRYHUHGPDQ²XQLGHQWL¿DEOH+HDSSHDUV
WREHORRNLQJWKURXJKDQH[SDQGDEOHIROGHU$ÀRSSLQJVRXQGDVRI
a man trying to rise. Fade up lights on a second man—GRAHAM
:+,7(²O\LQJIDFHGRZQRQÀRRU+LVKHDGDQGVKLUWDUHFRYHUHG
with blood. He is moving.
7KHXQLGHQWL¿HGPDQPRYHVWRDQRWKHUIROGHU:+,7(PRDQV7KHUH
is a sudden tingling of the wind-bell as a gust moves it.
7KHXQLGHQWL¿HGPDQPRYHVWRDQRWKHUIROGHU:+,7(GUDJVKLPVHOI
forward. A sudden tingling of the wind-bell as a gust moves it.
7KHXQLGHQWL¿HGPDQPRYHVWR:+,7(DQGWDNHVDSLVWRORXWRIKLV
pocket. Quickly and without ceremony, he stands over WHITE, puts
190 7ංආඈඍඁඒ'ൺඅඒ
the pistol behind his ear and shoots. WHITE’S body leaps into the
air. Blackout. A phone rings.
The texture of the print may be close (for reasons of economy) but
the actual ‘spatial result’ (in the theatre) would be one of chill, sparseness
and immeasurable depth. It uses what I call the Iceberg Principle: to keep
most of the emotions and possible reactions (that is, ‘what I’d say/feel in
that situation’) UNSTATED and beneath the spoken surface of the play.
The words occupy about 15-20 %, but 80% of the play’s many meanings
at this point lie underneath the social/verbalised surface.
I hope it’s becoming clear what I mean by ‘dramatic texture’. It is
WKH FRPELQHG H൵HFW RI ZRUGV DFWLRQV DQG JHVWXUHV RQ WKH KHDYLQHVV
or lightness, speed or slowness of the theatrical space. Texture is also
LQÀXHQFHGE\DQXPEHURIRWKHUSKHQRPHQDWKHW\SHVRIZRUGVXVHG
21st Century Playwriting 191
the speed they’re spoken at, the inner rhythms of language, the number
of ‘theatrical events’ happening at any one time etc.
It’s surprising how the texture of many writers’ work (especially their
un-produced scripts) is so homogenous. In other words, every page looks
the same. And yet, many textures are available to the playwright. In the
EHVWSOD\VWKHUH¶VKDUGO\DSDJHWKDWUHVHPEOHVDQ\RWKHUVRÀXFWXDWLQJ
DQGYRODWLOHLVWKHWKHDWULFDOµÀRZ¶
5R\0&RKQD:DVKLQJWRQODZ\HUDQGSROLWLFDO¿[HULVRQYDULRXV
SKRQHVZKHQ-RHHQWHUVKLVR൶FH
The scene continues and spirals upwards toward its main point:
Roy wants to hire Joe as his assistant. But before we get to that, sev-
eral techniques are spectacularly at work here. Most important for
our purposes— there’s multi-directionality. A character dominates
the space not by yelling, but by controlling several possible spatial
directions at once. Roy is talking on the phone; he is throwing sand-
wiches nonchalantly to a nonplussed visitor, Joe; and he is carrying
on a conversation with Joe about a range of things. He also juggles
several phone calls at once.
In this one scene (from Angels in America, Part 1 by Tony Kushner)
a major character’s brilliance, malevolence, cynicism, nonchalance,
cunning and sense of humour are all demonstrated for us to see and
hear. His complete ease in the use of power is also hinted at—something
which is crucial for the plot. But there is a paradox here, regarding the
use of power. For sometimes a powerful character speaks a lot, and the
‘victim character’ (Joe, in the example above) says almost nothing.
Note the amazingly unbalanced texture. Power is not contested here.
Roy rules supreme, and the texture embodies this. The printed page
is lop-sided in favour of Roy’s text, and that imbalance will translate
directly to the theatre space. But this is not the only way to demonstrate
brilliance and virtuosity. (In other words, it’s not a matter of showing
brilliance, control and power by ‘having that character talk a lot.’ It’s
not that simple. The words need to be witty, ironic, caustic, showing
ÀH[LELOLW\²ORRNDWKRZTXLFNO\5R\FDQFKDQJHGLUHFWLRQ$WRWKHU
WLPHVKRZHYHU\RXVKRXOGDSSO\DFRPSOHWHO\GL൵HUHQWWHFKQLTXHWKDW
is, where the controlling and powerful character says almost nothing
(Pinter’s favourite method.)
Just as power has its own textures, so does powerlessness, pain and
confusion.
Look at how ‘airless’ and claustrophobic this texture is. A few minutes
of this and the audience will be screaming for relief. And that’s precisely
the point. One of the greatest compliments that can ever be paid to your
writing is when actors tell you that your writing gives the audience the same
experience as the characters; that is, what the characters are going through,
the audience is also experiencing. (Not as common a compliment as you’d
think, given our theatre’s tendency to talk about feelings rather than linguisti-
cally demonstrate and physically embody them.) But it’s happening in this
play (Sarah Kane’s Psychosis 4.48) too. The language works to make the
audience experience the same inner pain and turmoil as the character herself.
Rather than give an example from a fellow writer and ruin a friend-
ship, I’ll dig into my own murky past, with an early, traumatic encounter
with the industrialised narrative machines of the TV industry. In Episode
1,147 of the Australian soap-opera Neighbours, Josh has a problem:
Again, I’ll not break the fragile spider’s web of trust and friendship
that links all writers by naming names or plays. For purposes of illustra-
tion, I’ll reproduce the type of linguistic texture I’m talking about, which
\RX¶OO¿QGLQPDQ\SOD\VSHUIRUPHGDQGXQSHUIRUPHG7KLVWH[WXUHLVD
favourite of some British and Australian writers.)
/HW¶VLPDJLQH-HQQ\KDVMXVWKDGDGL൶FXOWHQFRXQWHU0D\EHVKH¶V
looking for her dog.
These two linguistic techniques, seen here in embryo (that is, because
they are allied to a still-realist narrative conception) could be the spring-
ERDUGIRUDOLQJXLVWLFIDQWDVLDRQ\RXUSDUW7U\SXWWLQJ¿IWHHQTXHVWLRQV
together—and answer none of them (except with more questions)—and
you’ll achieve a ‘hyper-realism’ similar to the following:
When theatrical language is not brilliant, it has to make way for what
is. If the language is not sexy, seductive, mesmerising, formalistically
dazzling or irresistibly funny, it has to leave room for other things. Those
‘other things’ may be music, song, dance, movement, image, mime, act-
ing...and silence. (It’s amazing how easily you can edit your own writing
once you eliminate those lines which a) can be acted; b) can be assumed by
the audience; c) can be felt/thought by the actor (and thus the audience).)
21st Century Playwriting 197
So let’s end this smorgasbord of textural delights with an example
from a still great play A Stretch of the Imagination by Jack Hibberd. Note
how theatre space is ‘shared’ between (wonderful) words and suggestive
actions.
(He walks across to the table, creakily climbs the chair and raises the
sun umbrella which is weathered and bizarrely tattered. He descends.)
The excerpt goes on… as I easily could. But I hope I’ve whetted
your appetite—not to simply produce one of these textures in your next
SOD\EXWWRWU\WKHPDOO,W¶VWKHDJHZHOLYHLQ7KHSDJHVKRXOGUHÀHFW
the heterogenous, mixed, fragmented, bustling and excited spirit of our
times. Ignore it at your literary peril.
199
&ඁൺඉඍൾඋ
ACTING IS...
Acting is energy.
Actors love challenges—often until they actually get one! Then they
get scared. They worry they can’t do it. They come to the theatre every
night not being sure if they can get through a scene of especially complex
or strenuous physicality. But they do. And in the process, they discover
that physical challenges can make for exciting theatre. Laurence Olivier,
the master actor, used to create extra physical challenges for himself (for
H[DPSOHMXPSLQJR൵KLJKSDUDSHWVZKLOHUHFLWLQJ6KDNHVSHDUHDQYHUVH
I’d like to think that our actors don’t have to do this, because the ‘high
parapets’ are already built into the action of our plays. The implications
then, are simple: where is the exciting, strenuous and demanding physicality
in your play? Or do people just sit around and chat, occasionally getting
up to pick up a phone or exit? If ‘story’ deals with those situations when
‘life gets out of control’ (see Chapter 8) where, in your play, is physicality
also out of control?
The best actors are usually very intelligent on one or more levels.
There’s either a brilliant, rational intelligence, or a deep, intuitive ‘know-
ing’ that allows them to perform the conscious and unconscious levels of a
dramatic role. What if one of your characters was intellectually brilliant?
What if another was emotionally (even preternaturally) aware? What if
a third character possessed the stupidity of a sheep? We often make the
mistake of pitching our characters in the middle-range of possibilities:
for example, making our characters “moderately intelligent”, “moderately
ambitious” and (as a result) only moderately interesting. Macbeth is not
“moderately ambitious”. He is right at the end of the spectrum. He lies
at the extreme end of the Ambition Scale. There’s a lesson here: Making
our characters stunningly intelligent, stupid, aware/unaware is all part of
the process of pushing characters to points of extremity. At such extreme
points, the acting becomes very exciting.
,PDJLQHDVFHQHWKDWFDOOVRQWKHDFWRUWRIHHOVL[GL൵HUHQWHPRWLRQV
in a single page? Too much? Tennessee Williams didn’t think so: Actors
don’t think that such complexity is too much either. They love playing
his characters. It’s the very complexity, the almost operatic display of
FRQÀLFWLQJLUUDWLRQDOHPRWLRQVWKDWWKHDFWRUUHOLVKHV
As I’ve already said, it’s rare that an audience says, “I’m not going to
watch this, it’s too exciting.” Even in a comedy, the focus on something
that’s badly wanted should raise the tension and the atmosphere enough
to drive the play along. Whatever the dramatic want or need is, make it
urgently wanted. Which brings me to the next, related point.
When all else fails, have one or more of your characters pursue a goal
with ferocity. If Richard III can do it, then we can do likewise. Perhaps we
in the audience respond to the idea of wanting something badly because
it helps us give life a purpose? To Buddhists, most American drama
must seem like a Festival of Craving, something they warn against.
But Buddhism has yet to produce a Shakespeare, and until it does, the
yearning, the intense longing and striving will and should continue, at
least on stage.
Acting is play.
Acting is stillness.
Acting is activity.
After a moment of silence, let the actor’s body start moving again. It’s
very important to give the (actor’s) body a plot. That is, what happens to a
FKDUDFWHUGXULQJWKHFRXUVHRIDSOD\ZLOORUVKRXOGKDYHDQH൵HFWRQKHU
body. A good actor will look for a trajectory of physicality, from beginning
to end. You can help her by making ‘what happens to the character’s body’
more explicitly part of the plot, at least with some of the important characters.
Characters who have to change tactics, review their plans and make
quick decisions—all these make for exciting acting. When the narrative
204 7ංආඈඍඁඒ'ൺඅඒ
situation changes, let this unsettle, shock and disturb the characters, forcing
them to quickly change some or all of their approach. Urgency of response
never hurts the dramatic tension. (But see next point.)
1. He can speak.
2. He can think.
3. He can feel.
4. He can use his body.
You will notice that only one of these actually involves words! Yet we
writers insist on giving so many lines of dialogue that all the other modes
RIDFWLQJDUHQXOOL¿HGE\WKHGRPLQDQFHRIWRRPDQ\ZRUGV
I discussed over/underwriting in Chapter 11, but one more thing needs
to be said. Using more words than necessary is sometimes a stylistic decision
that yields brilliant results (think of Oscar Wilde), but in most cases it has
DUXLQRXVH൵HFW7KHZRUVWUHVXOWRIXVLQJPRUHZRUGVWKDQ\RXQHHG²RU
overwriting, for short—is that LWQXOOL¿HVPRGHVDQGDERYHIn other
words, if you want to kill an actor’s ability to think, feel and use his body
IRUH[SUHVVLYHH൵HFWWKHQVLPSO\JLYHKLPPRUHZRUGVWKDQWKHGUDPDWLF
situation and stylistic context require. It’s that easy: you can make even
the best actor look like a complete acting-beginner, simply by overwriting.
There is another bad result of our writerly obsession with just words:
it robs the audience of its main function: to work it out for itself. An
audience does not become an audience until it has started thinking and
21st Century Playwriting 205
questioning. Before they start thinking and feeling, they’re just a bunch
of tired people at the wrong end of a long day.
JACK: The thing is.... I don’t know how to say this, but....
(Picks up a letter) It’s all in here.
Look out how these simple few lines makes an audience work hard:
JACK: The thing is....(1) I don’t know how to say this, but....
(2) (Picks up a letter) It’s all in here. (3)
With (1), you have the power of the XQ¿QLVKHG VHQWHQFH There’s
nothing like it for arousing an audience’s curiosity: What was he going
to say? Why did he stop? What’s he hiding?
With (2), you get the audience feeling clever that it picked up the
early signs of something else going on under the surface (or subtext).
Even the slower audience members are onto it by now, and will be ‘play-
ing detective’ (“What’s he hiding?”) (Remember: an audience that asks
itself a question has become an audience. The question that each audience
member asks himself can vary, but as long as they are asking themselves
TXHVWLRQVWKH\KDYHEHFRPHDXQL¿HGDXGLHQFH
With (3), you not only have a change of acting mode (from the verbal
to the physical) but a promise of plot: “If you watch this letter, you’ll see
the solution to the narrative puzzle.”
Now, let’s look at all the acting joy you’ll create in this same example:
JACK: (A) The thing is....(B) I don’t know how to say this,
but.... (C) (Picks up a letter) (D) It’s all in here. (E)
With (A), you have the chance to create silence. From Chapter 1 on,
I have stressed that modern theatre is a sharing of words with something
else (silence, body, gesture, sound, space, and music). Simply by leav-
ing more silence in your work, you’ve become modern. But you’ll also
have given the actor one of the best ways to create the illusion of depth.
See it like this: the silent, still actor can create the illusion that he has
a rich thought-life and feeling-life, both of which are vital in creating
the belief in an audience that “Here is a character worth emotionally/
imaginatively investing in.”
206 7ංආඈඍඁඒ'ൺඅඒ
With (B), you give the actor the chance to ‘change gear’, that is to
SOD\DQRWKHUHPRWLRQ<RX¶OOSUREDEO\DOVR¿QGWKDWWKHDFWRUSOD\LQJ-DFN
KHUHZLOO¿QDOO\VWDUWWRWXUQKLVIXOOJD]HDQGHPRWLRQDOLQWHQVLW\RQWR
WKHRWKHUDFWRU+HSUREDEO\ZRXOGSOD\WKH¿UVWOLQHWRVRPHZKHUHHOVH
giving the next lines even more power, especially the “It’s all in here”
line, which shares its climax with the physical action of picking up a
letter.) Incidentally, there’s a good argument to say that Line (B) doesn’t
even need to be said at all, because it can be acted (i.e. thought and felt).
With (C), you have given the actor the chance to start moving around
(if he hasn’t already done so.)
With (D) and (E), you have allowed the actor to extend the moment.
By thus freeing the actor, you will have turned from a Writer-as-Control-
Freak into a Writer-as-Enabler, who actually trusts your fellow artists to
know as much about their craft as you do about yours.
The fascinating thing about the above example is that the majority of
WKLVGUDPDWLFPRPHQWLVQRW¿OOHGZLWKZRUGVThere is more silence in the
above example than there is verbal sound. There’s space for other artists
DFWRUGLUHFWRUVRXQGGHVLJQHUFRPSRVHUWR¿OO<RX¶YHJLYHQWKHPD
job in theatre. They’re more likely to do your play.
Some years ago, I had the chance to see the wonderful British actor,
ZULWHUDQGGLUHFWRU6WHYHQ%HUNR൵SHUIRUPLQJRQHRIKLVRQHPDQVKRZV
The whole evening was exhilarating, but one of the texts he performed was
HVSHFLDOO\IDVFLQDWLQJ7KHWH[WZULWWHQE\%HUNR൵ZDVFDOOHGVLPSO\Actor.
An actor goes for a walk in the park, and during his walk passes colleagues,
friends, enemies and others. Here is a sample from this wonderful, sparse text:
ACTOR: Greetings. Hello, John. Hello Richard, and how are you?...
Hello Mike?... How are you? Working?.. Really, that’s good.
What are you doing?... A play... How very nice... See you...
Have a nice day you... Hello Pete... How are you? I’m doing
well, too. Working? You are?... That’s great. Bastard. He
couldn’t act his way out of a paper bag... The slag... Still, I’ll
show them... Those out there... the faceless ones... the ones
in the chairs... The ones who say “Thank you. We’ll let you
know”... They haven’t the guts to get out there...
I hope the lesson from the above example is clear: if the implications
of the text are clear enough, eliminate as many stage directions as pos-
sible, so you leave the actor lots of room to explore possible physical and
emotional responses to your text.
Of all the great theatre topics, subtext would have to be the most
mentioned—and under-analyzed—of them all. As a young writer
yearning to write rich and wonderful theatre, I was desperate to learn
the mysterious art of this thing called ‘subtext’, something critics often
spoke about in connection with the great writers of Western theatre. Actors
would speak of the rich, nuanced subtext of Chekhov, or the fascinating,
bizarre and unpredictable life under the surface of many of Tennessee
Williams’ characters. But no one ever seemed to go further than a token
or retrospective acknowledgement of the importance of subtext. No one
seemed to be able to show a young writer ‘how to do it’ for himself. This
section, therefore, is all about making sure you are never in the same
predicament that I was all those years ago.
7KH ¿UVW WKLQJ WKDW VKRXOG EH VDLG LV WKDW WKHUH DUH QXPHURXV
W\SHVRIVXEWH[W%XWEHIRUHWKDWDGH¿QLWLRQWKDWLVEURDGHQRXJKWR
encompass all the following subtextual types: Subtext is any meaning
conveyed by the actor, additional to and implied by the words them-
selves. It may or may not have been intended by the author, but that’s
not the point. The fact that it can be done using any of the resources
of theatre (action, word, image, body, space etc) means that it deserves
some detailed attention.
I. NEEDS, WANTS
1. Single-direction subtext.
The most direct and basic subtext of all. Character A wants something
from Character B. David Mamet once said in an interview that “A character
should never say what he/she wants unless that’s the best way to get it.”
,W¶VWKH¿UVWTXHVWLRQDQDFWRUZLOODVNRIDZULWHUZKRVHZRUNWKH\DUH
rehearsing: “What does my character want?” Spell it out to yourself and
build it into the writing long before you have to haltingly explain it to a
perplexed actor in the rehearsal room.
21st Century Playwriting 209
2. Double-Direction Subtext.
3. Outward-directional subtext.
II. POWER
7. Consensual Subtext.
The fun continues, with both of them claiming not to love anyone,
least of all the other now speaking.
212 7ංආඈඍඁඒ'ൺඅඒ
8. Triangular Subtext
It’s a curious thing about 3-character plays: all the 3-actor plays I know
use power as an essential part of the narrative and dramatic structure. In
other words, if at the start of the play Characters A and C are in partnership
(or collusion) against Character B, then the next major plot shift involves
a shifting of the power structure so that, for example, Characters A and
B are now in league against Character C (as in the above illustration).
III. KNOWLEDGE
Characters who keep secrets from each other do the art of drama a great
favor. For secrets provide some of the best techniques of subtext available
to a playwright. The greatest master of the subtext of knowledge is probably
Henrik Ibsen. Reading all his plays will teach you all you need to know
about how held-back knowledge (i.e. secrets) can be used dramatically.
,Q([DPSOH&KDUDFWHU$LVGHVSHUDWHWKDW&KDUDFWHU%QRW¿QGRXW
the truth about something. Think of Nora in Ibsen’s A Doll’s House. There
are plenty of moments where Nora, thinking aloud, dreads the prospect
RIKHUKXVEDQG¿QGLQJRXWKRZVKHREWDLQHGWKHPRQH\WRNHHSWKHP
¿QDQFLDOO\VROYHQW
21st Century Playwriting 213
But it’s not enough just to complain about a situation. Action must
be taken.
In this case, Nora insists that Helmer play the piano for her while
she dances. She practically drags her husband to the piano, and dances
the Tarantella as he plays. Playing and watching her dance frenziedly, he
is both amused and amazed. He says to Nora, “You’re dancing as if your
life depended on it!”, and she replies, “It does!” In every production of
A Doll’s House that I’ve seen, this moment gets a very big laugh, for it’s
funny, mad and sad. A truly modern moment.
Incidentally, Subtext of Knowledge is very easy to create in your
work: Let Characters A and B tell a secret to each other, and then have
one of them say, “But whatever you do, don’t tell Character C!” A mo-
ment later, Character C enters, and the audience is aware of the power of
subtext created by withholding knowledge.
IV. PAIN
12. 6LQJOH3DLQ6ROXWLRQ2൵HUHG
What I will call the Acting Wave is one of theatre’s most exciting—and
rarely discussed—devices. Any actor will recognise it, and many writers actu-
ally use it, without being quite sure about the nature of this spatial phenom-
enon. The Acting Wave is an extended beat between two or more actors, where
FRQÀLFWLVXVHGWREXLOGDQLQYLVLEOHULVLQJHQHUJ\VKDSH%RWKDFWRUVµULGH¶
WKLVZDYHDGGLQJFRQÀLFWXSRQFRQÀLFWWRFUHDWHDSRZHUIXODQGLQWHQVHH൵HFW
Let’s look at a moment from Eugene O’Neill’s great play, Long Day’s
Journey into Night. In this excerpt, Tyrone is arguing with his son, Jamie,
about the future of the ailing Edmund.
I dislike the word ‘never’. But it’s probably advisable in this case.
Giving an actor a script with the following line should illustrate this:
STEVE: (angrily) Get the hell out of here!... (furiously) Now!... GO!
As I’ve explained in the chapter on syntax and punctuation, you can
JHWDOPRVWDQ\H൵HFW\RXZDQWE\WKHZRUGV\RXXVHRUKRZ\RXSXQFWXDWH
or order them. Adding the adverbs above is a bit like saying to the actor,
“You’re not smart enough to understand the words I’ve written, so I’m
adding these adverbs to help you.”
218 7ංආඈඍඁඒ'ൺඅඒ
As already discussed, the two are not the same. The thought-life is
that part of a human being which thinks, plans, strategizes and generally
approaches life on a rational basis (however irrational the thinking might
be to outsiders). In order to give the illusion of thinking to a character,
you need to create a plot which destabilises that character, forcing her
to reconsider her plans, adopt new tactics and react (quickly) to evolving
and unpredictable situations. Let some of your characters think using their
intellect and their intuition; but this can only happen if your plot is fast,
unpredictable and surprising.
The feeling-life, on the other hand, is that part of the psyche or soul
which responds on the feelings and emotions level to the plot events of
your play. As I’ve indicated earlier in the chapter, a character’s emotional
life does not have to be consistent or predictable. Contradictory emotions
in the same character, emotional ‘gaps’ where something is missing in
the character’s soul, things that don’t add up to an easy psychological
picture—all these help make characterising a role a delicious challenge
for an actor. I’ve always found that the best actors like the intellectual
and instinctive challenge of ‘making a character add up’. If you spell it
RXWWRRFOHDUO\D¿QHDFWRUJHWVERUHG%XLOGSDUDGR[LQFRQJUXLW\DQG
inconsistency into the emotional make-up of a character—and the actor
will probably be fascinated by the psychological ‘detective work’ she
will have to do. If you make the emotions deeply felt, that’s even better.
A character should probably not be fully in control of his emotions. Not
only should they be puzzling to himself, and hard to control, but also not
easily understandable to outsiders. In this way, you’ll have set the best
actors a problem worthy of their talents.
Not only is such a detailed thought and action (the last moment with
21st Century Playwriting 219
a long-dead relative) impossible to act or communicate clearly to an
DXGLHQFHDQDFWRUPD\ZHOOKDYHDEHWWHUHPRWLRQDOIRFXVWRR൵HU,W¶V
enough that we control the spoken lines. We don’t need to control an ac-
WRU¶VWKRXJKWVDVZHOO$OOZHFDQGRLVR൵HUhints and possibilities to our
actors, and let them use their wonderful acting instincts and intelligence.
The words “I love you” are very hard to act as a simple, direct state-
ment. But the words, “I hate you”, when acted with love— are much
easier. Think of the Beatrice and Benedick example previously. One reason
that audiences love these two characters is that, despite the often hilari-
ous insults, the audience knows that these two characters are addicted to
each other. They cannot keep away from each other, and only pride and
YDQLW\LQZLVKLQJWKHRWKHUWREHWKH¿UVWWRVD\³,ORYH\RX´VWRSVWKHP
from instantly falling into each other’s arms. By writing lines that go in
the opposite direction of where the plot is leading them, Shakespeare
has created rich, funny, wise and paradoxical subtext which delights the
audience and the actors who play these roles. By learning such techniques
from the best writers, you’ll have the interest of the best modern actors
in playing your characters.
&ඁൺඉඍൾඋ
CHARACTER (I): CHARACTER AS SYMBOL
incomplete that they will not leave the audience’s imagination alone, and
LW¿QGVLWKDVWDNHQWKHPKRPHDQGHYHQGLVWXUEHGWKHLUVOHHS
How is this done? For such a seemingly esoteric conception of character,
the steps are surprisingly clear and practical. Here are eighteen of them:
1. Give characters an inner life that is powerful, chaotic, at odds with their
outer life, and most importantly, an inner life they do not understand.
2. Give this inner life a power over them they cannot control.
3. Make their language the means whereby they wrestle with their
inner lives.
6. Give them a dramatic goal that is at odds with their fragmented nature,
or accords with only one aspect of it.
11. Create a ‘character dilemma’ that gives two options to a major character,
ERWK¿QHDQGERWKWHUULEOHDQG\HWRQO\RQHFDQEHFKRVHQ
12. Think of your plot as being the set of contradictions that put great
pressure on one or more of the fragments of the characters’ personal-
ity or nature.
14. Give them a thought-life, and this thought-life is taken very seriously
by them, even if it is expressed lightly.
15. Give them a feeling-life, where the range, intensity and history of
their emotions is as wide and deep as most people believe theirs to be.
16. Think of a plot that draws on the character’s experience in any or all
of the following thirteen levels of experience— physical, biological,
social, professional, emotional, sensual, sexual, intellectual, aesthetic,
ethical, moral, philosophical and spiritual.
$QG¿QDOO\FUHDWHD5RVHEXGIRU\RXUPDMRUFKDUDFWHUVDQGWKHQ
consider abandoning it. Rosebud, as we know, scatology aside, was Citizen
Kane’s lost sled, the symbol of the only existence Kane ever had in which
he experienced love. Personally, I suspect that while Rosebud was a good
narrative “puzzle-solving” device to get them out of the movie house with
a sense of completeness and satisfaction, its writers themselves may have
blushed at its very neatness (not to mention its inherent sentimentality). A
symbol exists because it means one and many things. A symbol that neatly
explains everything is no symbol—it’s just a plot device. The strength of
the symbol lies in how much we are fascinated by what we know of these
characters, and yet, days, even weeks after the performance, are still puz-
zling over their fragmented, contradictory, volatile and unstable natures.
224 7ංආඈඍඁඒ'ൺඅඒ
In this and the next chapter, I’ll go into more detail about the ways
of making a rich and powerful dramatic character.
2QHRIWKHSOHDVXUHVRID¿QHSOD\OLHVLQWKHSKLORVRSKLFDOµIDLUQHVV¶
that a writer gives to the range of characters she creates.
,PDJLQHDKRXVHKROG¿OOHGZLWKGL൵HUHQWW\SHVRISHRSOH1RWRQO\
DUHWKHLUOLIHVW\OHVGL൵HUHQWEXWWKHLUOLIHSKLORVRSKLHVFDQGL൵HUDOVR
When you draw up the characters in your play, try and place them on
a spectrum, representing the range of possible human responses. For
example, let’s say that one of the key themes of your play is the notion
of ‘hope’. Character A might be an embittered cynic who believes that
‘life is hopeless’, whereas Character B might be optimistic to an almost
delusional degree.
In the case of those two characters, the Spectrum of Possibilities
might look like this:
Here are some general possibilities, regardless of the play you are
writing:
7KH$৽UPHU
The Enthusiast
The Disappointed Idealist
The Utopian Dreamer
The Near-Sociopath
The Sentimentalist
The Impotent but Frustrated Observer
The Pragmatist
The Opportunist
The Frightened
The Broken
21st Century Playwriting 225
There are more possibilities than these of course, but I hope the
SULQFLSOH LV FOHDU ¿QG D SV\FKRORJLFDO µGRPLQDQW VWDWH¶ XQGHUQHDWK D
character’s social surface, and you may have found the basic drive that
DFWRUVORRNIRUZKHQWU\LQJWR¿JXUHRXWµZKDWPDNHVWKLVFKDUDFWHUWLFN¶
Incidentally, there is one important exception to this Spectrum: where every
character is almost exactly the same. Imagine a house full of rogues, as in the
occasional Mamet play, or in the works of Ben Jonson. But even then, there
DUHFOHDUGL൵HUHQFHVRIRXWORRNDWWLWXGHSKLORVRSK\DQGSV\FKRORJLFDOPDNH
up. Making characters ‘clones’ of each other is a Modernistic technique that
is occasionally useful, but it’s often fraught with danger. You’ve been warned.
THE AFFIRMER
— the emotional. John Osborne considered that the primary role of the-
atre was to provide the audience with an “education in feeling”. To
do this requires us to create characters capable of a great depth and
breadth of feeling. And if not, that may well be part of that character’s
story—and tragedy.
— the intellectual. Characters don’t just have feeling-lives. They have
thought-lives. This doesn’t mean they are egg-heads or Gitanes-
smoking intellectuals. Characters who think—badly, cleverly,
sophistically, loosely, speciously, vaguely, densely, laterally, or in
an overly-literal manner—create an audience that will also think.
— the physical. Characters have bodies, which are the result of how a
life has been lived, what thoughts have preoccupied them, as well as
what, genetically speaking, they were born with. Emotion shapes a
body. So does vice. Even virtue has its physical impact on the body
(clean or unmarked skin, for example). Theatre characters are, by
GH¿QLWLRQGULYHQE\VRPHLQQHUIRUFH:KDWHYHUWKDWLQQHUIRUFHLV
(ambition, some sexual lack, a massive moral confusion etc) it will
have made its impact on the character’s body. This aspect is related
to the next level of experience.
— the spiritual. By this I don’t just mean High Anglican and other forms
of clericalism. Rather I mean that inner life which encompasses the
fantastical, the imaginative, the ethical and moral. It is often the
FRQÀLFWEHWZHHQWKHVHHJ³:KDW,VKRXOGEH9V:KDW,DP´RU
“What I’m capable of being Vs What I’m forced to be”) that creates
the true story behind a particular character. Philosophy and values are
21st Century Playwriting 227
DOVRFUXFLDO6RPHWLPHV\RXFDQGH¿QHDFKDUDFWHULQDIHZVHFRQGV
by that character emphatically stating, “What I believe in”, “What I
live by”. And there are many variations: “Why I’m a physical wreck.
Why my life has been ruined.” It’s not going too far to say that char-
acters are the physical embodiment of their values and philosophies.
7RGH¿QHDQGVKDSHOLWHUDOO\WKHERG\\RXPD\¿UVWKDYHWRGH¿QH
the character’s philosophy.
— the sensual and sexual. Having bodies, those bodies don’t just think, imag-
ine or act badly. They feel. They are human animals, who are attracted or
repulsed by other human animals. It is visceral, instinctive and animal.
— the social. Human animals, however, must live on the surface. Even
Beckett’s characters have a social surface to their lives, even if it is
mostly distant, ruined, fragmentary and poorly remembered. In plays,
characters usually have a network of relationships, social, familial
and emotional. In fact, an early part of a writer’s character-sketching
can be simply summed up by, “Who does this character love?” This
alone might begin the important task of merging the various human
levels discussed here.
— the professional. The most explicit expression of the social is often
LGHQWL¿HGE\DFKDUDFWHU¶VMRERUHFRQRPLFDOO\PDUNHWDEOHSRVLWLRQ
in the world. In some plays—not to mention cultures—what a person
does for a living is crucial as a mark of that person’s rank or status.
In other plays, it may be less important, or be satirised, dismissed,
ironised or made an object of contempt.
Once you’ve got a sense of a character and how he lives and why, you
then need to ask what his contribution is to the story as a whole. This is
where the more functional role of characters comes in. A character is not
MXVWWKHUHWRµEH¶DFKDUDFWHULVDOVRGH¿QHGE\ZKDWKHGRHVRUGRHVQ¶WGR
A human being is not just a collection of philosophies and character traits.
To become drama, that philosophy and personality has to do something
that expresses its inner nature. A certain type of character, having that
particular nature, chooses an action because that is who he is.
228 7ංආඈඍඁඒ'ൺඅඒ
However, there’s an even simpler level to start from. You can simply
say, “My story needs a villain. Who will it be?” But there are lots more
‘story functions’ than a villain. Let me list them—
— The Protagonist. This character may be the driving force of the story.
Sometimes it’s the title character. To start your story, decide who is
the dominant force in the play. The character that ‘proposes’ (and
carries out) the largest, most ambitious course of action is usually
the protagonist.
— The Antagonist. This type of character ‘opposes’. An antagonist is not
DOZD\VHYLORUHYHQµWKHPRVWPRUDOO\ÀDZHG¶:KRHYHURSSRVHVD
principal character’s intentions is an antagonist, whether the protago-
nist is a saint or a devil.
— The Demonic or Monstrous Enemy. I’m not talking Lucifer here. I’m
talking of an opponent so implacable that the play is dangerous simply
by her presence. Allied to this is often an impressive array of skills that
make the opponent so dangerous. They are often things like an acute
psychological insight, a brilliance of verbal expression, a dexterity in
strategic thinking, or a radiantly charming manner.
— The Ambivalent Enemy. Enemies are not always implacably opposed to
each other. Even Shakespeare’s antagonists can be highly ambivalent.
$X¿GLXVDGPLUHV&RULRODQXVDVPXFKDVKHRSSRVHVKLP%UXWXV¶DP-
bivalence toward Julius Caesar (and consequent tactical ineptitude)
is the cause of his downfall. Remember, a play is not just action,
movement, colour and the clash of swords. It is also a meditation on
invisible but felt realities. Ambivalent characters often take an audi-
ence deep into its own inner life.
— The Companion. Sometimes a character stands alone, like a Titan. Other
WLPHVWKH\KDYHIULHQGVORYHUVFRPSDQLRQVDQGVRXOPDWHV&RQÀLFW
is not the only way to create powerful relationships in theatre. The
sharing of deep feeling between characters is also useful. Think of
theatre’s soulmates like Hamlet and Horatio, Romeo and Mercutio,
RU)DOVWD൵DQGKLVFRPLFGRRUPDW6LU$QGUHZ$JXHFKHHN
— The Shadow, or The Other Road Taken. Sometimes a character
might be one’s Jungian Shadow, that ‘other self’ without whom the
protagonist is incomplete. Butley, in the play of that name, looks at
his young protégé with envy and pain, as the protégé will take the
same career path as Butley but will make none of the older man’s
mistakes. Enobarbus tries to advise Mark Antony, but fails. Think
RIWKHSUREOHPDWLFIULHQGVKLSRI+DODQG)DOVWD൵3ULQFH+DONQRZV
21st Century Playwriting 229
that he will have to kill a part of himself if he is to free himself of his
FORVHVWFRPSDQLRQ)DOVWD൵7KHDUWLVW/RYERUJKDVWZRZRPHQLQKLV
life: the wild woman, Hedda Gabler, and a more sober and sensitive
alternative to Hedda, who will protect him from himself. The whole
SRLQWRIWKHVHFRPSDQLRQVDQGFRQ¿GDQWHVLVWRFUHDWHUHODWLRQVKLSV
where ‘the alternative lives’ that a character can live are played out,
aspired to, imagined or simply regretted.
— The Observer. The contribution of an Observer to a story is full of dangers
to the liveliness of the play you are writing. By its nature, a dramatic
character who simply ‘observes’ will either kill the audience’s curiosity,
RUEHDUDWKHULQDFWLYHHYHQLPSRWHQWFKDUDFWHU6RWKHPRVWH൵HFWLYH
way to create a dramatic Observer character is to vigorously establish
a character’s attitude to the dominant through-line. For example, Cas-
sius’ job is to promote the conspiracy against Caesar, whereas Mark
Antony’s job is to oppose the conspiracy as soon as he learns about
it. New writers have a tendency to create characters without any clear
relationship to the major action of the play. The great playwrights can
teach us here, however. An Observer might be witty, as in Oscar Wilde’s
plays. Wilde creates characters who observe the action as much as
they participate in it. It is Lord Goring’s super-awareness, and Ernest’s
clever-naive alertness that make the comedy such a conscious and joy-
ous experience. That’s one alternative. Characters who are not directly
engaged in the action, should be full of insights, or, if all else fails,
be very funny. Ibsen, on the other hand, likes to give his characters a
fatal illness. Dr. Rank is dying, and Judge Brack is morally cancerous.
And even Shakespeare kills Enobarbus, the loyal observer of Antony.
— The Observer as Narrator. Narrators can be highly useful in plays. They
are also quite dangerous. A narrator can very quickly take an audience
into a play’s story, but they may also prevent that audience from feel-
ing deeply. A narrator is a type of narrative tour guide, who is there to
clarify the experience we are having. But they can get in the way of
the play. Ideally, the play should be so direct, so immediate, so clear
and so powerful that it doesn’t need any intervention by anyone trying
WR³H[SODLQ´LWWR\RX+RZHYHU3HWHU6KD൵HU¶VWHFKQLTXHLVXVHIXO
here. He uses narrators frequently, but they usually have one saving
grace: they are morally implicated in the action. Salieri is tortured by
his guilt, as is the Doctor in Equus. There’s a lesson there: if you must
have a narrator, torture her. Let her be wracked by guilt, doubt, and a
KRVWRI³ZKDWLIV"´2WKHUZLVH\RXPLJKWQHHGWRNLOOKHUR൵FRPSOHWHO\
— The Victim. Stories have victims. In one sense, every character is at the
center of his own tragedy. But some are more victimised than others.
230 7ංආඈඍඁඒ'ൺඅඒ
And some are guiltier than others. Your Victim can be innocent and
idealistic, like Hedvig in The Wild Duck; rather pathetic, like Honey
in Who’s Afraid of Virginia Woolf?; pathetic but guilty as hell (like
many of Ayckbourn’s inadequate males). They may be too sensitive
for their own good, like Sarah Daniel’s central crusading character
in MasterpiecesRUHQQREOHGE\WKHLUVX൵HULQJDV0DUN$QWRQ\DQG
%UXWXVDUHKRZHYHUFRPSOLFLWLQWKHLURZQVX൵HULQJ5HJDUGOHVVRI
the cause, death or irreparable loss are the unhappy lot of your Victims.
5HPHPEHUP\HDUOLHUGH¿QLWLRQ$VWRU\LVDQH[FXVHWRUHOHDVHLP-
mense physical, verbal and spatial energy. If the protagonist decides on
something and goes for it, that creates energy. But even greater energy
can be created by another character moving in the opposite direction. It’s
a case of ‘unstoppable character meets immovable character.’ A character
may be a ‘villain’ simply because she opposes the plans and actions of the
others. Ultimately, one character will be more ‘in the wrong’ than the rest,
but this should not stop you from creating a rich series of moral/philosophi-
cal positions. Or, to put it another way: rarely is a villain completely bad,
and no good character is wholly good. Why should they be? Are you?
Some stories are creation myths. Others are “End of the World” stories.
Others are “Decline and Fall” narratives, such as Eugene O’Neill’s Long Day’s
Journey Into Night, where the family members struggle against their inevitable
demise as emotionally functional characters. In passing, it’s interesting to note
KRZPDLQVWUHDP$PHULFDQ¿OPFXOWXUHLVDOOEXWSUHGLFDWHGRQWKHQHHGIRU
232 7ංආඈඍඁඒ'ൺඅඒ
It’s worth knowing that other metaphysical states are also interesting.
Here are six:
— A character who lives in his own personal hell, and even occasionally
enjoys it. George and Martha in Edward Albee’s Who’s Afraid of
Virginia Woolf? are examples of this.
— A character who has given up hope of redemption, or tries one last
time. Butley, in the British writer Simon Gray’s play of the same
name, is a case in point.
— A character who lives in a type of limbo, where nothing matters, or
life is happening elsewhere. The climax of Christopher Hampton’s
The Philantrophist, has Philip, its central character, realise that his
life is a dreadful void.
— A character who is so unaware that he hardly knows he has a soul.
Such a benighted creature is Tesman, Hedda Gabler’s husband. No
wonder she kills herself.
— A character who knows that he has lost his soul. Many of Arthur Miller’s
male protagonists have this spiritual curse, often as a result of some-
thing that happened years before the play starts. Shakespeare, having
a more dynamic and ‘present tense’ conception of narrative, usually
has his characters lose their soul before the audience’s very eyes. Lady
Macbeth’s spiritual decline is one of the great dramatic achievements.
— A character who lives in the past, and sees the past as ‘paradise lost’.
Blanche in A Streetcar Named Desire is a good example of this.
— A character who lives for the future, and looks forward (usually in
vain) to a utopian future. The Doctor in Uncle VanyaLVSDUWO\GH¿QHG
by this. In fact, Chekhov’s greatest characters are either living in the
past, or looking forward to something that will never arrive, such as
the sisters getting to Moscow, in Three Sisters.
A character doesn’t always know what he wants, let alone what he most
needs. So characters who are self-delusional (as in nearly every Chekhov
play), or pumped up with a near-mad pride (as in some Ibsen plays), all
these make for powerful character drives. But the drive doesn’t have to be
consistent or smooth, for part of our human psychology is its maddening
inconsistency. Say one thing; do another. Believe X, but preach Y.
Try and have the outside world weigh down on some or all of your
characters. The world can be an oppressive, heavy thing, so showing the
burden of life, or that dealing with the pressures of living in society is not
necessarily a negative thing. It may well be recognised as Truth by the
audience, most of whom will have lived long enough to know that society
and reality can put immense pressure on the individual.
exercise choice in the way that humans do, so it’s no wonder that the role
of choice is crucial in stories. From Adam and Eve onward, choice has
been a powerful force in narrative and character creation.
<RXFDQXVHFKDUDFWHUFKRLFHWRVKDSHDFKDUDFWHULQ¿YHIXQGDPHQWDO
ways:
— A character has already made a fateful choice. For this character, the
role of consequences is important, as the past will come back to haunt
her. Be careful of this, however. For reasons too complex to go into
here, our culture is less responsive to guilty secrets being the driving
force of a play’s plot. It creates what the dramaturg and writer Keith
Gallasch calls the ‘Buried Child Syndrome’, where a supposedly
dreadful secret props up a story to the point where the audience is
kept waiting all evening for the details of the secret to emerge. Far
better to deal with the consequences of a secret being told. That’s far
more interesting. (I’ll return to this topic in Chapter 20.)
— A character is on the brink of making a fateful choice. Nero in Racine’s
Brittanicus is a case in point. Racine shows Nero at that dramatically-
potent moment in his life when he made the conscious decision to
turn from a sensitive, morally balanced person into the notorious
evil-doer who burned Rome.
— A character makes a fateful choice in the course of the play, the con-
sequences of which only gradually become apparent. Used literally,
it’s more a thriller technique. “Why did she pick that motel to stay
LQ"´³:K\GLGKHFKRRVHWKDWWRZQWRJHWKLVFDU¿[HG"´%XWLW¶VDOVR
useful for plays. A common use of the technique is to have a fateful
choice made by the end of Act I, and the consequences of that choice
will dominate Act II of that play. The central characters in Emerald
City and The Perfectionist do this.
— A character makes a fateful choice at the climax of the play. In this use
of choice, the whole play has been building up to the big scene where
VKHKDVWR¿QDOO\GHFLGH6RPHWLPHVDVZLWK1RUDLQA Doll’s House,
the precise nature of the big decision isn’t clear until almost the mo-
ment she has to make it. But with John Proctor in The Crucible, it’s
clear from at least midway in the play that it’s all building up to one
question: “Will you give up your integrity and sign the false confes-
sion, thereby saving your life?” His decision not to do this, marks
the major climax of that play.
— A character who is unable to choose2FFDVLRQDOO\\RX¿QGWKDW\RXU
21st Century Playwriting 235
central character or relationship is unable to choose, but that spiritual
paralysis may also make for a dramatic paralysis. But not always.
Madame Ranevsky in The Cherry Orchard refuses to make a decision
about the fate of the estate and the cherry orchard. What happens in
these plays is that life swirls around them regardless.
I’ve discussed this in the previous chapters, but it’s worth reiterating.
Unless you’ve found a way for a character to own a personal language,
the chances are that you’ve not created an interesting character. As we’ve
discovered in the chapter on theatrical space, language is one of the most
powerful tools to create an exciting space for the play to operate in. By
‘unique language’, I don’t mean things like accents or idiosyncracies of
speech or vocal delivery. Dramatic language is the highly-personalised
expression of what’s in the character’s soul, and what emotions live there.
Having looked at general approaches to the creating of character, it’s
time to examine some very practical techniques.
237
&ඁൺඉඍൾඋ
CHARACTER (II): CREATING A POWERFUL CHARACTER JOURNEY
,IDOOWKHDERYHVRXQGVGL൶FXOWWKHQ\RX¶YHUHDGFRUUHFWO\$FKDU-
acter is the closest thing to the writer’s inner self, of which only a part is
analysable, let alone teachable. But being an optimist at heart, I will put my
thoughts as clearly as possible, and let life experience and your therapist
do the rest. Or even better, let it all come out in the writing.
If you’re lucky, of the most scathing and frequent comments you will
hear about your work is, “I’m sorry, but I couldn’t care about any of your
characters.” It is a judgment that your play has almost completely failed
DSDUWIURPRWKHUTXDOL¿FDWLRQV,ZLOOGHDOZLWKLQWKLVFKDSWHU,VD\³LI
you’re lucky”, because in our international theatre’s strange tribal culture,
a writer will often not be given valuable advice on the grounds that it will
238 7ංආඈඍඁඒ'ൺඅඒ
R൵HQG3HUVRQDOO\,¿QGLWPRUHR൵HQVLYHIRUDZULWHU¶V¿QHSOD\QRWWR
be produced, so I’ll assume you’re as committed to hearing the full truth
as I am. Get the truth, and cry later.
Assuming that this damning judgment will be made of at least one
RI\RXUSOD\VOHWPHR൵HUWKHIROORZLQJZD\VWRPDNHDQDXGLHQFHµFDUH¶
IRU\RXUFKDUDFWHUV%XW¿UVWDFDYHDW
There are many responses that an audience can have to your characters.
The following table will illustrate this.
Having, I hope, clearly given you more options than simply wanting to
KDYHDQDXGLHQFHµOLNH¶WKHFKDUDFWHU,¶OOR൵HUVRPHWHFKQLTXHVWKDWZRUN
One of the best ways I know for creating richness and ‘roundness’ in
a character is to draw up a diagram like the one below. Try and address
each of the ‘arrows’ in this diagram. First, you can simply write down
your views about what risks, ideals and objectives each major character
has. Then, once you’ve got them clear in your mind, sketch some dialogue
lines or some dramatic action that communicates these attributes.
,QFRQWUDGLFWLRQWRVRPHRIWKHDERYH,¶GDOVROLNHWRR൵HUDWKHRU\
DQGLWVUHOHYDQWSULQFLSOHVZKLFKLQGLFDWHVDGL൵HUHQWDSSURDFK$IWHU
all, I’m not teaching a single ‘method’. As I said earlier, I reserve the right
to be complementary, and even contradictory.
As the lower, ‘cooler’ part of my table showed, drama is not just
21st Century Playwriting 243
a device for moral improvement. It’s often simply about showing the
monstrous and the demonic in us, but without demonising it or giving
the wicked characters a moral lobotomy.
There are several options facing you when you starting thinking about
‘how characters change’.
$&ඁൺඋൺർඍൾඋ¶ඌ5ൺඉංൽ*උඈඐඍඁ5ൺඉංൽ(ආඈඍංඈඇൺඅ-ඈඎඋඇൾඒ
7KH¿UVWRSWLRQLVVLPSOHOHW\RXUPDMRUFKDUDFWHUVIDFHUDSLGDQG
VLJQL¿FDQWFKDQJH/HWWKHHYHQWVRIWKHSORWEHVRIDVWDQGWKUHDWHQLQJ
that your characters have no choice but to adapt or die. Rarely does a rich
and interesting character feel (to the audience) to be in control of events.
%&ඁൺඋൺർඍൾඋංඇ7උൺඇඌංඍංඈඇ
'&ංඋർඎඅൺඋൻൾඁൺඏංඈඋ²&ඁൺඋൺർඍൾඋ/ංඏංඇංඇඈඋඋൾඏൾඋඍංඇඍඈ3ൺඌඍ
(&ඁൺඋൺർඍൾඋ)ඈඋർൾൽඍඈ&ඁൺඇൾ%ඒ(ඏൾඇඍ6ൾඅൿඇඈඐඅൾൽൾetc..)
)7උൺൽංඍංඈඇൺඅ5ංඌൾ)ൺඅඅ)උൾඒඍൺ)ංඌඁൾඋ%උඈඐඇൾ
7KHUHLVDWLGHLQWKHDৼDLUVRIPHQ
:KLFKWDNHQDWWKHÀRRGOHDGVRQWRIRUWXQH
(Julius Caesar)
alone have any feeling for them. If you’re in that situation, a little conscious
study will soon train your instinct. For playwrights are not born; they are
made, and practise improves our dramatic and structural instincts.
249
&ඁൺඉඍൾඋ
CHARACTER (III): MORE CHARACTER TECHNIQUES
In this chapter, I’ll deal with some character techniques that you might
¿QGXVHIXOUHJDUGOHVVRIWKHVRUWRISOD\\RXDUHZULWLQJ
A play often fails because the writer hasn’t made a fundamental choice
as to which of the following is the most important. In my experience, a
play is either dominated by a central character, or it’s dominated by the
progress and journey of a central relationship. Less frequently (and harder
WRSXOOR൵DSOD\PLJKWEHGRPLQDWHGE\DFHQWUDOJURXSZKRVHYDULHG
goals, aspirations, values and natures make up the real content of the play.
Deciding which of these three is the real center of your play may well
solve a lot of character and structure problems.
7KHUHLVVRPHWLPHVDGH¿QLQJPRPHQWLQDFKDUDFWHU¶VOLIHZKLFK
PDUNVWKDWFKDUDFWHUIRUDOOWLPH,QUHDOOLIHZHSD\DWKHUDSLVWWR¿QGRXW
what that is. In drama, the characters often know it already! For example,
quite early in The Cherry Orchard, Lopakhin the merchant mentions an
anecdote of his early years:
For some odd reason, this concept is much less known or discussed
than that of the character journey. (See Chapter 18 for a fuller discussion
RIWKLV%ULHÀ\WKHµUHODWLRQVKLSMRXUQH\¶LVWKDWVSHFLDOGLUHFWLRQWKDWD
particular relationship takes during the course of a play. If your play has
a central relationship rather than a central character at its core, then the
relationship probably has to develop fast, if only because an audience can
21st Century Playwriting 253
XVXDOO\JXHVVZKHUHWKHUHODWLRQVKLSLVKHDGLQJ,¶GR൵HUWZRWKRXJKWV
on how to deal with the relationship journey. First, make it go fast, and
even miss a stage or two. For example, a couple have just met. The next
scene, they’re in bed. The conversation is bound to be interesting. Second,
try the technique of “New scene equals new stage of their relationship.”
Another way to put this principle is: “In every scene of the play, A and
B’s relationship is at a new stage.” In one sense, you can go slow and
deep with characters, but because a relationship is much more of a pat-
WHUQHGD൵DLU\RXRIWHQQHHGWRWUHDWWKHGHYHORSPHQWRIUHODWLRQVKLSZLWK
economy and speed.
— A character who has never felt much at all in her whole life;
— A character who has lost the art of feeling;
— A character whom the story forces to ‘learn’ (again) how to feel;
— A character who has consciously decided not to feel emotion or sensation;
— A character who has too much feeling;
— A character who has more or less a ‘correct’ balance of feeling in his
emotional makeup;
— A character who, in the course of the story, loses her capacity for feeling.
Thus, with any spiritual, imaginative, intellectual, moral or emotional
quality there is usually a spectrum of possible attitudes that various char-
acters can take. As a speculative exercise you might ‘position’ each of
your characters somewhere along this spectrum. This doesn’t mean that
they shouldn’t move toward or consider other possibilities during the play.
I raise this idea because many scripts I read claim to deal with some big
thematic idea but hardly explore the idea in any breadth, let alone depth.
Characterization is the soul of drama, because drama, above all, is con-
cerned with dramatising the inner life in all its complexities—emotional,
imaginative, speculative, intellectual, ontological, moral and philosophi-
FDO7KLVKRZHYHULVQRWD¿QHVWDWHPHQWEXWDQDUWLVWLFLPSHUDWLYH:H
have no choice but to create a richness and depth for an audience to brood
on and take away—and keep brooding on.
,R൵HUD¿QDOTXLWHVLPSOHWHFKQLTXHZKLFK\RXFDQXVHWRJDLQDFFHVV
to the mysterious depths of your characters. It is this: let the character
talk. Let him talk, and talk, and talk. Fill up pages with his ravings, his
thoughts, opinions, attitudes, emotional outbursts and other linguistic
sputtering. In the early stages, make no attempt to put the character ‘into
a plot’. Simply let him talk. About many things, but most of all, about
himself. Let the word “I” start every second sentence. Discover the secret
that in drama, characters are constantly confessing, even if no one else
is present (except the audience.) Their inner lives are bubbling over and
VSLOOLQJRXWGHVSLWHWKHLUEHVWH൵RUWVWRFRQWDLQWKHÀRRG'DYLG0DPHW
once said that he never starts a play until he has at least one hundred pages
RIGLDORJXH7U\LW<RXPLJKW¿QGWKHNH\WR\RXUZKROHSOD\LQWKRVH
exploratory pages.
255
&ඁൺඉඍൾඋ
CHARACTER (IV): THE RELATIONSHIP JOURNEY
In many stories and plays, characters do not set out to meet each other.
They encounter each other accidentally, and do not always welcome the
HQFRXQWHUZKHQLWFRPHV7KXVWKLV¿UVWPHHWLQJLVRIWHQDFFRPSDQLHG
E\DVXUSULVLQJGHJUHHRIFRQÀLFW%XWWKHUHDUHDOVRRWKHUWKLQJVIDWH
coincidence, danger and threat. One way to see dramatic characters and
WKHLUH൵HFWRQHDFKRWKHULVWRWKLQNOLNHWKLV³7KHSHUVRQWKDWFKDUDFWHU
A meets will be the one person s/he most ... dreads, but who is, in ret-
rospect, the most necessary to his/her spiritual survival.” (Notice that I
write ‘spiritual survival’ rather than ‘physical survival’; while plays can
deal with matters physical, its supreme achievement is putting onstage
characters whose soul, mind or psyche is at risk.)
256 7ංආඈඍඁඒ'ൺඅඒ
6RPHWHFKQLFDODVSHFWVRIWKLVSKDVHKLJKFRQÀLFWOHDGLQJWRVRPH
turning point moment, where you give the characters (and the audience)
a reason for this relationship to continue. (I’ve seen/read so many plays
where I know the audience would ask “Why would s/he ever see this other
person again?”) It’s also in this initial phase that the social reality of the
characters (and the play) is sketched in: where they come from, what sort
of town it is etc. You don’t go overboard, but explain enough to give the
opening encounter some reality and bite.
I use the word ‘friend’ very advisedly. It’s often the wrong term for
the types of dramatic relationships that are possible in plays. In real life,
GRIULHQGV¿JKWDVPXFKDVWKHDYHUDJHGUDPDWLFUHODWLRQVKLS"3UREDEO\
not, and that’s because in real life, friends exists on the social surface,
and/or share deep personal unanimity. But in plays, a ‘friend’ is closer
WRµHQHP\¶EHFDXVHWKH\DUH¿JKWLQJRYHUSRVVHVVLRQRI\RXUVRXODQG
dealing with deep, nasty, hidden, private, volatile and painful things that
the dramatic character would rather remain hidden. Hence there’s usually
PRUHFRQÀLFWLQSOD\VWKDQUHDOOLIH%XWIRUDOOWKHUHVLVWDQFHWRFKDUDFWHU
change, it still occurs, and eventually the relationship of A and B has
become important to each other. In this vital phase, lots of things start to
happen: the characters may start to enjoy each other’s company (instead
of just pretending to, as before). They may start to need each other (for
business, personal, sexual or psychological reasons). The relationship
may become co-dependent and even addictive. It’s at this point that a
FKDUDFWHU¿QDOO\µFRQIHVVHV¶WKLQJVDERXWWKHWUXHVWDWHRIKHUVRXODERXW
what she really wants from life and the other character; and at this phase
DJOLPSVHRIWKHFKDUDFWHU¶VSHUVRQDO+HDYHQDQG+HOOLV¿UVWVHHQDQG
FHUWDLQO\¿UVWH[SODLQHG
Technical aspects of this phase: this phase, being so big and important
for the characters (and the play) sometimes takes more than a single scene
(unlike the previous two phases); risk should be involved for one or both of
the characters; (that is, “If I do this, I will lose x, y and z, which are beloved
traits that I’ve held onto for so long.”) Crucially, whatever has attracted
HDFKWRWKHRWKHUVKRXOGDSSHDUSHUKDSVIRUWKH¿UVWWLPHDVKROGLQJRXW
the possibility of salvation on a much wider level for one or both of the
characters. And what marks the climax of this phase is not a turning point
(though there may be one in the scene), and not a breakthrough (as with
the previous phase) but culmination. In other words, for at least one of
the characters, this journey into further closeness is a solution and end-
point for him/her. It seems like all his/her troubles are over. (That’s why
WKLVSKDVHRIWHQPDUNVWKHHQGRIWKH¿UVWSDUW²VRPHWLPHVHYHQWKH¿UVW
act—of a full-length play.)
5. Problems (Re-)Develop
This phase is (sadly) where life meets art. What seems such a great
idea (that is, the previous phase) starts to be questioned (and this time, it’s
by both characters and audience). Weaknesses in the relationship become
obvious. The strategy of one or both is starting to fail. Some of the pres-
sure that marked earlier phases is starting to return.
Technical aspects of this phase: Try and have at least one of the
characters hang on to the utopian dream which made them enter this
relationship. (In a sense, all dramatic relationships are utopian dreams,
founded on beliefs/attitudes that the plot will put such pressures on as to
render them unworkable.) Related to this, keep them pushing for what
they want, even in the face of mounting evidence to the contrary.
7. Showdown/Decision Time
And at the top of this hill lies … a narrow plateau called Suspense.
What will happen to the characters? What will happen to the relationship?
21st Century Playwriting 259
At this phase, the central interest is who will win/lose and what this will
do to the relationship.
Technical aspects of this phase: the scene where this phase occurs
can be a mixture of quiet (suspense) and loud (tension, fear, hysteria,
violence). The scene often involves a decision. And the decision appears
WREH¿QDOVSHOOLQJWKHHQGRIWKHUHODWLRQVKLSRULWVUHOHDVHLQWRDµOLYHDEOH
health’ and future viability.
8. Ending/Beginning
The fascinating thing about this phase is that it often reverses the
H൵HFW RI WKH SUHYLRXV SKDVH -XVW ZKHQ \RX WKRXJKW WKLQJV ZHUH RYHU
(or even that they were almost perfect), something happens to qualify or
reverse it all. The relationship may have ended formally (or emotionally,
VH[XDOO\SURIHVVLRQDOO\SV\FKRORJLFDOO\HWFEXWWKHUH¶VRIWHQRQH¿QDO
meeting, and at this last meeting, something new happens: it might be a
breakthrough into understanding on the part of a character; it might be the
release of forgiveness; it might be the hope of resurrection (for a character
or the relationship itself.)
Technical aspects of this phase: it tends to reverse the previous phase,
or at the very least, to qualify it or render it meaningless. The phase is one
of the shortest of all the phases; probably even shorter than the honeymoon
phase. There is either a twist or there is a reversal involved. There’s the
Chinese Curse Twist: “May you get what you want” (and it proves to be,
not heaven, but hell itself.) There’s the ‘Wants Vs Needs’ Twist, that is,
where a character who got want she wanted in the previous phase now
gives it up because she goes for what she actually needs.
I’ve been necessarily general, because there are so many things you
can do with this general pattern of ‘relationship journey’. For example,
you can miss out a phase. You can alter the order, or revisit a phase (mak-
ing the journey as unpredictable as life itself). If it’s a short play, you can
situate the entire play within one or two phases. At the very least, you
can go fast with this pattern. (I’ve sat in plays where the audience knows
the relationship journey from the second scene onward.) The point of this
pattern is not to impose it upon your play, but to know it exists, so you can
transform it into something volatile, unpredictable and strange—which
is how we often see love and life itself.
261
&ඁൺඉඍൾඋ
THE ART OF TITLES
This chapter should really be called “the luck of titles”. There are
many titles I wish I’d thought up and would kill a close relative to obtain.
Other titles leave me cold. It’s subjective, but not quite. There’s almost
DQDUWWRLW7KHUH¶VGH¿QLWHO\VRPHOXFN/HDYLQJOXFNWR\RXDQG\RXU
fortune cookies, I’ll concentrate here on exploring the art of creating a
title for your play.
A very bright and hard-headed theatre manager once told me, “The
job of a play’s title is to get people into the theatre.” From her point of
view, the title was the big come-on. It pulled people in, because something
about the title attracted them. To understand the basis of this attraction,
I’ll state some principles involved in the creation of titles.
The best plays usually announce their metaphysical nature right from
the start. The Unbearable Lightness of Being. Though a novel, this title
262 7ංආඈඍඁඒ'ൺඅඒ
The playwright Stephen Sewell believes that all plays deal with either
VH[RUGHDWK7LWOHVVRPHWLPHVR൵HUDSURPLVHRUDWKUHDWFatal Attrac-
tion, Primal Fear, Basic Instinct, Primal Attraction, Basic Fear, Primal
Instinct ... You get the point. Dark is aligned with light. Opposites attract.
The fantasy repels. The fear attracts.
Chocolat. The Tempest. The Waves. Clouds... all these deal with the
poeticising of the natural world, so that it aligns humanity, nature and
sensory experience. Miss Smilla’s Feeling for Snow also does this. When
nature is used evocatively the sensual impact of the title can be both
beautiful and powerful.
Throughout the play, there is a central search for meaning, value and sig-
QL¿FDQFH8OWLPDWHO\DWWKHSOD\¶VFOLPD[DQDWRPERPEH[SORVLRQWDNHV
WKHWRUWXUHGFRQFHUQVRIWKHFKDUDFWHUVWRDQHZOHYHORILQVLJQL¿FDQFH
SIZE MATTERS
7LWOHVFRPHLQVHYHUDOµVL]HV¶,Q¿OPDQGWKHDWUHQRZDGD\VWKHPRVW
common type of title is the single-word title. Beethoven. Juice. Fishgirl.
Ransom. Bliss. Furious. Luv. Sleuth. Frenzy. Loot. Amadeus. Arcadia.
7KH\ LQVWDQWO\ HYRNH HLWKHU DQ HQLJPDWLF RU ODUJHUWKDQOLIH ¿JXUH RU
some desired state or condition. (“Care to visit Arcadia?” “Yes, please.
Two return tickets.”) There’s also a modern, don’t-waste-time quality to
these one-word titles. Get to the point. Tell us what you’re selling.
The next size up is the two-word title. They may be a double-act: Troilus
and Cressida. Tristan and Isolde, or on a more modest level, Lettice and
21st Century Playwriting 265
Lovage. It may combine the incongruous: Kafka Dances. Juxtaposition,
irony and the pairing of odd couples (whether real people or intangible
qualities) is common for these titles. Paradise Lost. The Governor’s Family
(‘The’ doesn’t really count). My Vicious Angel'H¿QLWHO\DWKUHHZRUG
shoe-size here. But the rhythm and imagistic power of the second and
third word illustrate the attractiveness of the well-chosen two-worder.)
With the medium-length title, musicality, the striking image and the
promise of a form are very common. There is nearly always a rhythm
with a very clear pulse. You could almost notate their rhythms. Love In A
Cold Climate. A View from the Bridge. The Private Visions of Gottfried
Kellner. A Midsummer Night’s Dream. The Secret Diary of Adrian Mole,
Aged 13 ¾. The True History of the Kelly Gang. When I Was a Girl I
Used to Scream and Shout. There is a past, or another country, a ritual,
DQXOWLPDWHWUXWKRUDGH¿QLWLYHIRUPWKDWLVSURPLVHG7KHNH\ZRUGDV
always, is ‘promise’. Good titles promise something. It’s then up to the
play to deliver. But by that time, the audience is already inside the theatre.
:LWKWKH¿QDOVL]HWKH,PPHQVHO\/RQJ7LWOHZHVWDUWJHWWLQJDELW
silly—or even spectacular, depending on your point of view. The Persecu-
tion and Assassination of Jean-Paul Marat, as Performed by the Inmates
of the Asylum of Charenton, under the Direction of the Marquis de Sade ...
If there’s any more to this title, I’ve forgotten it. Most know it as Marat/
Sade. The long title is a poster-maker’s nightmare. Imagine putting all
those letters up outside a theatre in Broadway. But the very bizarre length
is its own mad publicity. And publicity doesn’t hurt a play. Who is Harry
Kellerman and Why is He Saying These Terrible Things About Me? also
attracts, not least because of the length of its paranoid comic focus.
$¿QDOWKRXJKW&RQVLGHUURDGWHVWLQJ\RXUWLWOHV$VN\RXUIULHQGV
“Would you go and see a play called ... (your title here)?” If they appear
shocked, hesitate, or just look embarrassed, you have your answer. Keep
working on the title. Redrafting a title isn’t half as hard as redrafting the
SOD\LWVHOI7KHQDJDLQLI\RXQHYHUKDYHWKHOXFNWR¿QGWKHSHUIHFWWLWOH
for your piece, then the search isn’t hard; it’s impossible. In the absence
of luck, try the above suggestions. But write the play anyway. The title
may well come late in the writing, when you’ve all but given up hope.
Life, or a long walk, might supply you with one.
267
&ඁൺඉඍൾඋ
'5$0$7,&6758&785(,6758&785($1'7+(81/($6+,1*
2)(1(5*<
,¶YHOHIWWKLVKXJHDUHDXQWLOODWHLQWKHERRNEHFDXVH,ZDQWHG\RXWR
JHWDIHHOIRUODQJXDJHVSDFHVWRU\DQGWKHVWUDQJHUV\RX¶OOEHWHOOLQJ\RXU
VWRULHVWR%XW,FDQ¶WGHOD\DQ\ORQJHU,W¶VWLPHWRWDFNOHWKHIDVFLQDWLQJ
DQGGL൶FXOWDUHDRIGUDPDWLFVWUXFWXUH
'5$0$7,&(1(5*<7(16,21$1'7+(:5,77(13/$<
)RUDXGLHQFHVDµSOD\¶LVVLPSO\DVWRU\WROGLQDWKHDWUH%XWIRU
SOD\ZULJKWVLW¶VPXFKPRUH,¶GGH¿QHLWDVIROORZVA play is the visible
and invisible form that results from the releasing of energy into physical
space where that energy is derived from a narrative and social context.
$VWRU\LVDQH[FXVHWRUHOHDVHHQHUJ\DQGWKHUHVXOWLVUHOHDVHGLQWRD
VSDFHFDOOHGDWKHDWUH
%XWZKDWLVµHQHUJ\¶DQGKRZLVLWFUHDWHG"7KH2[IRUG(QJOLVKGLF-
WLRQDU\GH¿QHVHQHUJ\LQLWVFRPPRQXVHDV³IRUFHYLJRU´%XW,SUHIHU
WKHXVHWKDWWKHVFLHQFHRI3K\VLFVJLYHVWRWKHZRUG³$ELOLW\RIPDWWHU
RUUDGLDWLRQWRGRZRUN´7KHNH\ZRUGKHUHLVµUDGLDWLRQ¶DVLIHQHUJ\
LV DQ LQYLVLEOH G\QDPLF WKDW SXOVHV WKURXJK HYHU\WKLQJ OLYLQJ RU GHDG
,W¶VPRUHWKDQMXVWµORXGQHVV¶RUEUXWHIRUFH)RUWKHSOD\ZULJKWHQHUJ\
LVERWKWKHPHDQVDQGWKHHQG(QHUJ\LVLQMHFWHGLQWRDVFHQHLQRUGHUWR
FUHDWHPRUHHQHUJ\$QGWKHUHDUHPDQ\ZD\VWKDWHQHUJ\FDQEHFUHDWHG
LQDQGIRUWKHWKHDWUHVSDFH
x :KHQDQDFWRUPRYHVHQHUJ\LVFUHDWHG
x :KHQDQDFWRUVSHDNVHQHUJ\LVFUHDWHG
x :KHQDQDFWRUµSOD\VDQHPRWLRQ¶HYHQLIVWDQGLQJSHUIHFWO\
VWLOOHQHUJ\LVFUHDWHG4XLWHDSDUWIURPWKHQDUUDWLYHFRQWH[W
WKHZD\WKHDFWRUXVHVKLVERG\ZLOOJLYHDQDXGLHQFHHQRXJK
KLQWVIRULWWRIHHOWHQVLRQ
)RUWKDWLVWKHWUXHIXQFWLRQRIWKHDWULFDOHQHUJ\VRWKDWWKHDXGLHQFH
ZLOOIHHOtension. $QGZKHQWKLVDXGLHQFHIHHOVWHQVLRQLWZLOODOVRORQJ
IRUrelease IURPWKHWHQVLRQ,WLVWKHFRQVWDQWRVFLOODWLRQRIWHQVLRQDQG
UHOHDVH WKDW LV WKH HVVHQWLDO H[SUHVVLYH PHGLXP RI µOLYH SHUIRUPDQFH¶
ZKHWKHUWKHDWUHRSHUDPXVLFGDQFHRUEDOOHW
268 7ංආඈඍඁඒ'ൺඅඒ
SHAPING ENERGY
The growth of energy looks much more like the second, jagged line
EHORZWKDQWKLV¿UVWWRRVPRRWKOLQH
The great plays start at a very high point. (Think of the tension of the
RSHQLQJRI+DPOHW7KH\WKHQGLSEULHÀ\DVPRUHGUDPDWLFLQIRUPDWLRQ
is allowed to enter. But once the new dramatic information has entered
(in the form of new characters or sub-plots), it once again resumes this
inexorable building of energy.
In general, the energy of a two-act play looks much more like the
VHFRQGLOOXVWUDWLRQEHORZWKDQWKH¿UVWXQUHDOLVWLFDOO\VPRRWKOLQH
ACT I ACT II
ACT I ACT II
21st Century Playwriting 271
Notice how, after an initial build, the play may drop, then start building
DJDLQDVFRQÀLFWDQGSORWGHYHORSPHQWRFFXU)XUWKHUGHOLEHUDWHGLSVRIWHQ
occur. There is usually a decline in energy after the climax of the act. It’s
one of the things that tells an audience “the play’s action has culminated.
*RDQGJHWDFR൵HH´,I\RX¶YHHYHUVDWLQDWKHDWUHZKHUHWKHDXGLHQFH
didn’t realise that Act I had ended, then you’ll know the reason. The confu-
sion in the audience was caused because the writer hadn’t produced that
decline of energy, or else the director had ignored it.
Occasionally, the energy may rise suddenly at the end. An odd array
RISOD\V¿OPVDQGRSHUDVGRWKLV3XFFLQLDQGRWKHUQLQHWHHQWKFHQWXU\
operas often have a sudden melodramatic rush of energy. So does Pinter.
So do thrillers, and even vampire movies, of all things, when in the time-
honoured fashion the vampire comes to life again at the end of the movie.
PHDQLQJVRQPDQ\OHYHOV7UXWKLVPDGHSXEOLF&RQÀLFWVDUHH[KDXVWHG
and gives way to something higher than anger. Peace may break out. Ac-
FHSWDQFHRIWKHVLWXDWLRQPD\UHVXOW)RUWKH¿UVWWLPHIRUJLYHQHVVPD\
enter the picture. Understanding certainly will. Real love may emerge.
The true nature of things may become apparent, and all involved may
¿QDOO\VHHWKLQJVDVWKH\DUH
:KDWHYHUWKHQDWXUHRIWKHFRPSOH[PHDQLQJWKDW\RXUVWRU\¿QDOO\
releases, there is usually a decline in energy when it does. But by the
time this loss of energy occurs, it doesn’t matter. In fact, the audience is
grateful. It can settle into a contemplation of the deeper truths that your
story is really concerned with.
Here’s a simple example to explain the description I’ve just given.
In A Doll’s House, by Henrik Ibsen, Nora has a secret that will bring dis-
grace upon her husband, given the conservative Norwegian atmosphere in
which they live and work. The play’s rising energy and tension come from
a very clearly motivated impulse: to keep the secret from the husband.
After desperate actions and counter-actions, the attempt to suppress the
truth fails. The theatrical energy declines simply because Nora stops the
useless struggle to stop the truth emerging. When she does, and gives both
herself and the audience a break from the nervous tension, something quite
PDUYHOORXVKDSSHQV0HDQLQJEHJLQVWRÀRZHUDOPRVWRUJDQLFDOO\IURP
WKHFKDRVRIWKHEHVWODLGSODQVRIKXVEDQGDQGZLIHDQGWKHODVW¿IWHHQ
PLQXWHVRIWKHSOD\WDNHSODFHRQDKLJKSODWHDXRIJUHDWVLJQL¿FDQFH
What emerges and grows may best be described as ‘the true meaning
of the lie by which both Nora and her husband have lived’. The elaboration
RIWKLVWUXHPHDQLQJJURZVDVLQIURQWRIDWUDQV¿[HGDXGLHQFH¶VH\HVZH
VHHDFKDUDFWHUXQGHUVWDQGDSURIRXQGWUXWKIRUWKH¿UVWWLPH7KXVLQVWHDG
of a manically driven linear search in order to stop the truth coming out, a
multi-linear growth begins from the moment that truth emerges. That is,
understanding is deepened, and the contradictory and paradoxical nature
of their relationship is made clear. Meaning is rich and multi-faceted, and
has its own tension, because now, another crisis has to be faced.
It may be summarised thus (and applies to many plays): “Now that
we know the full truth, what are we to do?” Nora’s startling action once
WKHWUXWKÀRRGVRXWVKRFNHGLWVDXGLHQFHVDFHQWXU\DJRDQGVWLOOPDNHV
exciting theatre. In other words, the plot made sure that there was a growth
toward meaning ... and then beyond.
VARIATION 1:
7KH¿UVWYDULDWLRQRQWKHDERYHEDVLFGUDPDWLFPRGHOLVWRVLPSO\
announce the dramatic goal quite openly at the start of the play.
Writers sometimes wait too long before having their characters an-
nounce their dramatic objectives. It’s a delicious thrill for an audience
to feel that they are privileged witnesses to “the only way this can end.”
I’d suggest you try one of two things: either announce the dramatic goal
quite openly, or else instantly (from page 1) create the conditions that will
make the dramatic goal inevitable.
VARIATION 2:
Any play in which the search for a past truth is so important that it be-
comes a crucial part of the plot is, in essence, a detective story. The search for
‘what really happened that day’ is the simple engine that has driven many great
SOD\V2HGLSXV5H[PXVW¿QGRXWZKDWKDVFDXVHGWKHSODJXHWRGHVFHQGXSRQ
7KHEHV+DPOHWQHHGVWR¿QGRXWWKHWUXWKDERXWZKDWKDSSHQHGWRKLVIDWKHU
$ULVWRWOHEXLOWWKH¿UVWJUHDWGUDPDWLFWKHRU\VXEVWDQWLDOO\IURPWKHSUDFWLVHRI
Oedipus Rex<RXGRQ¶WKDYHWREHLQORYHZLWKGHWHFWLYH¿FWLRQWRDSSUHFL-
ate that the search for truth is not just ‘a part of the plot’. It’s fundamental to
the mixed blessing we humans know as consciousness. To be conscious is
a privilege and a curse. We know we are alive, but not why—or the reasons
are, at the very least, disputed. The search to understand lies at the heart of
WKHPDJQL¿FHQWSUHWH[WNQRZQDVµGUDPD¶
276 7ංආඈඍඁඒ'ൺඅඒ
$QRYHOWHQGVWRDSSURDFKWKLVVHDUFKIRUWUXWKTXLWHGL൵HUHQWO\IURP
a play. I’ll explain it this way. Imagine an iron bar, on which were written
all the events of a story, from the very beginning to its end. Thus, letter
µ$¶ZRXOGEHWKHYHU\¿UVWHYHQWWKDWFDXVHGWKHVWRU\WRKDSSHQ,QGHWHF-
tive stories, it is usually an initiating crime or ethical treachery (adultery,
kidnapping, incest, cheating, a disappearance etc). The last event in time
LVOHWWHUµ=¶WKHHYHQWWKDWFOHDUVLWXSDQGJHWVWRWKHIXOODQG¿QDOWUXWK
emerging. (For reasons of space and nervous energy, I won’t enter the
problematic area of asking if truth can ever be fully known.)
A detective story tends to enter around the middle of the story. Let’s call
LWµ1¶$IHZKRXUVODWHUDGHWHFWLYHLVFDOOHGLQDWµ2¶7KHGHWHFWLYH¶V¿UVW
task is to establish the events surrounding the murder (where, when, who).
This involves a backward movement into the past, and with this backward
movement, a fundamental plot mechanism has been established. That is, a
detective story consists of the tension between movement into the past, and
movement into the future, with only very short and moody transit stops in
WKHSUHVHQW7KH¿QDOWZRHYHQWVRIWKHVWRU\DUHµ$¶DQGµ=¶7KDWLVWKH
murderer is arrested at ‘Z’, and the last piece of the puzzle at ‘A’ is exposed.
Thus, a search for what happened is a deliberate drive into the past.
But the actions taken to establish this truth are a movement into the future.
Every time the investigating detective makes an appointment with a wit-
ness, asks a question, or visits a crime scene, it is an action that takes her
into the future because it eats up time. The only ‘present’ time in this sort
of story is the brief rest between plot and information. And you can always
tell these moments, because it’s usually the end of a day, and saxophones
are playing somewhere, and the detective is drinking too much. But it’s
only a matter of time before that telephone rings again.
21st Century Playwriting 277
VARIATION 5: THE DETECTIVE SHAPE IN THEATRE
The most marked feature of the detective shape in stage plays is the
use of compression. As the diagram below shows, the forward thrust of
WKHSOD\µWR¿QGRXWWKHWUXWK¶LVFRPSUHVVHGLQWRDIHZKRXUVRUGD\V,Q
‘detective plays’, the drive to suppress the truth is every bit as strong as
WKHQHHGWRH[SRVHLW&RQÀLFWLVHDVLO\SURGXFHG7KHULVLQJWHQVLRQRIA
Doll’s House comes because Nora tries to suppress what must inevitably
come out. Arthur Miller learned enough from this technique to produce
KLV¿UVWLPSRUWDQWSOD\All My Sons.
By writing a play where a search for truth is involved, you can learn
a lot about how to release information to an audience. At the very least,
\RXZLOOOHDUQHQRXJKWRZULWHDVWDQGDUG79RU¿OPWKULOOHUVXFKJHQUH
¿OPVKDYLQJEHFRPHWKHQDWXUDOKRPHIRUVXFKSORWSDWWHUQV
But as I’ve already mentioned in Chapter 15, too obvious a use of
the detective shape can produce what the writer and dramaturg, Keith
Gallasch calls the “Buried Child Syndrome”. This is where there is a
terrible, dark secret buried nearby (literally, as in Sam Shepard’s play
Buried Child). It is meant to produce a gothic revulsion in the audience at
the dreadful secret that is so shameful it cannot be told. Sadly, I’ve seen
two productions of Buried Child where the ‘terrible climax’ of the play
produced not awe but laughter. It’s as if the audience was saying, “Is that
what all the fuss was about?”
:K\WKLVLVVRGHVHUYHVDFKDSWHUWRLWVHOI6X൶FHWRVD\WKDWPRGHUQ
audiences are becoming less-attuned to ‘the structuring of guilt’ which so
278 7ංආඈඍඁඒ'ൺඅඒ
GULYHVWKHHDUOLHUSOD\VRI0LOOHU2GHWVDQG,QJHVR¿OOHGDVWKH\DUHZLWK
a sense of Original Sin. But the way to get under a modern audience’s
skin is to deal principally in consequences. That is, don’t get obsessed
with the drive to suppress the truth. It creates such huge pressures of
expectations about the nature of the truth, that the eventual revelation is
bound to be anti-climatic. Instead, let the secret out (even by hints) quite
early, so that the consequences of knowledge start to play havoc in the
lives of the characters. It’s all about consequences, and what characters
do to themselves, rather than what Truth is supposed to do to characters.
Plot is not just what a character does. It’s also what happens to a char-
acter. Character A can ‘do things’ to character B, but character B can also
GRLWWRKLPVHOI,QRWKHUZRUGVLQGUDPDPXFKGDPDJHLVVHOILQÀLFWHG
The tragic notion, after all, is that no matter how perfect a person is, there
is always one thing that will bring him or her down.
The diagram above might be called the ‘Tragedy of a Good Person’.
Imagine a story where a person set out to do good (represented by the star in
the above diagram), but a decisive event turns him in the reverse direction. This
pattern applies both to tragedy and comedy. Coriolanus’s bruising encounter
21st Century Playwriting 279
with the people embitters him, and he turns savagely, vowing revenge on
all of Rome. In Emerald City by David Williamson, Colin, the aspirational
KLJKDUWZULWHU¿QGVWKDWKLVH൵RUWVDUHQRWDSSUHFLDWHGVRKHYRZVWRZULWH
UXEELVKDQGPDNH³ORWVDQGORWVRIPRQH\´7KHUHLVDOZD\VDWKLUGDQG¿QDO
stage of self-recognition, where the previous evil or excess is corrected, or
at least stopped. Colin accepts that he is neither a great artist nor a comfort-
able populist, and looks elsewhere for the solution. Coriolanus desists from
sacking, and returns to face certain death at the hands of Rome’s enemies.
The diagram below shows how a character may have entirely worthy
goals, ideals or ambitions, but she simply chooses the wrong way to go about
it. A poor choice of tactics, or a misreading of people, a lack of awareness, or
a blindness to bigger issues, all may ruin the worthiest of objectives. Willy
Loman’s heart is in the right place, but he lacks astuteness, he misreads situ-
ations, he is psychologically maladroit, and he cannot achieve his current
goal because he is haunted by previous failures in his life.
With the next diagram, we reach a unity of means and ends. A char-
acter sets out to be evil, and chooses the appropriate means:
8QOLNHSUHYLRXVSDWWHUQVZKHUHJRRGZDVLQWHQGHGWKHHYLOH൵HFWKHUH
is exactly what was planned for. It’s up to society to do the correcting, if
any. Once, traditional morality demanded that evil people be punished, that
the killer get a slug in the guts, and that innocent people go free. But we
280 7ංආඈඍඁඒ'ൺඅඒ
have lost our moral simplicities. Friedrich Dürrenmatt asked, “Is tragedy
possible after Auschwitz?” He was challenging the simple redemptive
PRUDOLW\WKDWWRWKLVGD\PDUNVWKHPDMRULW\RI$PHULFDQ¿OPVIRUXQ-
derstandable reasons. Nor is it simply a matter of easy moral inversion—
which Hollywood also sometimes indulges in—whereby good is bad, and
bad is good. It’s mostly a matter of accepting numerous shades of grey.
Moral complexity or moral suspension are the two highest ethical aims
of much of the last century’s literature, and the trend is sure to continue.
0RUDODYRLGDQFHLVDFRSRXW-RH2UWRQVXEYHUWVVRWKDWWKRVHZKRÀRXW
traditional morality escape with the loot while those who are decent go
to jail, but it’s done for a reason. His plays are about the theatricalisa-
tion of individual freedom. Oscar Wilde’s plays suspend our impulse to
moralise because Wilde feels that there are things far more important in
life than duty, reason, decency and subservience to convention. No judg-
ment is intended here: It’s your own decision as to what morality your
world consists of.
I’m simply indicating the dynamic/dramatic shapes possible. It’s up
to you to decide on the morality—and the consequent structure— of the
story you are dramatizing.
,QGUDPDJRRGSHRSOHÀRXULVKDQGVRGREDGSHRSOH,W¶VDOODPDWWHU
of timing. When you and your audience have agreed to identify a particular
character as ‘bad’ (when seen in the context of whatever ethical world you
create in your story), you are making a pact with that audience whereby
you show them ‘one way that people live’. A myth (as distinct from a
legend) has this tendency. As I said earlier, a myth is a non-judgmental
pattern of human behavior, with a story that dramatizes that behavior. No
purple-veined moralising is entered into. The Greek myths simply say,
“This is one way that people behave.” So do the gods. For every aspect
of human behavior there is a god.
Sometimes the gods smile on you. Examine the diagram below.
Imagine a story where two characters (C1, C2) each started from about the
same position. Imagine that C1 got everything (money, power, fame) that
she desired. Imagine that C2 got precisely the reverse: poverty, disgrace
and humiliation. You’ve just created a pattern. It won’t be a simple pattern
EHFDXVH¿UVWLWZRQ¶WORRNVLPSOH,WZLOOEHJRYHUQHGDQGPRGL¿HGE\
other patterns and a host of other factors that will turn your play into the
complex thing that it aspires to be. Second, even if it did turn out a bit
simple, the audience probably won’t mind. They actually go to the theatre
WR¿QGSDWWHUQV²LQSORWFKDUDFWHUPRUDOWUDLWVDQGDKRVWRIRWKHUDVSHFWV
of human experience.
The next diagram shows a similar ‘crossover’ pattern, but it has a new
balance at the end. It’s more complex, and probably more interesting, as
‘good fortune’ is always relative, and a type of queasy ambiguity is both
common and palatable to our western consciousness, which never quite
accepts its good luck and happiness.
282 7ංආඈඍඁඒ'ൺඅඒ
&ඁൺඉඍൾඋ
DRAMATIC STRUCTURE (II): THE TECHNIQUES OF SCENE
WRITING & PHASE WRITING
In one sense, no scene is the same as any other. The unique combi-
nation of characters, relationships, place in the story, and position in the
rising scale of the play’s dynamics all mean that, to some extent, a good
scene is a unique and highly idiomatic event.
But this is not the whole truth. The fact is, there is a generalised pat-
tern to theatre scenes. The diagram below indicates this general pattern.
21st Century Playwriting 287
Just as a play’s plot is the narrative ‘excuse’ for the release of energy,
so is a scene. Whatever story is in your scene becomes the opportunity
to release energy. How high the energy goes depends on the emotions
involved in that scene.
A scene can start quite soft, ‘low’ (in energy), and quite muted in tone.
Alternatively, it can start very strong, with powerful emotions and high
energy. (If the latter, it tends to drop before rising again.) A complication
LQWKHSORWFDQPDNHWKHHQHUJ\GURSDJDLQ%XWGUDPDWLFFRQÀLFWVRRQ
pushes the energy to a high point (sometimes called a climax), at which
WKH HQHUJ\ LV VXVSHQGHG EULHÀ\ EHIRUH HLWKHU VLQNLQJ RU ULVLQJ DJDLQ
depending on where you end your scene.
This may appear quite complex, but in fact it’s very simple, at least
in broad outline. Imagine this—a man enters, and quite suddenly tells
his lover that he is going to leave his wife for her. The man’s enthusiasm
for his new life pushes up the energy of the scene. But the lover, taken
aback, replies that she doesn’t want this, at least not yet. This sudden
UHYHUVDOIRUWKHKXVEDQGFDXVHVWKHHQHUJ\WRGURSEULHÀ\%XWWKHQKH
gets angry. They both get angry, and the discussion shifts to their own
relationship, and bitter, vicious things are said. By the end of the scene,
something startling has happened: the man and his wife have not broken
up; he and his lover have.
The concept of the ‘scene issue’ will be useful. A scene issue is that
idea, issue, point of view, opinion or state of mind that will be focussed on
and argued over during the course of the scene. Mamet’s view on scenes
is useful here. In an interview, he suggested the following: “Unless you
KDYHWZRFKDUDFWHUVZKRZDQWGL൵HUHQWWKLQJV\RXGRQ¶WKDYHDVFHQH´
That’s not the whole story by any means—and personally, I disagree with
its blanket prescriptiveness, but it’s valid for many types of scenes you’ll
want to write. Man wants to leave wife for his lover; lover doesn’t want
KLPWR7KDW¶VWKHLVVXHWKH\DUJXHDQG¿JKWRYHU
You can create a good scene by leading with a ‘fake’ issue. In the scene
above, the audience would think that ‘leaving the wife’ is the real issue of
the scene. But it soon changes. The real issue of this scene is whether the
man and his lover will stay together. When that issue is decided, the scene
is over. Everything else is probably either atmospherics—or over-writing.
288 7ංආඈඍඁඒ'ൺඅඒ
—It might be the clearest statement of one or more of the parties’ opposi-
tion to each other. (e.g. “Did you hear me? I want you out! NOW!”
He exits.)
—It might be the acoustically noisiest part of the scene.
—It might be the most emotionally devastating moment of the whole scene,
where a character’s heart and soul are broken right in front of us.
—It might be when the scene issue is clearly decided, one way or the
other. (He’s won; she’s lost; scene over.)
21st Century Playwriting 289
—It might be when what is at stake in the scene (honor, self-worth, a job,
DORYHUDNLQJGRPLVGH¿QLWLYHO\ORVWRUZRQ
—It might be when a dramatic action or intention (eg to win her heart)
has been achieved.
—It might be when the truth is fully out in the open.
—It might occur between two characters when the action of the scene takes
their relationship to a new stage; for example, they’re now deeply
committed to each other; or even in love.
One type of scene climax is where the main issue or action of the scene
LVFRQ¿UPHG/HW¶VVD\WKDWZHNQRZWKDWLQDSDUWLFXODUVFHQHDZRPDQKDV
WRWHOOKHUIULHQGWKDWVKH¶VJRLQJWRKDYHWR¿UHKLP6KH¿QDOO\UDLVHVWKH
courage, and sacks him. The scene is over. For want of any better term, in
&KDSWHU,FDOOHGWKLVW\SHD&OLPD[RI&RQ¿UPDWLRQZKHUHWKHDFWLRQWR
EUHDNWKHQHZVRIKLVVDFNLQJLVFRQ¿UPHGLQWKHFOLPD[+HLVVDFNHG
The second type of scene climax is a Climax of Reversal. Here, the
ZRPDQZRXOGEHJLQWKHSURFHVVRIWHOOLQJWKHPDQKH¶V¿UHGEXWVRPHWKLQJ
goes wrong, new information is learned etc, and by the end of the scene,
the person who is out of a job is not him, but her. The action of the scene
(to break the news of his sacking) is reversed in the eventual climax (She
learns that she is to be sacked instead.)
The longer the scene, the less likely that you can structure it as a simple
&OLPD[RI&RQ¿UPDWLRQXQOHVV\RXFUHDWHDQHYHQPRUHLQWHUHVWLQJVWUXFWXUH
ZLWKVHYHUDOPLQLFOLPD[HV6KHWHOOVKLPWKHEDGQHZVKH¿JKWVEDFN
VKHFRQ¿UPVWKHQHZVDQGUHIXVHVWRZDYHUKH¿JKWVEDFNDJDLQWKLVWLPH
PRUHH൵HFWLYHO\DQGVKHEHJLQVWRZDYHUQRZLW¶VKHUZKRLV¿JKWLQJIRU
her survival, until at a crucial moment she realises he’s been acting under a
false premise. She produces her ace card (maybe some piece of information),
DQGKHLVGH¿QLWLYHO\EHDWHQ+HOHDYHVDQGVKHEUHDWKHVDVLJKRIUHOLHI
Experiment with such unstable structures, as it’s very exciting for an
audience. They like not knowing the outcome of a scene until near its end.
I dealt with this subject in Chapter 14, but it’s worth revisiting, if
RQO\WRUHPLQG\RXWKDWVXEWH[WLVRQHRI\RXUJUHDWHVWDVVHWVLQ¿QGLQJ
the structure of a scene. Another of David Mamet’s wise dictums is useful
here: “Characters should never say what they want unless that’s the best
290 7ංආඈඍඁඒ'ൺඅඒ
way to get it”. Subtext is like an iceberg: nine-tenths below the surface, and
only one-tenth on top. It’s not going too far to say that a scene really gets its
formal shape and power from the gradual rise, iceberg-like, of subtext to the
surface. It’s a very exciting thing to sit in the audience and feel subtext get
closer to breaking the surface. You’re watching the character for that moment
ZKHQVKH¶OO¿QDOO\XQGHUVWDQGZKDW¶VEHHQJRLQJRQ:KHQWKDWKDSSHQV
DQGLW¶VDOORXWWKHUHRQWKHVXUIDFH\RX¶YHJRW\RXUFOLPD[³6KH¿QDOO\
knows the truth!”) and the scene is over (not to mention the relationship.)
There are lots of ways that you can contrast your scenes:
2QWKLVODVWSRLQWUHPHPEHUWRNHHSWKHVWDJHµWUD൶F¶RI\RXUVFHQHV
moving around. Mix character combinations around. For example, char-
acter A and B, then A and C, then B, C and D, then D and A. If several
character combinations never meet in your play, it’s often a sign that
there’s something under-developed in your plotting.
It’s well-known that you can’t write a play until you can write a scene.
But what’s much less well-known is that the ‘hidden structure’ of scenes
is not made up of beats, or even scene drives, or character intentions. A
great scene gets created by the momentum of phases.
To understand this, let’s return to Glengarry Glen Ross, David
Mamet’s Pulitzer Prize-winning play. It’s got some of the clearest use of
phase writing you’ll encounter.
While all the scenes in that wonderful play are dominated by phase
writing, Scene 2 is particularly phase-dominated.
Scene 2 starts in a Chinese restaurant, where the bitter realtor Moss is
trash-talking with his more compliant, but fatalistic work-colleague, Aaronow.
%HLQJWKHEHJLQQLQJRIWKHVFHQHLWLVE\GH¿QLWLRQ3KDVHRIWKHVFHQH
Phase 1:
After more illustration of the lamentable humans they must deal with
in real estate, Moss gets to the point:
Having established the moral justice for their complaints, Moss moves
to broaden his and Aaronow’s outlook:
(Incidentally, note how, strictly-speaking, it’s not a new phase that
develops here now, but a continuation of the old. That’s why I’ve called it
Phase IB. Why is it not a new phase? Simple: because technically a new
phase changes the direction of the scene, usually by revealing information
that changes the situation. I’ll have more to say on the technical nature of
the phases below. For now, let’s return to this wonderful scene.)
Phase 1B:
0266 /RRNDW-HUU\*UDৼ+H¶VFOHDQKH¶VJRLQJLQWREXVLQHVV
for himself, he’s got his, that list of his with the nurses...
see? You see? That’s thinking. Why take ten per cent? A
ten per cent comm... why are we giving the rest away?
What are we giving ninety per... for nothing.
Eventually, Moss gets to his real point, which will change the situ-
ation completely:
Phase 2:
... and the darker natures of each man ruminate on the fantasy of
revenge and personal enrichment.
Climax of Phase 2:
$$5212: 'LG\RXWDONWR*UDৼ"
MOSS: Is that what I said?
AARONOW: What did he say?
MOSS: What did he say? He’d buy them.
294 7ංආඈඍඁඒ'ൺඅඒ
Phase 3:
Climax of Phase 3:
MOSS: You have to go in. (Pause.) You have to get the leads.
Phase 4:
&RQIURQWHGZLWKWKLVXOWLPDWXPE\0RVV$DURQRZVTXLUPVOLNHD¿VK
RQDKRRNIRUQRZDIRXUWKDQG¿QDOSKDVHKDVEHJXQ,WLVERWKGDUNO\
brooding and darkly comic. Having dangled the carrot before a tempted
$DURQRZWKHUXWKOHVV0RVVQRZKLWVKLPZLWKRQH¿QDODFH
Climax of Phase 4:
7KHIRXUWKSKDVHFOLPD[QDLOVWKHKDPPHULQWKHFR൶QRISRRU*HRUJH
Aaronow, and ends the scene brilliantly:
MOSS: ....You tell me, you’re out, you take the consequences.
21st Century Playwriting 295
AARONOW: I do?
MOSS: Yes.
AARONOW: And why is that?
MOSS: Because you listened.
²'L൵HUHQWFKDUDFWHUVWHQGWRGULYHHDFKSKDVH)RUH[DPSOH&KDUDFWHU
A might dominate Phase 1; while B dominates the second phase.
— Each phase tends to have a GLৼHUHQWtexture. For example, Phase 1
might be dominated by Character A telling a long, rambling and
apparently meaningless anecdote. But then the situation changes,
and Phase 2 might be dominated by Character B reacting to what
she realises is going on. (It’s true that the above example from
Glengarry Glen Ross has a similar ‘sliced’ texture throughout,
but such relentless back-and-forth horizontal texture is only really
H൵HFWLYHZKHQWKHGUDPDWLFVWDNHVDUHKLJKDQGWKHUHVXOWLQJZULW-
ing is irruptive and brilliant. We playwrights tend to overuse this
texture, as if it’s the only one we have! See Chapter 13 for more
information on texture.)
—New and surprising information (or ‘the reveal’) is the most commonly-
used way of bringing in a new phase. Have one of the characters
‘drop a bombshell’ (in informational terms) on the other character.
The resulting phase will show the reverberation of that bombshell
on the other character(s).
—The more phases you have, the longer the scene can be. To put it another
way, if you can legitimately create another phase, you’ll have bought
yourself more time in the scene; and, as already stated, revealing (ex-
plosive/shocking) new information buys you a new phase, whereby
the reaction to that new information can be dramatized.
—The arrival of a new character—or his/her exit might create a new phase.
—Most scenes have between two and three phases. A short scene may
only have one.
—Finally, beware of making your phases as long as Mr. Mamet
does in this scene—or else, write as brilliantly as he does here.
Generally, a phase length of approximately one page to one-
and-a-half pages is about right as an ‘average’ length. (But see
the next point also!)
296 7ංආඈඍඁඒ'ൺඅඒ
—The lengths of the phases should not be too similar. As the section on
,PSURYLQJ<RXU 6FHQH :ULWLQJ EHORZ FRQ¿UPV DQ DXGLHQFH JHWV
refreshed by contrasts, even in the length of the scene’s phases.
2. If you must have a long scene, then you need to learn the art of the
“build”. This is where energy rises in an inexorable but unpredictable way,
despite any necessary and temporary relaxations of tension.
3. Either make your scene energy rise fast, or have it change direction
(via plot complications, reversals etc).
5. The shorter the scene, the more quickly you need to build its energy.
,I\RXUµDUF¶RUHQHUJ\FXUYHLVWRRVKDOORZRUµÀDW¶FKDQFHVDUHLWZLOO
IHHOPRUHOLNHD79RU¿OPVFHQHWKDQDWKHDWUHVFHQH:K\"%HFDXVHWR
WHOOVWRULHVH൵HFWLYHO\LQVSDFHWKHWUDMHFWRU\RIHQHUJ\QHHGVWRFXUYH
KLJKHUDQGGRVRIDVWHUWKDQ¿OPRU79)RUPRUHRQWKLVDVSHFWUHUHDG
the chapter on writing for theatre space.
6. &RQVLGHUKDYLQJ\RXU¿UVWOLQHFUHDWHWKHµVFHQHLVVXH¶ZKHWKHUUHDO
or fake. If it’s the major issue of the scene that you start with, then it’s
probably going to be a short scene.
10. If there is a central relationship in your play, then regard each scene
WKH\ DUH LQ DV D VLJQL¿FDQW GHYHORSPHQW LQ WKHLU UHODWLRQVKLS7U\ WKLV
principle: New scene means their relationship is at a new stage. In drama,
it’s quite rare for a relationship to need more than one scene to show its
current emotional state.
11. Try and get your scene to advance any or all of the following: plot,
character growth, relationship growth, what the audience learns or the
spiritual atmosphere of the world the characters inhabit.
12. 'RQ¶WIRUJHWWKHQRWLRQRIWKHµHPRWLRQDODIWHUH൵HFW¶/HW¶VLPDJLQH
that two business partners in your play have a huge argument. A real
VFUHDPLQJPDWFK7KHQH[WVFHQHKDVWREHDUVRPHHPRWLRQDODIWHUH൵HFW
of this row, even if the next scene is a few days later. In dramatic terms it
is ‘immediately after’, or close enough to. The audience will expect you
to take account of that row, given the last thing they saw was these two
characters being furious at each other. To show them being good pals, as
if nothing happened won’t make sense to an audience. Hint at or show
the chilling of their relationship.
13. Remember the William Goldman principle, that writers should “enter the
scene as late as possible, and leave as early as possible”. What this means is
that you should consider starting your scene as close as possible to its climax.
14. Avoid constantly starting your scenes with characters being ‘discov-
ered’ doing something. That belongs both to TV and 19th century theatre
(the two forms often being quite similar in several ways.) It’s much more
dynamic and theatrically exciting to have characters enter theatre space,
with the force that comes from them knowing what they’ve got to do. Or,
to put this point another way, vary how you start your scenes: sometimes a
character enters full of energy and intention, and other times two characters
should be in the middle of an intense and involving action.
298 7ංආඈඍඁඒ'ൺඅඒ
15. Write your scenes with a sense that at any moment, one of the charac-
ters is wanting to leave the scene. Generally, when power or status shifts
in a scene, the weakened character either doesn’t want to be there (in
which case he’ll be trying to exit the scene) or else he desperately needs
the stronger character to stay, and does whatever he can to keep her there.
If this status changed a couple of times in the scene, you’d have a volatile
and exciting scene on your hands. For, as I explained earlier, a character
ZDQWLQJWRH[LWFUHDWHVDUHDOWHQVLRQDVZHOODVDGDQFHOLNHÀXLGLW\WR
the character’s movements in space. If nothing else, your director will
thank you, for making her job so much easier.
&ඁൺඉඍൾඋ
DRAMATIC STRUCTURE (III): THE TWO-ACT PLAY & OTHER
THEORIES OF NARRATIVE & DRAMATIC FORM
The Plot Snake was devised by Allen Tilley in his book, Plot Snakes
and the Dynamics of Narrative Experience (University Press of Florida,
1992). It is a theory of story shape that deserves to be better known. Put
simply, it goes as follows: A plot is a process of change; this change forms
300 7ංආඈඍඁඒ'ൺඅඒ
DSDWWHUQFRPPRQWRPDQ\VWRULHV7KHSDWWHUQLVPDGHXSRIÀXFWXDWLRQV
7KHVH ÀXFWXDWLRQV DUH WKH ZD[LQJ DQG ZDQLQJ RI WKH VWRU\¶V HQHUJLHV
The energies form a shape that looks like a snake; hence the ‘plot snake’.
To illustrate this, Tilley uses the fairy tale of Cinderella, dividing the
story into six phases:
5. Final Binding.7KHWXUQLQJSRLQWWRZDUGWKLVGH¿QLWLYHDQGFOL-
mactic phase begins when the Prince, almost as an afterthought,
asks if there are any other women in the house. The step-sisters
UHOXFWDQWO\ EULQJ &LQGHUHOOD IRUZDUG WKH VOLSSHU ¿WV KHU IHHW
and the Prince recognises his new love. The energies of the
story that were released in the initial moments (the invitation
to an exciting and potentially life-changing royal ball) were
bound and shaped into an optimistic world order (at least for
Cinderella).
Tilley’s snake is based on a simple premise: that when the story moves
into darker regions of chaos and disorder, the narrative ‘line’ moves down.
When order is restored, the line moves up.
What relevance does this have to playwrights working on a play
that is much more complex than Cinderella? Disregarding the rather
302 7ංආඈඍඁඒ'ൺඅඒ
IRONV\QDPHVJLYHQWRWKHYDULRXVSKDVHVIRUH[DPSOHµEXUQW¿QJHUV¶
WKHJUHDWYDOXHRIWKH3ORW6QDNHOLHVLQLWVÀH[LELOLW\,WFDQEHDSSOLHG
to micro-structures (the shape of an individual scene) as well as to such
big picture issues as the entirety of a play’s narrative shape, the ethical/
PRUDOÀXFWXDWLRQVRIDQ$FWRUWKHFRPSOH[LWLHVRIDVLQJOHFKDUDFWHU¶V
‘character journey’. Its beauty is that it makes clear what threatens to
become lost in details and complexity. To playwrights, it is a gift, in that
it can prevent us from getting lost in a forest of potentialities, and being
unable to see the structural wood for the trees.
Years of writing and dramaturgical experience have taught me (and
other writers I speak to) that a broad overall pattern—a sense of “I know
or I think I know where this character/Second Act is going.”—will do
wonders for your play, as well as possibly saving your sanity! The pattern
is not ‘simple’ any more than any other aspect of play writing is simple.
In any case, the Plot Snake may not be right for your play.
But you should at least pose the question before disregarding it. It
is quite possible that it works on at least one level of your play-making
(eg. scene construction, character arcs, act shape or overall play-shape.) It
can be surprisingly useful in another area of play-making: the relationship
journey, which I looked at in more detail in Chapter 18. In the course of
the play you are writing, it would be hard to imagine at least one dramatic
relationship not going through a pattern similar to the Plot Snake. So keep
an open mind about it until you’ve clearly proved to yourself that it’s not
right for any aspect of your play. Remember that if ‘story’ is a symbolic
narrative of human experience, then ‘plot’ is the temporal ordering of the
events or incidents of that experience. And the ordering of events and the
H൵HFWRQWKHFKDUDFWHUVWKDW7LOOH\DQDO\]HVGRHVLQP\YLHZULQJWUXHWR
what humans go through at some point in their lives.
Theatrical art in the 21st century is riven with aesthetic divisions, not
least in the area of ‘text’ and ‘linearity’. To many writers and theatre art-
ists, the latter is anathema. The idea that a work could be both linear and
innovative is, in the eyes of some theatre theorists, a contradiction in terms.
But to me, it’s no contradiction. Nor is it a contradiction to the gen-
eral theatre-going public, whose overwhelming preference (when it even
thinks about such things) is for straight-forwardness, clarity and ‘a great
story’. But as I’ve constantly tried to show in this book, innovation can
go hand-in-hand with great story-telling.
Hence, a look here at ‘linearity’. In one sense, the word is meaning-
less for theatre writers. The idea that a story goes forward in one line
21st Century Playwriting 303
of narrative development is absurd. Every play over ten minutes long
has between thirty and forty threads which make up their true form. To
understand that, I’ll illustrate how simply one thread operates, using a
classic play of the last century.
As we all know, Arthur Miller’s Death of a Salesman tells of the decline
of a fading salesman. If that’s all Miller’s play dealt with, it would truly be
a linear experience. But it also deals with Willie and Linda’s relationship. It
H[SORUHVWKHIDWKHUVRQH[SHULHQFHWZLFHZLWK%L൵DQG+DSS\$SDUDOOHO
‘success fable’ in the character of Bernard (when young and in mid-life) is
SOD\HGRXW:LOO\¶VWRUWXUHGLQQHUOLIHLVSOD\HGREOLJDWRZLWKFRQVWDQWÀDVK-
backs to the Uncle Ben and “what might have been” in Alaska. And crucially,
there is a mystery in the story: What happened in Boston all those years ago?
I’ll call that story thread the Mystery Woman thread. This thread is
present from the very start of the play:
$PHORG\LVKHDUGSOD\HGXSRQDÀXWH,WLVVPDOODQG¿QHWHOOLQJRI
grass and trees and the horizon.
7KHÀXWHVRRQIDGHVDZD\%XWDIWHURWKHUSORWVDQGFKDUDFWHUWKUHDGV
are set up, the mystery returns:
1RWHKRZ%L൵LVGUDJJHGLQWRWKLVWKUHDG7KDW¶VDFUXFLDOSRLQWHU
for later. Not long after this, Bernard, once a studious nerd the Loman
boys always used to laugh at but now a successful lawyer, asks Willy a
crucial question:
%(51$5' :KHQ KH %Lৼ ZDV VXSSRVHG WR JUDGXDWH DQG WKH PDWK
WHDFKHUÀXQNHGKLP«'LG\RXWHOOKLPQRWWRJRWRVXPPHUVFKRRO"
304 7ංආඈඍඁඒ'ൺඅඒ
HAPPY: That’s why I can’t get married. There’s not a good woman in a
thousand. New York is loaded with them, kid!
$IHZPLQXWHVODWHUWKH0\VWHU\:RPDQVWDUWVODXJKLQJR൵VWDJH
MXVWEHIRUHDÀDVKEDFNHQFRXQWHUZLWK:LOO\LQWKHSULPHRIKLVVDOHV-
man days.
THE WOMAN, now urgently: Willy, are you going to answer the door!
The Woman’s call pulls Willy back. He starts right, befuddled.
.QRFNLQJLVKHDUGRৼOHIW7KH:RPDQHQWHUVODXJKLQJ:LOO\IROORZV
her. She is in a black slip; he is buttoning his shirt. Raw, sensuous
music accompanies their speech.
WILLY: Will you stop laughing? Will you stop?
THE WOMAN: Aren’t you going to answer the door? He’ll wake the
whole hotel.
WILLY: I’m not expecting anybody.
The knocking continues, forcing Willy to open the door. It’s his young
VRQ%L൵7KHP\WKRIWKHJRGOLNH)DWKHUKDVEHHQVKDWWHUHGLQÀDJUDQWH,
DQGWKHµ:KDWKDSSHQHGWR%L൵"¶WKUHDGLVUHVROYHG
I’ll be blunt here. I don’t believe in linear writing; but I do believe
strongly in what I’ll call multi-linear writing. Five minutes’ analysis of
Death of a Salesman would provide ample evidence that it’s the symphonic
weaving together of between 30-35 narrative threads that makes for its
undisputed dramatic power.
You don’t have to write (or wish to write) like Arthur Miller to ac-
knowledge the usefulness of multi-linear writing. I’ve detected this tech-
21st Century Playwriting 305
nique in playwrights as diverse as Ionesco, Mamet, Tennessee Williams,
Beckett, Ibsen and others. If anything, its compositional antecedents lie in
Bach, Beethoven and Wagner and the German musical aesthetic of organic
through-composition using motifs that both unify and transform the work.
To put this less exaltedly, you can create rich lines of multi-linear
development from any of the following:
For each of these threads you can use the story shape of Chapter 8,
and ask yourself such questions as:
The Plot Snake and Multi-Linear Writing are useful tools in the
creation of plot. The following technique, Fragment (or Moment) Writ-
ing, was devised by me during a period when I was looking for a way of
building a play with little outer plot but much ‘movement of character’.
I came up with the following method.
A word of warning: While what follows is an attempt to bring a rich
character into being, it is highly unlikely that you will need all of these!
Regard them as ‘prompts’ to your creative sketches. Some (or many) of the
following will be perfect for some of your characters. The rest you should
forget about, at least for that play or character. In other words, if one of
the many suggestions below doesn’t almost immediately give you a good
line or a strong creative impulse, then move on to the next suggestion.
So let’s start...
The sketches you can create from this method are mainly focussed
in three areas of character life. They are—
I. WILL, INTENTION
6. Give her a moment of confusion about the ethical rightness of her goal.
11. Give her a moment of fear that she will never achieve her goal.
12. Give her a moment of renewed purpose and energy in the pursuit
of her goal.
14. Give her a moment of realism about her goal, or let another character
try to do this.
15. Give her a moment of stubbornness and dogged pursuit of her goal.
16. Give her a moment of awareness of the costs (to herself and others)
of the pursuit of this goal.
17. Give her a moment of mixed feelings on the achievement of the goal.
19. Give her a moment of panic that the goal has escaped her.
20. Give her a moment of deadness on achieving the goal. (“It doesn’t
matter anyway.”)
40. *LYHKHUDPRPHQWRIVHOIVDFUL¿FH
41. *LYHKHUDPRPHQWRIEHLQJVHOIVDWLV¿HG
43. *LYHKHUDPRPHQWRIVHO¿VKQHVV
48. Give her a moment of intense love for the other character.
49. Give her a moment of passionate desire for the other character.
54. Give her a moment of being impatient toward the other character.
55. Give her a moment of being patient toward the other character.
56. Give her a moment of falling in love with the other character.
57. Give her a moment of enjoying the company of the other character.
62. *LYHKHUDPRPHQWRIÀLUWDWLRXVVH[LQHVVZLWKWKHRWKHUFKDUDFWHU
63. Give her a moment of idealistic intensity with the other character.
65. Give her a moment of shared pain with the other character.
66. Give her a moment of shared loneliness with the other character.
67. Give her a moment of shared pleasure with the other character.
68. Give her a moment of shared frustration with the other character.
312 7ංආඈඍඁඒ'ൺඅඒ
69. Give her a moment of shared excitement with the other character.
70. Give her a moment of shared strategic excitement (eg, as they plan
something together).
71. Give her a moment of laughter, joy with the other character.
73. Give her a moment of fun, happiness with the other character.
76. Give her a moment where she lies to the other character.
77. Give her a moment where she tells the painful truth (about herself)
to another character.
78. Give her a moment where she tells a few ‘home truths’ to another
character (which are painful to that other character.)
82. Give her a moment of emotionally striking a chord with the other
character.
86. Give her a moment of recognition of a deep truth about the other
character (that is, a turning point moment, which imperils their
relationship.)
21st Century Playwriting 313
87. Give her a moment of recognition of how appalling the other character
LV7KLVFRXOGZHOOSURYLGHDGL൵HUHQWW\SHRIWXUQLQJSRLQWPRPHQW
ZKLFKPLJKWGH¿QLWLYHO\SDUWWKHP
A… Start
6RPHQDUUDWLYHGLVWXUEDQFHRFFXUVWKHZRUOGLVWKUHDWHQHG7KH¿F-
tionalised world might have been threatened from the start, as with Hamlet;
or it may take some time before it ‘gets dangerous’. It depends on the
story and the type of play it is. It’s one reason why B is a moveable feast.
7KH)LUVW0DMRU$FWLRQLVXVXDOO\TXDOL¿HG³,W¶VQRWDVVLPSOHDV
that”), reversed (“We’re going in the wrong direction!”), or brought to ful-
¿OPHQWRQO\WREHUHYHDOHGDVLQVX൶FLHQWWRFXUHWKHLQLWLDO'LVWXUEDQFH
Thus, there is usually a change of direction in some way (plot, a character’s
goal, a character’s fortunes etc). But the audience is experiencing a rapid
increase in tension (as they watch the characters going through hell.) The
tension grows to the point of being unbearable (we hope); something has
to give. It does. A dam bursts (but not till the next scene).
The last scene before Interval from the author’s point-of-view, in-
volves orchestrating the plot so that a clear Turning Point and/or Climax
is achieved. But from the audience’s point-of-view, it is a release of the
XQEHDUDEOH WHQVLRQ WKDW WKHLU LGHQWL¿FDWLRQ ZLWK WKH SOD\¶V SORW DQG LWV
characters has produced. The longed-for release from the ‘enjoyable dis-
comfort’ that an audience feels at this point in the play, is both a blessing
and a curse: “Thank heavens, that Hamlet has found out the truth about
his father; but, look what he’s now got to do!”
In other words, the last scene before Interval both culminates and
H[WHQGV,WFXOPLQDWHVWKHOLQHRIDFWLRQIRUH[DPSOHµWR¿QGRXWWKHWUXWK
about X’) but now that the truth is learned, it sets up a terrible duty to follow
through. (“Now that you know about X, what are you going to do about it?”)
This type of scene used to be called the “Obligatory Scene”, either because
316 7ංආඈඍඁඒ'ൺඅඒ
F… Interval
'HVSLWHWKHRIWHQSHULORXVVWDWHRIWKHDWUH¿QDQFHVDSOD\¶V,QWHUYDO
does not exist simply for the bar-takings. (Although when I started work-
ing in theatre, one theatre I worked at refused to produce plays without
intervals, so desperate were they for the beer and wine sales!)
Above all, an Interval has a structural function. You can do lots of
good narrative and structural things with an Interval. For example, you can:
b) 0DNHDKLJKO\VLJQL¿FDQWFKDQJHRIORFDWLRQ,¶OOQHYHUIRUJHW
the breath of fresh air (literally) that was produced in Willy
Russell’s Shirley Valentine when in Act II he took the audience
out of that dingy English kitchen straight to a Greek island.
5HJDUGOHVVRIZKDW\RXFKRRVH\RX¶YHJRWDERXW¿YHPLQXWHVEHIRUH
the most dangerous time in the whole evening starts…
6RPHWLPHEHWZHHQ¿YHDQGWHQPLQXWHVDIWHU$FW,,VWDUWVDFKDQJH
begins to take place in the audience. They have settled into their seats,
have had the moderately interesting Act II start, and any hopes (or fears)
RIDEHWWHU$FW,,DUHEHJLQQLQJWREHFRQ¿UPHGDWSUHFLVHO\WKHWLPHZKHQ
WKHDOFRKROLVVWDUWLQJWRNLFNLQDQGWKHLUFRQFHQWUDWLRQLVVWDUWLQJWRÀDJ
It’s at this point that many plays fail. Why is this so? Answer: Be-
cause a play is a narrative machine, with an invisible framework that is
designed to run through space and time, using long connective lines that
pull individual scenes together with an unstoppable momentum.
I’ve indicated these ‘connective lines’ in the diagram on page 314.
I’ve called them “1st Wave”, “2nd Wave” etc.
A ‘wave’ is not necessarily the plot: it is usually the result of plot. It
318 7ංආඈඍඁඒ'ൺඅඒ
is the movement toward meaning (and its resultant release of tension.) The
wave is usually a product of many individual thread-lines of development
(involving character, relationship growth etc) but all the individual threads
tend to be pulled in the direction of this forward-movement. To put it as
simply as I can (while still being helpful), the wave is usually made up
of a combination of the following:
If the 1st wave moves toward positivity (for example, happi-
ness, success, wealth, goal-attainment etc), then negativity
kicks in with the 2nd wave. (For Macbeth, his 1st wave, despite
the qualms, is mostly positive: he’s got the kingship; but for
him, the 2nd wave is ‘the beginning of the end’, as he (and Lady
Macbeth) see the kingship ebb away from them.
The reverse also applies: if the 1st wave was negative, the 2nd is
mostly positive.
No wave is unambiguous, even for the obsessed characters who
21st Century Playwriting 319
drive the action. Macbeth is aware of his evil even as he does
LWDQGKHPD\UHJUHWDQG¿JKWYLFLRXVO\WKHLQHYLWDEOHRQVHW
of the 2nd Wave, but for most of the other characters, and the
DXGLHQFHZLWKTXDOL¿FDWLRQVWKHnd wave is a ‘good thing’,
and much longed-for.
As can be seen from these observations, the principal relation-
ship between the 1st wave and the 2nd is one of reversal. When
trapped in the deadly Forest of the First Draft, think simply: “If
1st wave Good, then 2nd wave, Bad.” You can nuance it all later!
J… Climax Scene
,W¶VDWWKHFOLPD[WKDWWKHRXWFRPHLV¿QDOO\GHFLGHG7KHSOD\ZULJKW
Marsha Norman, in a letter to fellow playwrights, once stated, that “a play
is about a character who wants something, and the climax is where he or
she gets it or not. And that’s how the audience knows when to go home.”
That statement is a bit dogmatic and doesn’t always apply, but often it
does, and it’s mostly a very wise insight. A goal is decided once and for
DOO2UDZLVKLVJUDQWHGRQO\IRUKLPWR¿QGWKDWLW¶VQRWWKHKHDYHQKH
hoped for: it’s actually a living hell.
But this discovery is usually held over until the next moment…
&ඁൺඉඍൾඋ
DRAMATIC STRUCTURE (IV): UNIVERSALISMS, DRAMATIC
TONE AND FINDING THE TRUTH OF YOUR PLAY—AND ITS
ENDING
The plays of mine that have ‘worked’ with an audience, and the plays
of others that I’ve seen hit the mark, seem to belong to one of two basic
‘tonal patterns’, that is, where the story, characterization and language
work to create one of the following tonal patterns.
324 7ංආඈඍඁඒ'ൺඅඒ
I know what you’re thinking now as you read this: “Not only do
I have to create this elusive thing called ‘tone’. I now have to create a
tonal pattern!” I never said play writing was easy, but fortunately you
don’t have to ‘choose a pattern’. The logic and truth of the story tends to
choose the pattern for you.
The above diagram shows how a play might start at a low ebb (of
morals, luck, fortune, material prosperity, happiness etc). For the charac-
ters, this is a ‘bad’ situation. Some struggle occurs, and, despite setbacks,
a relative victory is arrived at by the end of Act I. The victory might be
one (or several) of numerous things: wealth, position, status, love (“He’s
won the love of his life.”) What’s interesting about this position is that it’s
unstable. It’s not only going to be contested (during Act II) but by its very
QDWXUHWKHUH¶VXVXDOO\DÀDZDZHDNQHVVLQWKHYLFWRU\$QGWKHDXGLHQFH
often knows this even better than the character(s).
Incidentally, it’s a good feeling for an audience to go out to interval
on this ‘high’. Even if the victory is to be short-lived, it makes for a nice
IHHOLQJLQWKHDXGLHQFHDVWKH\KHDGIRUWKHFR൵HHEDU:KHQWKHDXGL-
ence returns for Act II, there’s often an inevitable ‘honeymoon’ period,
where the elation of the pre-interval phase is maintained. But it isn’t long
before something goes wrong, and the rot starts to set in. In other words,
we’re back in the Bad state that started the play. (Or things might even
be worse than at the start.)
From here, you have a choice: you can tell the audience that “life
is bleak”, and let things slide and slide to the point of no-return. Or, you
FDQ KDYH WKH FKDUDFWHUV VWUXJJOH IRU WKH ¿QDO YLFWRU\ KRZHYHU SDUWLDO
weakening and ironic. It’s up to you—or rather, it’s up to the story and
what it demands.
The other pattern is even darker:
21st Century Playwriting 325
What Pattern 2 shows is a story where, at the start of the play, things are
VDWLVIDFWRU\RUHYHQJRRG/LIHLV¿QHHYHU\RQH¶VKDSS\PRUHRUOHVVHQRXJK
money to go round etc.) Alternately, things might be really bad. (The town
is in a slump; the marriage is dreadful; he’s been unemployed for months.)
Regardless of your point of departure, things very soon get worse.
'HVSLWHWKHFKDUDFWHUV¶EHVWH൵RUWVE\WKHHQGRI$FW,WKHWRZQPDU-
riage/company is in a huge mess. When the audience returns for Act II,
they watch a titanic struggle to recover something or return to the Good.
Where it goes after that is, again, up to you. Things can sink back into
oblivion, or they can reach a plane of relative peace and even well-being.
Once again, it’s up to you and what you feel the story demands.
Can you actually write in accordance with the several patterns shown
and discussed in this chapter? The answer is complex. You write from
instinctual impulses, but I strongly believe that the instinct can be trained.
No one is born a playwright: you become one. And since I also believe
that a play is more than a spewing out of words and scenes in any order
that your feverish brain commands, it follows that there’ll be times when
you have to become very conscious in your play-making. How do you
write freely without self-censoring and inhibition, and yet be aware of such
dynamic patterns as outlined in this chapter? Simple (if that’s the word):
You write at white-heat, but then edit and re-shape with the coolness of
several cucumbers. It’s at this point that the above diagrams and ‘rules
of thumb’ might be helpful. It might only need the application of one of
these patterns for the play to fall into its true shape.
$XGLHQFHVRIWHQOHDYHDQLJKWDWWKHWKHDWUHKDOIVDWLV¿HG7KHSOD\
was competent. The story was interesting. The acting was quite good.
But “something was missing”, they will think to themselves as they
326 7ංආඈඍඁඒ'ൺඅඒ
FKHHUWKHPVHOYHVXSZLWKFR൵HHRUDODWHVXSSHU,QP\\HDUVRIZDWFKLQJ
semi-successful theatre I’ve come to the view that the element most often
missing-in-action is that of the Universalism.
,GH¿QHDµ8QLYHUVDOLVP¶DVDVWDWHRIKXPDQH[SHULHQFHWKDWDOOSHRSOH
regardless of life-style or nationality, can understand and respond to, either
because they have already lived through it, or because one day it could
happen to them. We’ve all been in love. We’ve all hoped and yearned for
some desired ‘thing’ to happen in our lives. We’ve all lived in fear. We’ve
all experienced a wide range of sorrows and joys.
Some of us have been robbed, burgled or attacked in the street. The
rest of us can imagine what that’s like—and we don’t want it to happen
to us. A Universalism can be something that you want to happen in your
life; and it can be something you would dread to happen in your life.
Illusory/temporary escape
Revenge
Loss
Betrayal
Greed/desire
Delusionary Joy
Pride/ambition
6XৼHULQJSDVVLRQ
Hatred
Love
Grief
Forgiveness/compassion
Wisdom (real/ironic)
Maturation
21st Century Playwriting 327
Understanding
Peace & acceptance
6DFUL¿FH 5HQXQFLDWLRQ
The discovery of purpose & meaning
that which follows something as some other thing follows it.” A more use-
less piece of dramatic advice can scarcely be imagined. Many analysts and
commentators have puzzled over exactly what Aristotle was getting at. My
initial reaction was that it was a rather silly, even meaningless ‘attempt at
DGH¿QLWLRQ¶WKDWDOOQRQSUDFWLVLQJWKHRULVWVDUHGUDZQWR$GPLWWHGO\WKH
greatest value of the Poetics comes from Aristotle’s description of important
narrative elements like Reversal and Recognition. Lately, however, I’ve
ZRQGHUHGLI$ULVWRWOHZDVQ¶WDWWHPSWLQJWRGH¿QHDQLQWXLWLRQWKDWWKHUH
is a level beneath stories—a level that I now describe as a Universalism.
6WRULHVGRQRWH[LVWLQDYDFXXP7KH\XVXDOO\H[LVWLQDVSHFL¿FSODFH
and time. Flaubert said that “All great Art is provincial”, referring to the
WHQGHQF\RIDUWWR¿QGSRZHUIXOV\PEROLFYDOXHLQIRFXVVLQJRQVSHFL¿F
people or groups living in a particular place and time. But a hard truth must
now be told. Much American drama is boring and unsuccessful because
it only focuses on place and time. In other words, without the symbolic
power of a Universalism, a story may end up being, not provincial but
parochial. That is, the story and the world of the play has no meaning un-
less we, the audience, also happen to live in that same town or city. I’ve
seen many plays, especially the unproduced ‘plays-in-development’ which,
like the Flying Dutchman, travel endlessly from one theatre Conference
to another, never really improving because the play never achieves the
sort of symbolic power that a Universalism gives to a play.
When you write a play which has at its center the dominant relation-
ship between, say, a mother and her only son, you are writing a group or
family based Universalism. The audience understands that some truths
and insights about this relationship will be a part of the play’s ideas and
meanings. If it is not, then you may have missed a good opportunity to
remind your audience of some important truths. It’s important to remem-
21st Century Playwriting 329
ber that simply having a Mother/Son relationship in your play doesn’t
of itself guarantee any deep connection with an audience. You have to
actually do something with that relationship. For example, imagine that
there is a complex love-hate relationship between the Son and his Mother.
Imagine, that they are rivals in some weird way, and that each delights
in undermining the other. In other words, you need to emotionalise this
universal relationship, or give it a particular psychological twist. In that
way you create a story where the audience is allowed to ‘meditate’ on the
complexities of mothers and their sons. In this way, your story has the
potential to make a strong connection with every member of your audience.
7KHIDWKHU¿JXUH
7KHPRWKHU¿JXUH
The almost-a-brother
The almost-a-sister
3HUVRQDOO\,¿QGWKHSVHXGRIDPLO\PRUHGUDPDWLFDOO\LQWHUHVWLQJWKDQ
a real family. This is not to imply that a real family can’t be dramatized
successfully; if that was the case, then King Lear would be a failure. But
the power of the pseudo-father or mother shouldn’t be forgotten. Think of
WKH¿OPWall Street. *RUGRQ*HNNRDIDWKHU¿JXUHWRWKHQDLYHSURWDJR-
QLVWLVRQHRIWKDW¿OP¶VEHVWFKDUDFWHUV<RXGRQ¶WKDYHWRDFWXDOO\EH
someone’s father to play that role—for good or ill. In fact, a woman who
is ‘like a sister’ to another character raises many interesting psychological
questions which you can explore in your play.
TABLE 6
THE UNNATURAL ORDER - CHILDHOOD
PHYSICAL MENTAL THE SOCIAL &
DEVELOPMENT DEVELOPMENT PSYCHOLOGICAL
RESULT
Body of a child Mind of an adoles- A manipulated neurotic child
cent
Body of a child Mind of an adult A Precocious child, old
before her time; perhaps
DUWL¿FLDOO\PDWXUHGDQG
resenting it.
What Table 6 shows is just two possibilities (there are more) that
might make for interesting characterization. The principle should be
clear: simply put the wrong mind in the right body (or vice versa). Give
a character a younger or older mind, temperament and psychology than
she would normally have.
Here are some possibilities for characterization of adolescence and
early adulthood.
332 7ංආඈඍඁඒ'ൺඅඒ
TABLE 7
THE UNNATURAL ORDER -
ADOLESCENCE & EARLY ADULTHOOD
PHYSICAL MENTAL THE SOCIAL &
DEVELOPMENT DEVELOPMENT PSYCHOLOGICAL
RESULT
Body of an adolescent Mind of a child The Hermit, Isolate
Body of an adolescent Mind of a child The Nerd, Greek
Body of an adolescent Mind of a child The Abused Child
Body of a young Mind of a child A Mommy's Boy
adult (male)
Body of a young Mind of a child A Daddy's Girl
adult (female)
Body of a young adult Mind of a child An Idiot Savant
Body of a young adult Mind of an adolescent A Puer Figure/Eternal Boy
Body of a young adult Mind of an adolescent A 'Young fogey'
:KDW7DEOHR൵HUV\RXDUHQRWMXVWµIUHDNLVKSV\FKRORJLFDOW\SHV¶
(such as the idiot savant, a description often criticised and replaced by
such clinical terms as Asperger’s Syndrome.). For dramatic purposes, it’s
probably better to bury the freakish inside the normal. What this means is,
if a character is labelled as having a clear psychological or medical condi-
tion, it makes the audience withdraw from that character. That character
is no longer ‘one of the audience’. The audience response tends to move
IURPHPSDWK\WRV\PSDWK\²WKHODWWHUDOHVVH൵HFWLYHWRROWRPDQLSXODWH
an audience’s response. When an audience can only feel pity (probably
IROORZHGE\LQGL൵HUHQFHRUHYHQGLVJXVWWKHOLNHOLKRRGRIWKHPRSWLQJ
out of imaginative engagement with your play is increased.
Here are some patterns of dramatically-interesting behavior in mature
adulthood.
TABLE 8
THE UNNATURAL ORDER: MATURE ADULTHOOD
PHYSICAL MENTAL THE DRAMATICALLY
USEFUL RESULT
Body of an adult Mind of a child A comic child, perhaps
incapable of real
adult relationships.
21st Century Playwriting 333
The obvious should be stated: that these tables are guides only.
They are not comprehensive. Their real value perhaps lies in giving
you a clue as to how you can have another, interior level of character-
ization that belies predictability. In any case, a major idea of this book
is that all character and psychological traits must be supported and
demonstrated by language. 6R ¿QG D ODQJXDJH IRU HDFK FKDUDFWHU DQG
only then should you determine his/her psychology. As I’ve said else-
where in the book, language creates psychology; and not the reverse.
,W¶VZHOONQRZQDPRQJSOD\ZULJKWV²DVZHOODVRXUORQJVX൵HULQJ
DXGLHQFHV²WKDW¿QGLQJDZRQGHUIXOHQGLQJWRDSOD\LVRIWHQYHU\GL൶FXOW
It’s as if all the weaknesses and problems in our writing get saved up for
WKH¿QDOPRPHQWVRIRXUSOD\ZKHQLQMXVWDIHZVKDPEROLFPRPHQWVDOO
the play’s energies seem to evaporate and peter out. I’ve seen it happen to
my work. I’ve seen it happen to the work of many other writers.
The truth is, however, that a bad ending doesn’t happen all by itself.
It’s usually prepared long in advance, just as a good ending is. Knowing
ZKDWPDNHVIRUDZRQGHUIXOHQGLQJWR\RXUSOD\FDQPDNHDOOWKHGL൵HUHQFH
between a play that is produced—and a play that never sees the light of day.
Before I explain what actually does happen in the play, I’ll explain
what does not KDSSHQ,¿UVWVDZWKHSOD\ZLWKWKHODWH$ODQ%DWHVLQ
one of the greatest performances of his career. There is a record of his
SHUIRUPDQFHLQWKH¿OPRIWKHVDPHQDPHPRUHD¿OPRIWKHSOD\WKDQ
D¿OPLQLWVHOI:KHQ,VDZWKHSOD\,ZDVVWUXFNE\WKHULJKWQHVVRIWKH
ending, and how satisfying it was. It stayed with me for weeks afterward.
Analysing it later, I realised that there must have been many options and
possible endings confronting the writer when he came to the ending of
his play. I’ve listed them below.
In this possible ending, Butley would have begun to damage the new
pupil just as he had with his former, star pupil. Vampires always return
to their essential nature—and resume feeding on the life and soul of their
human victims. This is also exactly what happens in Ionesco’s play The
Lesson, which I discussed in Chapter 4. In that play also, a new pupil
arrives, and the audience has a strong belief that the Professor will do to
the new pupil exactly what he did to the old—i.e., he will destroy her just
like the previous pupil. That play’s ending was vampiric and Absurdist;
but the ending ‘worked’ because the whole play was Absurdist. For an
essentially realistic play like Butley to suddenly leap to the Absurd would
be to betray the trust the audience had placed in the reality and truth of
the author’s world that he had so painstakingly created.
This is the actual ending to the play. When toward the end of the
play, a new pupil arrives, and Butley is given the chance to repeat all
the errors and bad behavior he had shown to a former pupil. He starts a
familiar pattern (of bad behavior); but suddenly, he stops. Butley tells the
QHZSXSLOWR¿QGDQRWKHUWHDFKHU+H¶VQRWJRLQJWRPHVVXSWKLVWLPH$
simple description like this of the play’s ending does not really do justice
to its subtlety and nuance. You’ll have to read it or see it for yourself. I
hope the point is clear: Butley has no idea of his future—but the past is
¿QLVKHG,W¶VRYHU
Space prevents me from exploring some of the many complex issues
surrounding the joint working of a play’s Climax and Resolution—that’s
336 7ංආඈඍඁඒ'ൺඅඒ
for another book. For now, I’ll give a few ideas here about some of the prin-
ciples and techniques that could help to strengthen the ending of your play.
7KLVLVDGL൶FXOWSRLQWWRH[SODLQEXWLW¶VYLWDOWRXQGHUVWDQG7KH
point of a play’s ending is to place or return the play to a state of
transcendence, beyond the pettiness (or the anger, the pain) that
made up so much of the play. Think of the wonderful ending of
Wit, the Pulitzer Prize-winning play. To say that “she dies at the
end” is absurdly simplistic. It’s true that the protagonist of Wit
does indeed die at the end; but it is much more than a simple
death; it is a movement to transcendence, above the pain and pet-
tiness of human life. The audience, despite being in the presence
RIGHDWKJORZVZLWKZDUPWKDWWKHIHHOLQJRIDULFKIXO¿OOHGOLIH
7KH(QGLQJLQYROYHV5HYHUVDO&RQ¿UPDWLRQDQG3DUDGR[LQVRPHZD\
$V,H[SODLQHGLQ&KDSWHUDSOD\¶VFOLPD[DQGLWV¿QDOUHVR-
lution can work in tandem to qualify and nuance the multiple
meanings and impressions you want to leave with your audience.
See it like this: if she wins in the Climax of the play, she loses
VRPHWKLQJ LQ WKH ¿QDO 5HVROXWLRQ RU YLFH YHUVD %\ KDYLQJ
these working together, you create one of modernity’s gifts to
our culture: the condition of Paradox. When you have paradox
present in your play’s ending, it’s very likely to be a rich conclu-
sion, because paradox is so central to our Western, rationalist
way of thinking. We are less of a religious faith-based culture
(and certainly less so than a century ago). What has partially
UHSODFHGLW²DIDLWKLQUHDVRQLVE\GH¿QLWLRQSDUDGR[LFDO6R
¿QGLQJWKHLURQLHVLQFRQJUXLWLHVDQGSDUDGR[HVLQHYHQWKHPRVW
WULXPSKDQWD൶UPLQJHQGLQJZLOOKHOS\RXUDXGLHQFHWRDFFHSW
the truth of your play. And they will accept this truth because it
LVQRWDVLPSOHWUXWKLWLVTXDOL¿HGDQGQXDQFHGE\WKHSDUDGR[L-
cal presence of other meanings and counter-motifs. Every rich
ending I can think of has a paradox at its core: Linda loses her
husband Willy Loman, but her last words are almost a song of
freedom, not least for Willy. Blanche is heading to an asylum,
but the sense of kindness and sorrow, release and transcendence
at her exit is astonishing—and paradoxical.
7KH(QGLQJLVWKHODVWVHFWLRQWREHµ¿[HG¶
feel better to know this, but at least you’ve been warned. And by
then in the rehearsal period, you’ll have a lot of help in getting
the ending right. If anything I’ve said in this chapter helps, I’ll
be pleased. I’ll have a lot more to say on the realities of theatre
production in later chapters. For now, it’s time to take a trip in a
red phone box—into the Future.
339
&ඁൺඉඍൾඋ
DRAMATIC STRUCTURE (V): NEW FORMAL POSSIBILITES FOR
THE 21ST CENTURY
Concept 1: NON-LOCALITY
,W¶VZHOONQRZQWKDWWKHEDVLVRIRXUVFLHQWL¿FNQRZOHGJHKDVPRYHG
from Newtonian physics to quantum physics. In the world that Isaac
Newton imagined, the world operated according to rational rules of cause
DQGH൵HFW$FDXVHV%ZKLFKLVZK\&ZLOOKDSSHQ
Paul Pearsall, in his book, Making Miracles (Prentice-Hall, NY,
1991), examines quantum science for its new principles. For Pearsall,
non-locality is the central assumption of quantum mechanics, a branch
RIWKHQHZSK\VLFV,WKROGVWKDWSHRSOHDQGWKLQJVFDQEHD൵HFWHGE\
HYHQWVRXWVLGHRIDVSHFL¿FWLPHDQGSODFH)RUH[DPSOHDPDQLQRQH
URRPPD\EHD൵HFWHGE\WKHDFWLRQVRIDZRPDQLQWKHQH[WEXLOGLQJ$
340 7ංආඈඍඁඒ'ൺඅඒ
EXWWHUÀ\PLJKWVKDNHLWVZLQJVLQWKH$PD]RQDQGEHIRUHORQJWKHUH¶VD
tsunami hitting the east coast of Japan. Events can interact strangely on
each other without needing to be in the same place and time-zone. There
is a strange unity to the world, and that unity is not created by cause and
H൵HFW,W¶VMXVWµWKHUH¶LQP\VWHULRXVDQGXQSUHGLFWDEOHZD\V
7KDW¶VQLFH\RXWKLQNEXWKRZGRHVLWD൵HFWP\ZULWLQJ",FDQWKLQN
of two possible ways:
Concept 3: SIMULTANEITY
2QH FKDUDFWHU WDONLQJ DW D GL൵HUHQW VSHHG WR DQRWKHU DQG \HW
both making very clear sense.
'L൵HUHQW VFHQHV SOD\LQJ DW GL൵HUHQW WHPSRV 0RGHUQLVWV OLNH
Shakespeare do this already, but I can imagine a theatrical aes-
WKHWLFZKHUHWKHLQYHVWLJDWLRQRIFOHDUO\GL൵HUHQWLDWHGWKHDWULFDO
tempos or speeds are part of the play’s structure.
Scenes which challenge the notion that ‘time always marches
forward’. If science no longer accepts this, why should drama-
tists? Imagine a theatrical scene (or whole play) which started
R൵LQµQRUPDOWLPH¶WKHQDWLWVKDOIZD\SRLQWVWRSSHGDQGSUR-
ceeded to go backwards. Shocking? No. Just challenging. But
not impossible. Such a thing was, in fact, done by Alban Berg
in his 1914-1922 opera, Wozzeck in the orchestral interlude of
Act Two. It goes forward, then, at the half-way point the music
goes backward to its starting point! Theatrical modernism has
a lot of catching up to do, compared to its musical counterpart.
Beginners in play writing are often advised, “Don’t tell us; show us!”
What the advisers mean is that generally, it’s better to dramatically show or
demonstrate (in dramatic action) an event/emotion/fact than simply ‘talk-
ing about it’. (And we’ve all slept through plays where all the characters
do is talk about their feelings and what they’d like to do.)
The truth is, however, this ‘rule’ is often misleading and wrong. For ex-
ample, a one-person show lives by the very opposite of that rule: “Don’t show,
tell.” The one-(wo)man play relies on an intimate ‘confessional relationship’
ZLWKWKHDXGLHQFHLQH൵HFWWKHDXGLHQFHEHFRPHVWKHVHFRQGFKDUDFWHUWRZKRP
secrets must be told. In addition, as no other character will enter, there does not
exist much chance for the dramatic acting out of facts and other plot information.
It’s not just in single-cast plays that the concept of ‘telling an audience’ is
vital. David Bordwell, in his book, Narration in the Fiction Film (University
of Wisconsin Press, 1985) compares two ways of communicating with an au-
dience. Mimetic narration presents a spectacle: it represents a scene; it shows
something to the audience. But what he calls a diegetic style of narration is
much more direct: it speaks directly to the audience (often quite literally); it
tells them a story and gives them plot information without having to re-enact it.
At the risk of encouraging a rash of inept, expository-heavy and over-
explained theatre, I will venture to say that, in this super-conscious age, a
342 7ංආඈඍඁඒ'ൺඅඒ
new relationship can be found between the telling and the showing. Our
DJHLVWRRDZDUHRIWKHDUWL¿FHRIWKHDWUHDQGVWRU\WHOOLQJJHQHUDOO\WR
treat either as ‘real’. Theatre and stories are at their best when they are ar-
WL¿FLDO7KH\WKULYHDVFRQFHLWVDVPHWDSKRUVZKLFKVWDQGIRUUHDOLW\UDWKHU
than earnestly trying to be reality. To sound Wagnerian (a true modernist
in his time) the art-work of the future will have a shifting, unsettled and
unsettling relationship to the audience, requiring more of them, bringing
them in close to the action only to distance them again.
One of the principles of physics, old and new, is that energy, once
created, is never destroyed. It just goes somewhere else. But what about
theatrical energy? What happens to the spatial energy that is created
by a strong exchange between two pumped-up characters? Put simply,
the energy is maintained and increased by resistance. Character A says,
“Yes”; B says “NO!” Unstoppable force meets immoveable object. And
as the discussion in Chapter 7 on the spatial axis shows, the energy can
be sent in various directions, there to be received by an audience willing
to return the energy in the form of concentration. (Actors will tell you
that an attentive audience gives great energy to the performance space.)
But what is new about this? It applies equally well to traditional the-
atre. It is a question both of degree and kind. To truly represent the modern
world, chaos has to be built into your work in many ways: the chaos of
language (as a character struggles through the constrictions of language
to express a truth that is almost beyond words to express). The chaos of
character, where, instead of a character existing in a good/bad dualism,
he operates from a multiplicity of ‘selves’. (“Who are you tonight, Geof-
frey?”) The chaos of form, where no sooner is a plot issue settled than it
is subverted by new meanings.
To adopt this unsettling, restless aesthetic involves rejecting Platonic
LGHDOLVPWKDWLVZKHUHWKHUHDUH¿[HGVWDWHVVXFKDVµJRRGQHVV¶RUµWKH
ideal relationship’. In the writing of the future, even desired states such as
goodness will be simply waiting stations in a journey to another destina-
tion. The secret of chaos and its control lies in perpetual (self-)contradic-
tion.$FKDUDFWHUZLOOQRVRRQHUDUULYHDWKHUVHOIGH¿QLWLRQRIµWKHGHVLUHG
moral state’ than she is starting to qualify and contest it. If the stars and
the universe are in constant motion, why aren’t we? The fact is, we are.
It’s only dull theatre and soap-opera TV (with its need to reassure us of
the permanence of ‘universal values’) that tells us the opposite.
Does this mean that theatre must always be frantic and restless, like a
PHGLHYDOYLOODJHD൷LFWHGZLWK6W9LWXV¶'DQFH",W¶VWUXHWKDWHQHUJ\QHYHU
21st Century Playwriting 343
stops, but movement may. See it like this: a character who is completely
still is not without energy. The energy goes ‘down’ into some psychic
space within the character. The more profound the character, the deeper
WKHLQWHUQDOµSV\FKLFZHOO¶WKDWWKHFKDUDFWHUSHHUVLQWR,¿UVWGHYHORSHG
this idea while watching a performance of Beckett’s Endgame. It was as
if the characters were throwing (verbal) stones into the empty-but-endless
abyss of their own psyches, and waiting forever for the echo to come back
to them. Mostly it didn’t. There, in brief, is the modern condition.
pretentious notion (at least in its usual verbal formulations) has at its
heart a very 21st century concern: that the materials of an art form must
be explored every bit as much as the content those materials express.
What are the materials of theatre? The humanist outlook says that “Plays
are about people and the lives they lead”. Knowing people involves knowing
human psychology. That is useful, but as the book has tried to indicate, it’s
incomplete. Modernist aesthetics demand that we investigate other materials
equally vital to the creation of contemporary theatre: space, time and matter.
“Notes and coins totalling $272.60; two credit cards, six plastic
membership cards; a cheque book; a mobile phone (containing
an unknown number of stored phone numbers); a plastic card
holder with three bank cards; two doctors’ bills (for Medicare);
D)O\%X\VFDUGDUHVWDXUDQWPDWFKER[¿YHSD\VOLSVEXVL-
ness cards; a mini-spiral notepad; an ear piece for mobile phone
(still in sealed plastic bag); a glasses case containing one pair of
glasses; an address book; a hair brush; 30 owner’s business cards;
a newspaper clipping with address of antique shop; 10 pens; a free
breast-screening coupon; a prescription; a tax invoice statement; a
health brochure; a receipt for an Afghan war rug; two dry-cleaning
discount coupons; a family history society membership booklet.”
Listener, S.E. by E.; Narrator, N.W. by W.; on the 53rd parallel of latitude,
21st Century Playwriting 345
N. and 6th meridian of longitude, W.; at an angle of 45o to the terrestrial
equator.
In what posture?
Listener: reclined semi-laterally, left, left hand under head, right leg extend-
HGLQDVWUDLJKWOLQHDQGUHVWLQJRQOHIWOHJÀH[HGLQWKHDWWLWXGHRI*HD7HO-
OXVIXO¿OOHGUHFXPEHQWELWZLWKVHHG1DUUDWRUUHFOLQHGODWHUDOO\OHIWZLWK
ULJKWDQGOHIWOHJVÀH[HGWKHLQGH[¿QJHUDQGWKXPERIWKHULJKWKDQGUHVWLQJ
on the bridge of the nose, in the attitude depicted on a snapshot photograph
made by Percy Apjohn, the childman weary, the manchild in the womb.
Womb? Weary?
In this excerpt, the material, spatial and geographic world are trav-
elled, measured and delimited, right down to a photography shop in
'XEOLQ²DQG \HW WKH RYHUDOO H൵HFW LV VSDFLRXV DQG H[KLODUDWLQJ +HUH
LVWKHSDUDGR[RIFRQVFLRXVQHVVWRDFKLHYHLQ¿QLW\GH¿QHLWSUHFLVHO\
Name, in order to tame.
FRANZ: I’ve drawn up a plan for our married life. She’s right. I can be
anything I want: Writer, shopkeeper, insurance agent, factory man-
ager, husband, father, lover, human being. It simply needs organisa-
346 7ංආඈඍඁඒ'ൺඅඒ
tion. And lists… Tell me what you think: 6.05am, rise, exercise and
wash, with optional ten-minute period for Hebrew, violin or dancing
practise; 6.30, breakfast with Felice, plus conversation appropriate
IRUWKDWWLPHRIWKHPRUQLQJSUHSDUHR৽FHEULHIFDVHZLWKUHO-
HYDQWSDSHUVGRFXPHQWVDQGIUXLWIRUOXQFKOHDYHIRUR৽FH
&ඁൺඉඍൾඋ
DRAMATIC STRUCTURE (VI): A THEORY OF EVERYTHING
In this chapter, I’ll attempt the impossible. I’ll try and put all the
previous structural theories into an over-riding general theory, against
which you can examine your developing playwriting.
This theory is misnamed, of course. It can’t include absolutely ev-
erything. It won’t change your life, or help you to start your car in the
morning, but it may give your work two extra dimensions—ambition, and
comprehensiveness. The desire to say and be everything, in a single work,
or, to paraphrase Mahler’s words, “to put an entire world into every work.”
But this is not a cosmological statement. Principally, the theory that
follows is a statement of form. I have found it useful not just for multi-
linear structural analysis, but also when clarifying problems in less linear,
modernist texts.
/HWPH¿UVWVWDWHZKDWIRUPLVnot. It’s possible to parody multi-linear
structural principles like this: “Start with a central protagonist (main character).
That protagonist has a goal. To achieve this goal, the protagonist develops a
plan. In carrying out the plan, s/he meets obstacles, both inner and outer. A
FKDQJHRIGLUHFWLRQLVXVXDOO\LQYROYHGDVLVFRQÀLFWKLJKVWDNHVDQGZKHUH
appropriate, comic relief. After much struggle, the goal is achieved (or not),
and the protagonist has learned a great deal in the meantime.”
The problem with this linear theory is not that it’s untrue. Years ago
I remember desperately holding on to such truths in order to learn my
dramatic craft. The problem is that the description is incomplete, and ulti-
mately, external to drama. That is, it describes things not uniquely related
to drama and its relationship to an audience. The struggle described above
could also be said of many things in life: relationships, career paths, even
the search for a bank loan.
In expounding the following, I owe a debt to Francis Fergusson’s great
book on theatre, The Idea of a TheaterZKLFK¿UVWLQWURGXFHGPHWRWKH
concept of theatre as ritual. In this book, Fergusson wrote about Greek
drama and its merging of theatre and religion, resulting in the ritualising
RIWKUHHVSHFL¿FFKDUDFWHULVWLFVRIWKHFHQWUDOSURWDJRQLVW7KHVHDUH²
1. PURPOSE
2. PASSION
3. PERCEPTION.
348 7ංආඈඍඁඒ'ൺඅඒ
The central character has a driving purpose. In the carrying out of this
SXUSRVHJUHDWVX൵HULQJRFFXUVERWKRQWKHSDUWRIWKHFHQWUDOFKDUDFWHU
DQGWKRVHKHD൵HFWV$WWKHHQGRIWKLVVX൵HULQJJUHDWDQGGHHSLQVLJKW
LVDFKLHYHGZKLFKFDVWVOLJKWQRWMXVWRQWKHVSHFL¿FSUHGLFDPHQWRIWKH
individual ‘who caused all the trouble’, but on the place of humankind in
the world, in the universe. Form meets character to create a cosmology.
(Hollywood—and much theatre— used to treat cosmology as a given; but
both, fortunately, are changing)
8VLQJ)HUJXVVRQ¶VPRGHODVDEDVLV,R൵HUWKHIROORZLQJIRXUSDUW
formal theory. My four phases rely on the unfolding or revealing of four
states of being. This ‘being-ness’ relates not to personal psychology but
to the state of the world that the characters live in.
1. THE ORDINARY
2. THE EXTRAORDINARY
3. THE ASTONISHING
4. THE TRANSCENDENT.
,Q WKLV ¿UVW SKDVH WKH FKDUDFWHU DQG KHU ZRUOG DUH LQ D VWDWH RI
some ‘equivalence to reality’. That is, life is fairly normal. The world
of the play is fairly close to the world the audience has come from
before sitting down to watch the play. Characters may not be mirror
images of either the audience and our society, but there is a degree of
correspondence. Where there is little or no correspondence— eg, in
plays set on Mars, or set on an enchanted island, like The Tempest, the
playwright is simply upping the ante, putting more pressure on his pen
to treat the abnormal as normal. The next three phases still apply. In
other cases, like Molière’s great comedies, the Ordinary has already
been disrupted for some time by the Extraordinary. (eg, even before
WKHSOD\VWDUWV7DUWX൵HKDVEHHQGHVWDELOLVLQJWKHKRXVHKROGIRUVRPH
time with his religious dictates.)
21st Century Playwriting 349
LEVEL 2. THE EXTRAORDINARY
Very soon (or much later, in a bad play) the ordinary world is dis-
rupted. The world is hijacked by an event, a character, or a situation. The
H൵HFWLVVRPHWLPHVLPPHGLDWHDQGGHHSDQGDWRWKHUWLPHVLWJURZVDQG
seeps into the root structure of the play like poison. In Ibsen, characters
return from other countries, or the past, to disturb the unstable-but-bearable
bourgeois life of the characters. In Shakespeare, an Iago works his poison
PHWKRGLFDOO\DQGH൵HFWLYHO\2UDQHPRWLRQOLNHDPELWLRQVWDUWVWRZRUN
its dark magic on a good man like Macbeth. In Wagner (a dramatist who
should be studied by playwrights) Tristan and Isolde decide to die, but
instead, they drink a love potion which instantly, ecstatically, reveals to
them (and the audience) the tired mirage known as ‘the real world.’
One simple precept tests whether or not your play has moved into
this second stage of the Extraordinary: ie, that after the initial disturbance
(of a character, incident etc) then nothing will be the same again. Things
have drastically changed, even if they seem to remain the same in the eyes
of some of the characters. If things are not deeply altered, or if they do
proceed as before, except with ‘a bit more tension’, then it is highly likely
that your play has not reached this second level of being.
I have sat and even slept through many theatrical evenings where play-
ZULJKWVKDYHEHHQFRPSODFHQWO\VDWLV¿HGZLWKWKHLUGUDPDWLFWHFKQLTXH
350 7ංආඈඍඁඒ'ൺඅඒ
and accordingly, for the rest of the evening, have kept their plays on the
previous level, that of the Extraordinary. But the great dramatists are not
VRHDVLO\VDWLV¿HG+DYLQJUHDFKHGDOHYHORIVLJQL¿FDQFHDQGWHQVLRQ
danger and emotional intensity) with the Extraordinary, they proceed to
amaze both characters and audience with a series of incidents, events or
developments that take the play to an even higher level.
At this amazing level, high comedy, grotesquery and tragedy often mix in
a dazzling display of drama. As the climactic battle approaches, Richard III is
becoming more and more grotesque; the mad comedy of Mark Antony trying
to kill himself; events whirl around the head of Karsten Bernick, the central
character (and villain) of Ibsen’s Pillars of Society, occurring at a dazzling
and near-comic speed; while in Equus the savage ritualism and psychological
pain of the boy’s revelations are nearing the peak of their intensity.
It’s my belief that Shakespeare extends this third level as long as
possible, in the process slightly shortening the fourth, as well as also
delivering the fourth transcendent level in a few choice moments at
crucial points during the third. eg: Macbeth’s “tomorrow and tomor-
row” speech, or Horatio’s heart-breaking farewell to the dead Ham-
OHW²ERWK RI WKHP DUH SUH¿JXULQJ RI WKH SOD\V¶ GDUNO\ WUDQVFHQGHQW
and ritualistic endings.
This level is not just where the play’s summatory meanings occur, or
ZKHUHWKHUHODWLRQVKLSVUHDFKWKHLU¿QDOGHVWLQDWLRQEHLWFRQVXPPDWLRQ
or death. It’s a lot more than that. This level is where the play transcends
the materiality of its own origins, and rises above the grimy, bloody, sor-
did level that so much of the story was probably stuck in. At this point,
usually after the narrative climax, a new world is often announced (as in
many of Shakespeare’s plays), or the old is abjured (as in The Tempest),
or a more just and fairer state is promised (involving restoration of some
sort), or else, at the very least, awareness has been gained, at much cost. To
understand, to ‘know thyself’ is Oedipus’ reward for his mostly-admirable
H൵RUWV2FFDVLRQDOO\DYLVLRQRIKHOOLVWKHUHZDUGDVLQ,EVHQ¶VGhosts)
for the character’s strivings. It’s not just a matter of plot or the notion of
a character’s journey. To become more conscious is a constant goal in our
lives. To achieve it is to become supremely human.
7KDWWKHQLVP\YLHZRIGUDPDWLFIRUPDOEHLWYHU\EULHÀ\H[SUHVVHG
21st Century Playwriting 351
Where does it leave us writers? Let me be cruel for a moment, or
rather, let me be as cruel as an average audience, and ask this: How often
do we see anything like the above set of creative ambitions in American,
British or Australian theatre? The reasons are complex; to put it perhaps too
simply, I’d say that the basically rationalist, English-speaking cultures of
those three countries avoid metaphysics and transcendentalism. Or rather,
humanist theatre creates a transcendentalism-of-sorts in the sentimental
ending. And the modernist aesthetic often creates a grotesque, or Gothic
HQGLQJ1HLWKHULVVX൶FLHQW
Regardless of which aesthetic you come from, getting to this fourth
OHYHOLVGL൶FXOW3HUVRQDOO\,¶YHRQO\SXOOHGLWR൵LQDERXWKDOIRIWKH
dozen or so plays I’ve written. The failure rate is very high. Amazing work
LVDPD]LQJO\KDUG7KXVLIDQ\RIWKHIROORZLQJVSHFL¿FVXJJHVWLRQVKHOS
you in reducing your own failure rate, then I’ll be delighted.
3. Make the impact of disturbance (the bad news, the unexpected visi-
tor, the psychic shock, the sudden realisation) as large and deep as
possible. Let its implications grow like a shock wave, and make it
wreak havoc on young and old, innocent and guilty.
4. Push your characters to the limit. The British critic Kenneth Tynan
said that characters should be driven to desperation. Better that than
the middle-class chat-show which sometimes passes for character
development in our theatre.
5. Imbue the world of the characters with size, stature, and moral com-
plexity, so that when this world totters it’s also a shock (and a threat)
to the theatre audience watching it. A world full of idiots, or of social
stereotypes, or of ‘typical’ people with nothing to lose is not worth
dramatising—or watching.
6. Make one or more of the characters close enough to the audience’s own
view of itself so it can identify with these characters. This is not so the
audience can ‘like them’. It’s really to give the audience no easy option
RIEHLQJDEOHWRGLVPLVVWKHKRUUL¿FDQGODUJHIDWHRIWKHFKDUDFWHUVE\
being able to say “Thank goodness I’m nothing like them!”
352 7ංආඈඍඁඒ'ൺඅඒ
7. Methodically estimate every horrible thing (inner and outer) that can
happen to the characters... and then make it happen! That’s called
plotting.
8. Make the events of the play so fast that a type of Bergsonian comedy
emerges (ie, characters turned puppet-like, or machine-like by the
speed of events). As I indicated above, Shakespeare does this. The
irony is that characters are rarely so human as when their humanity
is turning grotesque and parodic.
&ඁൺඉඍൾඋ
UNDERSTANDING THE AUDIENCE (II): THE TWO LARGEST
AUDIENCES FOR THEATRE
I’ve already said elsewhere in the book that I’m not a behavioral
psychologist. The following observations are just that: observations, based
upon many years of studying audiences. Feel free to agree or disagree.
Here is my basic position.
As we grow and become socialised by the many experiences that
life and our society gives us, we absorb them and use them to form our
tentative views about the world.
/LIHEHIRUHLVH[FLWLQJSDUWO\EHFDXVHLW¶V¿OOHGZLWKH[SHULHQFHV
that are totally new to us. Our bodies change massively in our teens and
twenties. We are learning how to live, how to love, how to learn, how to
JHWDMRELQD¿HOGWKDWH[FLWHVXV,W¶VIXQH[FLWLQJDQGVFDU\
Fortunately, the nervous system of a young man or woman is amaz-
ingly strong, compared with older people. Younger people can undertake
the extraordinary ‘apprenticeships’ needed (in life, love, learning, work,
play, sex) to gain mastery in the ways of the world, and they can do this
because in most cases their nervous system is extremely strong. The nerve
endings in our bodies are more robust at this age. They are thicker and
stronger. All this has been medically proven. This means that not only can
the younger person take more sensory stimulation without damage—but
354 7ංආඈඍඁඒ'ൺඅඒ
they actually demand it! In other words, having a stronger nervous sys-
tem means that a younger audience wants a theatrical experience (true
with their music also) that pushes their nervous systems to the limit; and
because the limits of their nervous systems are higher, they accordingly
ZDQWPRUHLQWKHLUWKHDWUHWKHLU¿OPVDQGWKHLUPXVLF
After the age of 35, however, in most cases, we’ve gained some
mastery of life’s rules; we’ve partnered, and our career path, while
still insecure, is at least a little clearer, the on-going revolution in work
notwithstanding. This is not to imply that all problems are over, or even
solved. But gradually, over time, we become less addicted to the sensual,
social, physical and intellectual levels that so excited us in our optimistic
twenties, when so much was new, fresh and amazing—partly because
ZHKDGVLPSO\QHYHUH[SHULHQFHGLWEHIRUH0\¿UVWGR]HQWKHDWUHSOD\V
seen in my mid-twenties were an extraordinary experience for me, which
nothing has since recaptured. It was as if I were being shown a brave new
world, that had such characters in it.)
%XWKXQGUHGVRIH[SHULHQFHVSOD\V¿OPVERRNVDQGVWRULHVODWHU
our tastes start to change. While we still enjoy entertainment as much
as ever, we also start looking for a depth that once we might never have
GHPDQGHG:H¶YHVHHQVRPXFKLQOLIHDQGWKH¿FWLRQVWKDWPLUURULWWKDW
less astonishes us, because we’ve seen a lot of it before. It’s not that it
gets stale. It’s just that it now needs to be saying more than the obvious.
Talking of the obvious, I should state what I hope is also obvious
to you: that this watershed age of 35 I am discussing here is only ap-
proximate. It’s not as if every human being, at midnight on the eve of
their 35th ELUWKGD\ VXGGHQO\ ¿QGV KLPVHOI WUDQVIRUPHG LQWR VRPHWKLQJ
unrecognisable. Life is much more cunning and subtle than that. But by
WKHDJHRIRUVRZHKDYH,EHOLHYHEHFRPHVLJQL¿FDQWO\GL൵HUHQW
from the person we were during our twenties. Or perhaps we have added
OHYHOVWRRXUDOUHDG\FRPSOH[QDWXUH0\RZQYLHZLVWKDWHYHU\¿YHWR
seven years we add another thin layer of ‘self’ to our psyche. It does not
replace the previous levels—it adds to them. In any case, the layers are
QRWHYHQO\VWUDWL¿HG,W¶VPRUHOLNHWKRVHMDUVRIVDQGRUGL൵HUHQWFRORXUHG
beans you see in stores—all neatly arranged in horizontal levels. But then,
Life comes along, and shakes the jar up, and like a kaleidoscope, you see
bits from all the levels at once. From your childhood. From your twenties.
Pieces from everywhere, still on display for all the world to see.
7KLVKDVDQH൵HFWQRWMXVWRQRXUWDVWHVDVDXGLHQFHPHPEHUVLWDOVR
has implications for us as writers for those audiences. The older we get,
WKHPRUHOHYHOVWKDWKDYHWREHVDWLV¿HG
21st Century Playwriting 355
THEATRICAL TASTES OF THE TWO GENERATIONS
Theatrical Forms
Under 35: Younger audiences prefer their theatre to be short, sharp, furi-
ous and intense. Their tastes run from short, sitcom-like plays to very
demanding ninety-minute plays. I’ve seen young audiences sit riveted
by works about important themes as well as laugh themselves silly
at a crazy-slight comedy. But the crucial aspect to realise is that they
usually prefer it in one sitting, without an interval. They will socialise
after the show, rather than during it.
Over 35: Older audiences, on the other hand, having usually seen a lot
more theatre in their life-time, tend to grow out of a preference for
the bedlamic. They prefer a story that is coherent, nuanced, full of
rich interconnected levels of meaning. They have also grown beyond
an immature rejection of multi-linear narrative, because they have
learned that reality (which is the basis of realist narrative) has much
VWLOOWRR൵HUDQGLVE\QRPHDQVWKHGXOOWDPHWKLQJWKDW\RXQJHU
audiences sometimes see it as.
In the case of audiences over 35 years of age, they also like the
long one-act play which may run up to ninety minutes. But they are not
against an interval, especially if the work was written with an interval
in mind. Older audiences have no abiding interest in short work, not
least because the younger writers who tend to dominate this form also
tend to concentrate on the concerns of the young adult years (love, sex,
dating, romance, anxiety, self-esteem). The taste of under-35 audiences
regarding play styles and other formal aspects is surprisingly wide. They
like theatre that is short, disruptive and chaotic, hybrid in its selection
of theatrical techniques. Equally, they will also accept a very conserva-
tive play if it is dealing with very serious themes. (For more on that,
see below).
356 7ංආඈඍඁඒ'ൺඅඒ
Philosophy
Under 35: Few would claim that being young is easy. Even in times of
peace and plenty, the pains and strains of growing up in American
society are real. What young adolescents go through in a single
year (say, from ages 16-17) in physical, psychological and social
terms is more strenuous and demanding than a decade’s worth of
mid-life development. No wonder younger people’s mood swings
wildly. Mine did. One minute I was on top of the world. The next,
I felt I was in hell. This creates a preference for certain philosophi-
cal trends and fashions. Younger audiences like stories and plays
ZKLFKUHÀHFWWKH'LRQ\VLDQWKH5RPDQWLFWKH6XUUHDOWKH*RWKLF
and Brutalist. If anything, the philosophy of the young has darkened
in recent years and become more pessimistic. When I began writ-
ing in my late 20s, the dominant ‘young’ philosophy of the time
was Surrealism. In the new 21st century, the Gothic predominates,
making the earlier Surrealism seem almost innocent in comparison.
Over 35: Older, over-35 audiences are calmer, but often sadder and wiser.
7KHLUSKLORVRSK\ZKLOHJHQHUDOO\RSWLPLVWLFDQGOLIHD൶UPLQJLV
also very accepting of the role of the Tragic. Being statistically
closer to life’s end, they know that even good things come to an
end. A quite realistic story will move them, especially if, to quote
from the Alcoholics’ Anonymous prayer, it involves them having
the courage to accept what cannot be changed.
Aesthetic
Under 35: As I’ve indicated in the last paragraph, the under 35-audience
LVERWKPRUHHFVWDWLFDQGPRUHSHVVLPLVWLF7KLVLVUHÀHFWHGDOVR
in their aesthetic, which is closely tied to their preferred philoso-
phies. Thus, a Gothic philosophy (which accepts that life is/can be
a brutal, hellish, random and nasty business) creates an aesthetic
which allows those dark and brutal elements into the stories and
plays of this age group.
Over 35: But the calmness—even resignation—of older audiences cre-
ates an aesthetic which allows for more balance, and a more nuanced
and textured response to life and the stories which tell this audience
about what it is to be alive. Like all the aspects described here, this
is something you can either cater to—or subvert.
21st Century Playwriting 357
Under 35: People under 35 years of age haven’t lived that long. It’s
not their fault. It’s actually one of their great strengths. But it
PDNHVWKHPVHHSHRSOHGL൵HUHQWO\<RXQJHUSHRSOHWHQGWRVHHDOO
people from the outside. Understanding both people and the world
even less than older people (who may also be mistaken), younger
people see life as a type of circus, a freak-show and a wonderful
carnival of incidents. In other words, they are voyeurs—espe-
cially if they’re by nature introverted. Because in most cases they
haven’t progressed to the highest levels of society yet, they have
a particular interest in outsiders, in fringe dwellers, in marginal
characters. Their response to life is visceral, and that’s how they
like their drama.
Over 35: Older people have progressed further up (and down) the
many ladders that society puts in front of us. Because theatre
is an expensive art-form, its audience tends to be more affluent
than the norm. So plays which deal with affluence, power, status,
materialism have a particular resonance for older people, either
because they have achieved all this—or because they wanted to.
Being less interested in theatre effect, they prefer stories that
allow them to ‘be on stage’, and therefore prefer a vicarious
relationship to the characters in the drama (i.e. ‘That woman
on stage is me’).
Under 35: I’ll make a provocative statement: that younger audiences prefer
comedy to truth. What this means is that exaggeration, grotesquerie
and cynical/satirical impact have their own truth and power, and are
preferred to comic styles which are more sober and ‘fairer’ to all
sides of the question.
Over 35: With older audiences, however, comedy tends to be less impor-
WDQWWKDQWKHDWUHZKLFKR൵HUVGHSWKDQGDUDQJHRILQVLJKWVLQWRWKH
mysteries of human life. Where comedy is most enjoyed, it is either
because it is one of those very clear theatrical genres (for example,
farce) or because it is allied to a broader dramatic intention than
simply ‘being funny’.
Politics
It’s a broad truth that many people get more politically conservative
as they age. This is not innately a good thing in itself—any more
than the opposite tendency, which is for young people to be more
politically radical than their elders. I’ve yet to see a play written by
a young writer which was not on the political liberal/Left in some
way. It might be a near-anarchist hard left position, like Fatboy by
John Clancy, or it might be more on the soft left, socially progressive,
let’s-improve-the-system position. Being left-wing or liberal is so
common among playwrights that a British theatre director recently
asked, only half in jest, “Where are all the right-wing plays?” What
it means for us theatre writers is that we need to be aware of these
tendencies, even if only to subvert them. I’ll have more to say on
the political and social beliefs of our audiences in the next chapter.
Dramatic/Spatial tones
Under 35: It’s tempting to say that ‘all young people are modernists’.
But it’s not that simple, because what modernism ‘is’ changes every
decade. When I was falling in love with theatre in the 1980-1990’s,
the dominant and progressive theatre ideologies were Absurdism,
Surrealism and the Carnivalesque. Since at least 2000, the dominant
theatre aesthetic has been the Gothic, in any of its forms.
Over 35: It’s fair to say that the dominant and preferred theatre ideologies
of our current audiences at the start of the 21st century are Realism,
Naturalism and Humanism. Like it or not, that’s what the vast majority
of the successful plays for this generation are based on. As I’ve said
before, feel free to change or challenge this; but it helps if you know
ZKDW\RX¶UHGHDOLQJZLWK²RU¿JKWLQJDJDLQVW
362 7ංආඈඍඁඒ'ൺඅඒ
Preferred theatres
All theatres have ‘house styles’. A house style is created by the plays
that they tend to produce, based on a single style or a mixture of
aesthetics and commercial needs. Some theatres produce only one
type of play. Others produce a ‘balanced season’, full of variety in
WKHW\SHVRISOD\VWKH\R൵HUWKHLUDXGLHQFH6RPHWLPHVWKHWKHDWUH¶V
QHHGVFDQEHKLJKO\VSHFL¿F,ZDVRQFHFRQWDFWHGE\DWKHDWUHLQ
Florida, asking me if I had a play with a pro-family, Christian theme
IRUDFDVWRIWZRPDOHVDQGRQHIHPDOH7KDW¶VKRZVSHFL¿FDWKHDWUH
PLJKWJHWLQLWVWKLQNLQJ%HIRUH\RXR൵HUDSOD\WRDQ\WKHDWUH\RX
VKRXOG VWXG\ WKHLU ODVW ¿YH VHDVRQV WR VHH ZKDW VRUW RI SOD\V WKH\
produce. Do they cater for an older audience? Or a younger one? Are
they trying to appeal to both? Some theatres will only produce new
ZULWHUV%\GH¿QLWLRQWKH\DUHDOVRFDWHULQJWRDQXQGHUDXGLHQFH
Under 35: Ingenious and intricate plotting does not tend to be either
characteristic or strongly desired by the under 35 audience and their
writers. This does not mean that work enjoyed by younger audi-
ences is plotless. What excites younger audiences is an audacious,
bold or bizarre world (often a Gothic one) where whatever happens
is extraordinary. Sensational incident is more important than inter-
connected incident, and the ‘logic’ of plot is not as important as the
spectacular and sensory impact of that plot. Additionally, Performa-
tive States (covered in Chapter 12) have a more structural role than
in work for older audiences. Finally, it’s worth noting in passing that
younger writers and their audiences tend not to need a narratively
satisfying ending to their theatre. It can simply stop. I’m tempted to
say that endings, to a young audience, have less impact than starts
and middles. They’re much closer to the start and middle of their own
lives in all its strangeness and excitement, and there is little need to
understand what life and its stories mean ‘as a whole’. This is not
an encouragement to younger writers not to bother with their play-
endings; simply a suggestion to concentrate on making the world of
the play amazing, and let the ending look after itself.
Over 35: With the older generation of theatre-goers, on the contrary, I’d
suggest that an interest in the power, meaning and aesthetic perfection
of a play’s ending is paramount. It’s not simply that older audiences
have experienced more of life (and they have); it’s also true that they
have usually seen a lot more theatre than younger people. They are less
21st Century Playwriting 363
impressed by ‘tricks’, or claims that ‘This theatre work is re-inventing
the wheel’. Fashions and ‘innovations’ recur, almost cyclically, so a
concentration of richness and coherence of meaning is probably more
important than any alleged ‘newness of message’. And it’s in a play’s
ending that meaning, or ‘What it all adds up to’, is most on display.
Use of the Fs
Under 35: The love of sensational impact and excitement in our younger
audiences is clear, but what’s not so clear are the implications for
us as theatre writers. I’ve already discussed the role of F-Buttons
(covered in Chapter 5), so I’ll state what I believe to be the dominant
buttons that excite younger theatre audiences: they are the buttons of
Fury, Frenzy, Fatalism, Fear, and yes, our reliable companion called
(euphemistically) Desire. In milder work, the Frisson button is use-
ful, too, especially when allied to the weird/funny agonies of love,
sex, courting, dating and marriage. Young audiences tend to oscillate
between agony and ecstasy in several aspects of their emotional and
social lives; this makes them highly receptive to a theatre dynamic
which does much the same.
Over 35: Contrary to the beliefs of some younger people, older folk don’t
stop living or enjoying their lives once they reach maturity and be-
yond. But the sensations are both less intense and less histrionic in
their expression. What replaces sensation and nervous intensity is a
deepening sense of the sadness and the tragic in life. Thus, stories
ZKLFKHPSKDVLVHGHHS)HHOLQJVRUDWUDJLF([LVWHQWLDO)HDU¿QG
a response in older audiences. But so does Fun.
FODVVVSHFL¿FFRPHG\ZKLFKWKHDWULFDOLVHVWKHVRFLDOSDLQVRIDVSHFL¿F
generation. In this case, the R-level in characterization is crucial: the detail
of the characters’ lives, where they work, what they do on weekends,
their fashion-sense, political views and attitudes to money—all this detail
allows an audience to see itself on stage, and to have its concerns dra-
matized. Thus, a (probably dark) comedy might be set in New York, and
deal entirely with the lives, loves and loneliness of a group of ambitious
young men and women who have all the money they want, but hardly
much else. That’s probably a Metaphysical statement in itself, but it’s
clothed in much social, emotional and realistic detail.
Over 35: The situation for older audiences is a little more complicated.
In the best mature theatre, there is a rich blend of R, E and M, but in
practise, there tends to be more focus on R and E. This means that real-
istic detail tends to be important because older audiences have learned
that everyday reality is complex and worth taking seriously. Equally,
psychological detail (the E-level) and the fascinating complexity of
humans and their intricate and often-contradictory behavior—this
tends to be a vital part of the plays that older audiences enjoy.
Relationship to reality
Under 35: Younger audiences enjoy plays that have an obviously complex
relationship to reality, and not just because they’ve had fewer years of
it. The 20th century has acculturated us to accept multiple realities. Even
when there is a ‘clear’, everyday reality, the aesthetic preference of
younger audiences is for plays that ‘do something to shake up the reality’.
The plays of Sarah Kane, and Caryl Churchill, for example, tend to be
DUWL¿FHVWKDWGRQ¶WUHÀHFWUHDOLW\VRPXFKDVWUDQVIRUPLWVHYHUHO\SDUD-
doxicalise it, or even make its reality grotesque, Gothic and monstrous.
Over 35: Generalisation is not really possible here, for it depends on the
story type, the theatrical genre and many other factors. The only
half-valid thing I can say is that, in general, older audiences prefer
more realism in their narrative worlds, along with characters (and
their authors) who take that realism seriously.
Under 35: In general, younger audiences have a preference for theatre work
WKDWHLWKHUTXHVWLRQVWUDGLWLRQDOPRUDOLW\VXEYHUWVLWRUR൵HUVJOLPSVHV
of worlds which live entirely without it. This is not to imply that audi-
ences under 35 have no interest in morality or ethical questions. In
fact, if anything, it’s the reverse. A burning desire to change the world,
21st Century Playwriting 365
which we all tend to have when young, usually translates into a desire to
challenge and ‘interrogate’ the moral norms which make up the world;
plays which deal with urgent moral questions—even by presenting
abnormal or anti-morality—are often appreciated by these audiences.
Over 35: Rightly or wrongly (with no pun intended), older audiences tend
to believe that they have worked out the fundamental moral principles
by which people and society should live. But this does not mean
that the moral basis of this type of theatre is unquestioned. On the
contrary, the ‘moral point’ of many plays for this audience actually
shows the inadequacy of such moral principles, and how life, time
and circumstances intervene to throw up “more mysteries than are
dreamt of in (our) philosophies”, as Hamlet almost says.
Under 35: If there is one area of contemporary theatre that divides its audience,
LWZRXOGEHLQHDFKJHQHUDWLRQ¶VXVHRIGUDPDWLFODQJXDJH7KHLQÀXHQFH
of contemporary Modernism is strongest in the work for younger audi-
ences. In this aesthetic, theatrical language does not exist to ‘serve’ the
plot or the characterization (except obliquely, even incidentally); rather,
it is the plot. It is the quintessential theatrical experience. One look at
the Sarah Kane excerpt I discussed in Chapter 1 will show you that the
quintessential modernist expression is the explosion of language in theatre
space. This creates the ‘micro-events’ that make up the larger forms of
more progressive contemporary theatre. The use of language as a primary
formative element in the work is both deliberate and self-conscious. By
self-conscious, I mean that the writer actually wants you to be aware
of the primary, structural role that language takes. In keeping with this
outlook, the word ‘dialogue’ is rarely used in discussions of this type of
theatre, for what is usually called ‘dialogue’ is the servant of other, more
prioritised aspects, like story, plotting and characterization.
Over 35: Plays and theatre works for our older audiences tend to follow
the traditional, humanist values: that language or dramatic dialogue
exists to serve the plot, reveal the inner lives of the play’s characters
and be the keeper of the play’s secret meanings. As I indicated ear-
lier in the chapter, if the dramatic language used is more realistic in
nature (i.e. closer to ‘how people really speak’) this is not because
older audiences are more conservative (though they often are), but
because older audiences have learned that reality is a much more
complex and dangerous phenomenon than younger people have yet
experienced, and are thus more willing to accept ‘realistic dialogue’
as the bearer of a play’s multiple meanings.
366 7ංආඈඍඁඒ'ൺඅඒ
Textures
Under 35: Related to the previous area (dramatic language), the use of
OLQJXLVWLFWH[WXUHVLVDOVRPDUNHGE\JHQHUDWLRQDOGL൵HUHQFHV7RD
young writer—and her audience—a texture is not one governed by
reality or ‘what people would say in that situation’. On the contrary,
it is reality. The texture chosen actually helps to create the reality.
To put this another way, just as language is at the heart of Modern-
LVWµUHYLVLRQLQJ¶VRLVWH[WXUH,WLVDQH൵HFWZRUWKH[SORULQJIRULWV
own sake. (Revisit Chapter 13 for the many varieties of spatial and
dramatic textures that are possible.)
To an older, realism-preferring audience, the textures of younger
SOD\VPD\RIWHQVHHPDUWL¿FLDODQGµVKRZ\¶DQH൵HFWIRULWVRZQ
VDNH%XWLW¶VZRUWKQRWLQJWKDWDQLQWHUHVWLQDSSDUHQWDUWL¿FLDOLW\
is really an interest in intensity. $QHZH൵HFWRUDQHZWH[WXUHKDVD
special intensity of its own.
Over 35: This generation of writers—and their audience—tends to regard
texture (like dialogue itself) as the ‘servant’ of other realities. It is
a means to an end, rather than an end in itself. The textures that are
FKRVHQDUHWKRVHWKDWÀRZµQDWXUDOO\¶IURPWKHPRUHUHDOLVWLFEDVLV
of the characterization or the story. It blends in. It’s not meant to be
noticed. There may still be great textual variety, but that is an end-
result of other factors at work.
An audience goes to see stories that are mostly about itself. It’s the
UHDVRQZK\LQDPRGHUQSOXUDOLVWVRFLHW\GL൵HUHQWDXGLHQFHVIRUWKHDWUH
exist. (It’s also the reason that most plays are set in the age in which they
are written.) But the contention of this chapter is that an audience is not
just demographically or racially created (the New York gay audience,
for example, as compared to an elderly, Jewish Florida audience). As the
SUHYLRXVVHFWLRQWULHGWRVKRZD\RXQJDXGLHQFHWHQGVWRZDQWGL൵HUHQW
things from its theatre compared to an older audience.
There is, however, another factor involved which further complicates
the picture: the Zeitgeist. This is German for ‘the spirit of the times’. Each
GHFDGHKDVLWVRZQÀDYRU%HLQJ\RXQJGXULQJ:RUOG:DU,,ZDVQRWWKH
same thing as growing up during the 1960s and 1970s, when such conten-
tious issues and traumatic events as the Freedom Marches, the assassina-
tion of John F. Kennedy, Martin Luther King and Malcom X, as well as
the Vietnam War, the Cold War, the Watergate scandal, and the corruption
of Vice-President Spiro Agnew: all these things galvanized and divided
the country. The type of person who emerged from the 1970s was a very
GL൵HUHQWLQGLYLGXDOIURPDYHWHUDQRI+LWOHU¶V:DU
John Cawelti, has written an astute analysis of how Zeitgeist myths
have changed in the USA. Writing in The American Self, in a chapter
entitled, “Pornography, Catastrophe, and Vengeance: Shifting Narrative
Structures in a Changing American Culture”, Cawelti delineates three
dominant myths of much of the 20th century. They are: the myth of proper
VH[XDOLW\WKHP\WKRIH൵HFWLYHLQGLYLGXDODFWLRQDQGWKHP\WKRIUDFLDO
temptation and conquest.
368 7ංආඈඍඁඒ'ൺඅඒ
%ULHÀ\HDFKP\WKPD\EHH[SODLQHGOLNHWKLV
The myth of erotic liberation and enslavement. This new myth ex-
plores the exciting but dangerous element of liberated sexuality. It has
produced a number of narrative consequences: the erotic thriller, where the
H[FLWHGPDOH¿QGVKLPVHOIDYLFWLPWRDVH[XDOO\UDPSDQWDQGPDQLSXOD-
WLYHIHPDOH7KH¿OPFatal Attraction is one example among many); the
‘liberated female’ manifestos and novels like Erica Jong’s Fear of Flying
and Fifty Shades of GreyDQGHYHQWKHYDVW¿HOGRIZULWWHQDQGLQWHUQHW
pornography stand as an expression of this released social impulse.
The myth of catastrophe. 7KLVLVUHÀHFWHGLQGLVDVWHUPRYLHVOLNH
The Titanic and its much earlier precedents, The Towering Inferno or The
Poseidon AdventureRUWKHQHZµIXQ¶VFL¿¿OPVOLNHWKHTransformer
series. Buried deep within these narratives is the eternal Romantic (and
youthful) hope for complete transformation, astonishing change and
ultimate transcendence.
The myth of the violent avenger. This myth should be obvious, years
DIWHU&DZHOWL¶VDQDO\VLVZKHQZHVHHWKHRXWSRXULQJRIYLROHQFHLQ¿OPV
or literary expressions of it (for example, American Psycho by Bret Easton
(OOLV$QGDFUXFLDOSDUWRI*HUPDQLQÀXHQFHGPRGHUQLVPLVLWVHPRWLRQDO
histrionic, sexual and psychological violence. It’s not for nothing that
European modernism is also sometimes called Brutalism.
21st Century Playwriting 369
An important question needs to be asked: How new are these ‘new’
myths? The dangerously sexual female of erotic thrillers seems very close
to the Lulu character of the early 20th century German playwright Frank
Wedekind’s plays (Pandora’s Box and Earth Spirit). And the myth of
FDWDVWURSKHFRXOGEHWUDFHGEDFNIURPWKHVFLHQFH¿FWLRQRI-XOHV9HUQH
and H.G.Wells, and even all the way back to the destruction allegories
of Sodom and Gomorrah, or The Flood depicted in the Bible. The ‘hope’
inherent in catastrophe narratives—for complete transformation, aston-
ishing change and ultimate transcendence—is also remarkably close to
the aesthetic and theoretical cravings of Richard Wagner for a total and
transformative ‘art work of the future’.
But this is not the point—and value—of Cawelti’s analysis. He states
that it is impossible to know how ‘permanent’ these new myths are. They
may well be transitional myths on the way to other narrative and mythic
positions. For example, the release of sexuality and its narratives may
ZHOOEHWKHPLGSRLQWRIDQHYHQWXDO¿[HGQDUUDWLYHSRVLWLRQEDVHGRQWKH
equality (real and conceptual) of the sexes.
Our job as creative artists is to respond to the myths that dominate
our time—assuming we can’t invent new ones for our times. (Only rarely
does an author do that: think of Wilde’s Dorian Gray, or Beckett’s ‘eternal
tramps’ (itself a response to Chaplin’s famous and nostalgic anti-modernity
tramp character.) Personally, I prefer to blend ‘old myths’ with new. Thus,
DFKDUDFWHUZKRLVGRPLQDWHGE\WKHP\WKRI(൵HFWLYH,QGLYLGXDO$FWLRQ
may be married to another character who, at heart, believes only in the myth
of Catastrophe. Or both myths may be at war—within the one character!
2XUWDVNDVWKHDWUHZULWHUVLVQRWMXVWµWR¿OOWKHDWUHVSDFHZLWKRXUVWR-
ULHV¶,¶GVD\LW¶VPRUH2XUWDVNLVWR¿OOWKHDWUHVSDFHZLWKVWRULHVthat need to
be told now, at this point in our history. A director once told me that she likes
plays which ‘shame’ a community. She advised me: “Find what a community
is most ashamed about—and then write about that.” This is another way of
saying “Address the Zeitgeist”. Deal with what has to be dealt with now. This
does not mean, however, that every single play you write has to be an Emile
=RODOLNHUHVSRQVHWRWKHÀDPLQJXUJHQF\RIWKHODWHVWVRFLDOLVVXH³-¶DFFXVH´
A warning, however: If your ‘task’ as a playwright can be reduced
to one single function, chances are you’re not suited to theatre writing.
Theatre writing is both topical and ‘eternal’ (check out the chapter on the
Universalisms). For every Liberal Anxiety (see the next chapter) that a
good play may deal with, it’s also dealing with many issues relating to
the timeless, unchanging nature of human experience.
So, how do we know ‘what’s important for this age’? The truth is,
we don’t. Some problems are so stark and obvious (for example, the
Cold War during the 1950s) that every man and his dog were aware of
370 7ංආඈඍඁඒ'ൺඅඒ
the perilous nature of the Zeitgeist. (It’s no accident that so many nuclear
DOOHJRULHVHPHUJHGDWWKLVWLPHHVSHFLDOO\LQWKHSRSXODU¿OPVFUHDWXUHV
from another planet, invasions from outer space, gigantic insects and
mutant beings. In most cases, however, we are too busy living in the age
to fully understand it.
x Work out ‘what bugs you’—and see if others share this irritation
or complaint that you have. Some irritations are simply eccentric
and subjective. Others are more fundamental, and allow us writ-
ers to carry out one of our most noble functions—to speak to an
age. “As a writer, your duty is to warn”, an actor once warned
me. Even if it’s only half-true, it’s worth thinking about.
&ඁൺඉඍൾඋ
UNDERSTANDING THE AUDIENCE (III): LIBERAL ANXIETIES,
HOW TO WIN A PULITZER PRIZE AND OTHER MYSTERIES
OF MODERN THEATRE CULTURE
audiences that come to our theatres as precious and valued? Giving them a
wonderful theatrical and imaginative experience will naturally build the theatre
audience. It’s well known in theatre circles that “word of mouth” (what audi-
ences that have seen a show or play say to their friends and acquaintances)
is easily the strongest builder of audiences for a show. And I’ve already said
WKDWDZRQGHUIXOSOD\ZLOO¿QGDZRQGHUIXO²DQGODUJH²DXGLHQFH
So we shouldn’t worry about audiences, but instead, make our work
brilliant, and—paradoxically—seek to place even more demands on our
faithful audience. We can do this by understanding and using the Liberal
Anxieties in our work. Earlier I said that nowadays theatre is a celebration
of surplus income. It can be more. It can also be a celebration of surplus
intellect and moral imagination. It’s our writing of plays that exploit the
Liberal Anxieties that help our theatre to be more than just diversions and
escapist entertainment; for, as noble as those aims are, theatre can do more.
,W¶VWLPHWRJHWVSHFL¿FDQGZKLOHGH¿QLWLRQLVXVHIXOLW¶VSUREDEO\
PRUHLPSRUWDQWWRGHVFULEHWKHW\SHVRI/LEHUDO$Q[LHWLHVWKDWÀRXULVKLQ
our contemporary culture. There are many.
$IHDUIRUWKH,QGLYLGXDOLQWKHPRGHUQZRUOGDQGWKHHৼHFWRQKLVKHUVRXO
A fear that how we earn our living is what will kill us—if it hasn’t already
This is the fundamental fear behind many plays with a political im-
SXOVH$¿QHEXWOLWWOHNQRZQSOD\H[HPSOL¿HVWKLVBack of the Throat
by Yussef El Guindi tells the story of an Arab-American who is visited
by two FBI agents who grill him within an inch of his life, tainting him
with suspicion simply because of his Arab heritage. Written in the years
RIWKH*HRUJH:%XVKSUHVLGHQF\DQGLQWKHSRVWZRUOGLW¶VD¿QH
example of how a play can be both topical and epic.
The fear that the individual will always be beaten by the State—and its
institutions
,PDJLQHDUULYLQJKRPHRQHQLJKWDQG¿QGLQJ\RXUSDUWQHUWDONLQJ
WRWKH&,$7KH\ZLVKWRXVHWKHWRSÀRRURI\RXUKRXVHWRFDUU\RXW
surveillance on your neighbours—whom (you soon learn) are suspected
of being Russian spies. You’d previously got on very well with them;
you’d shared meals, picnic, even Thanksgiving with them. The C.I.A.
advise you, when you next meet your neighbours, to ‘act as if nothing
has changed’. As if you could! But this ‘story’ actually happened to an
ordinary couple in London. It wasn’t the C.I.A. that called on them; it was
the British equivalent, M.I.6. The pressure on the couple who were caught
up in this espionage trap was extraordinary. The woman died not long
after her neighbours were arrested and charged with espionage. Imagine
that happening to you. Hugh Whitemore did, and created a compelling
play, Pack of Lies, which dramatizes this Liberal Anxiety: If the State and
its powerful mechanisms behaved like that in the case of this ordinary
couple, what could they do to me?
able’ Enigma code by which Hitler’s navy received its battle orders. But
this extraordinary achievement was overlooked when, after the War, he was
arrested and charged with the crime of homosexuality. The circumstances
of Turing’s arrest were almost farcical; but the consequences were serious.
Turing was charged, lost his security clearance, and was given the choice
of imprisonment or chemical castration. He chose the latter, and soon died
of arsenic poisoning, apparently in suicide. That this should happen to a
war hero who helped to shorten the War’s duration is just one of the tragic
ironies that abound in this play.
Interestingly, recent research has shown that Alan Turing probably
did not commit suicide, but was probably poisoned by the chemicals he
worked with. But this does not lessen the power of the Liberal Anxiety that
pulses throughout this play. Had Turing lived now, the forces of tradition
and history would probably not have punished his homosexuality at all.
But the lesson of ‘what history can do to you’ remains a powerful message.
In a certain sense, this Anxiety is also part of the enduring appeal
of Tennessee Williams and his plays. His greatest characters operate
from delusion, ruin and loss. They live in the past because they cannot
endure the present, and cannot even imagine the future, except in wildly
unrealistic terms.
Part of the reason for the international success of Sarah Ruhl’s Dead
Man’s Cell Phone is the chord that the play struck, especially our love of
the convenience, mystery and aura that surround our modern technologi-
FDOOLIH,QWKDW¿QHSOD\DZRPDQKHDUVDPDQ¶VFHOOSKRQHULQJLQJ6KH
SLFNVLWXSDQG¿QDOO\DQVZHUVLWEHFDXVHWKHPDQZLOOQRW,WWXUQVRXW
he has just died.) The woman gradually enters the dead man’s life, living
vicariously through him and his strange family. Beyond the interest of
the writing, lies a fascinating Liberal Anxiety. While we sometimes take
modern technology for granted, every new development reminds us of
the excitement of technology’s complexity and its possibilities for the
future. But deep within us a fear also resounds—or perhaps it’s simply
a question: Has the highly technological life that we lead, and take for
granted, obscured other aspects of life? In gaining so much (technological)
control, have we lost something else, perhaps having to do with feelings,
moral balance or a sense of what constitutes healthy living. Put more
simply, it might just be a fear that we are losing something valuable in
our pre-technological life that gives plays like this an extra edge, and an
additional reason for seeing them.
21st Century Playwriting 377
The fear that we are losing an institution that once helped us become strong
Some time ago now, the British writer and translator Christopher
Hampton dramatized the novel The Portage to San Cristobal of A.H. by
George Steiner. In both the book and the play, a secret American-Israeli
mission into the central American jungle has one aim: to capture a now
very old Adolf Hitler who has apparently been hiding out for decades in
South America (as many ex-Nazis actually did.) The story has a bizarre-
but-fascinating ‘What if?’ premise: What if Hitler had survived the War?
How would he defend his crimes? That’s (partly) what the book and the
SOD\VHWRXWWRDQVZHU%XWOLNHPRVWRIWKH¿QHSOD\VH[DPLQHGLQWKLV
section, the story is just the pretext; an ‘excuse’, so to speak, for a deeper
philosophical discussion. Even beyond the work’s discussion of the re-
current nightmare that was Nazism, there is a deeper theme: our fear that
Evil can never truly be killed.
The fear that ordinary people, a fellow citizen, even your neighbour, can
commit unspeakable evil
Ariel Dorfman’s play Death and the Maiden dramatizes this Anxiety.
Set in an un-named country in South America, a man brings home a new
acquaintance he’s just met. The woman recognises this stranger by the
sound of his voice: she is convinced that it’s the man who tortured her in
prison during the recent period of military dictatorship. During the night,
she overpowers the stranger, ties him up and subjects him to questioning
and punishment. What follows is a feverish, unpredictable inquisition,
where ideas and philosophies are contested with great personal urgency.
The best productions I’ve seen of this play have tended to rely on more
than just the melodramatic question (“Will the woman kill her former
378 7ංආඈඍඁඒ'ൺඅඒ
torturer?”) There are two more issues in this play: How can she even be
VXUHRIWKLVPDQ¶VJXLOW"$QGLIKHLVJXLOW\LVWKDWVX൶FLHQWMXVWL¿FDWLRQ
for personal revenge? This layering of complex questions, one on top of
the other, gives us a clue as to the best use of Liberal Anxieties in our
writing: It’s not the answers to the questions that matter—it’s enough to
raise complex, disturbing questions and let the answers prey on the minds
of our intelligent audiences.
:KDWLI\RX¿QDOO\PHWWKHORYHRI\RXUOLIH":KDWLIWKLVSHUVRQ
made you feel like no other? The only problem is that you are already
married. A dilemma worthy of soap opera perhaps? But it gets worse:
\RXDUHDQLPSRUWDQWJRYHUQPHQWR൶FLDOLQFKDUJHRIVWDWHVHFUHWV7KH
love of your life turns out to be a spy for a hostile government. But that
is not all: the love of your life is not a woman even though she lives
and dresses as one—but a man! Astoundingly, you have not discovered
this, even though you have made love many times (in the dark) with her.
This astonishing mix of improbabilities actually happened to a French
diplomat serving in China in the 1950s, and became the basis for David
Hwang’s 0%XWWHUÀ\In this play, everything is exotic (politics, sexuality,
gender, race) and nothing can be relied upon. But beyond that, the play
R൵HUVXVVWLOOPRUHFOXHVDVWRWKHEHVWZD\WRXVHWKH/LEHUDO$Q[LHWLHV
make the audience feel that this situation could happen to them, given
the right circumstances. The audience becomes implicated and cannot
distance itself from a bizarre situation. In this way, the exotic “Other” is
not separated from the audience’s inner lives, but is a part of ourselves
WKDWZH¿QGKDUGWRDFFHSW
The fear that you, too, will have to make terrible choices in your life
My own play, Kafka Dances, was initially written from a deep desire
to ‘create a fantastical dream life on stage’. The play tells the story of the
great writer Franz Kafka and his attempt to marry the same woman—twice.
(It was a true story, too.) Apart from my love of Kafka’s writings, I had
QRRWKHUVSHFL¿FPHVVDJHWRJLYH%XWODWHU,OHDUQHGRUUDWKHU,ZDVWROG
that one of the reasons that audiences in many countries responded to the
play was because it raised a terrible fear, disguised as a choice: it was the
horrible fear that a person of great intelligence and imagination (Kafka)
PXVW FKRRVH EHWZHHQ KDSSLQHVV DQG WKH IXO¿OPHQW RI RQH¶V WDOHQWV²D
choice that most people understand and probably fear that they will also
have to make in their own lives. Without knowing it, I’d embedded a
21st Century Playwriting 379
Liberal Anxiety in the play. It also taught me another valuable lesson:
&UHDWH¿UVWZRUNRXWZKDWLWDOOPHDQVODWHU
Acting as your Career Manager, I’ll show you the secret plan. There are
four ‘simple’ steps, in my view.
Liberal Anxiety: This aspect has already been discussed earlier in the
chapter. Many of the examples discussed above are Pulitzer Prize
winners. Unlike other plays you will write, you probably should know
from the get-go what Liberal Anxiety your play is dramatising. It’s
SUREDEO\WKHEURDGWKHPHWKDWLQWHUHVWHG\RXLQWKH¿UVWSODFHDQG
ZKLFKLVJLYLQJ\RXWKHµ¿UHLQWKHEHOO\¶WRZULWHWKHSOD\
Journalistic topicality: Some ideas and themes are more apposite than
others. There is often a feeling that a play’s time has come because
the idea that the play dramatizes is urgently needed at that time. This
was the case, I believe, with Angels in America by Tony Kushner. All
over the world, not least in the U.S., there was a feeling that ‘these
things needed to be said’. Thus, I’d suggest that you ask yourself:
“What is crying out to be dramatized now?” A more recent example
of that urgency would be the Pulitzer Prize-winning play Ruined by
Lynn Nottage, set in the Democratic Republic of Congo, a play that
dramatizes contemporary African horrors in the light of history, sexual
politics and Western responsibility.
Narrative ‘angle’: This may be nothing more than ‘the great twist that
makes the play’s story special’. For example, the play The Mountaintop
by Katori Hall has both an interesting narrative ‘angle’ (the last night
on earth of Dr. Martin Luther King Jr.) as well as a twist that I won’t
reveal if you’ve not seen the play. (It involves the character who visits
Dr King.) Or it may be that there is a special moment that makes the
whole intellectual journey more than just an interesting play of ideas.
Such a play is the Pulitzer Prize-winning Wit by Margaret Edson,
whose transcendent ending helped to make it an international success.
21st Century Playwriting 381
Step 3: Complete the paradigm for your play—at least in outline.
Step 4: Write the play, completely forgetting (for now) the paradigm in
Step 3.
Here, you write the play that you are burning to write. You let your
SHUVRQDOSDVVLRQLQVWLQFWDQGFUHDWLYH¿UHGHFLGHZKDWLVVDLGDQGGRQH
If any elements of this ‘Pulitzer Paradigm’ emerge in the writing, they are
likely to be organically connected to the whole of the play (which was
the point of Step 3). If they are not, there is still time to coolly review
and decide whether any new elements are still needed. (As the chapter on
‘threading’ shows, it is surprisingly easy to thread extra and enriching mo-
ments into your work, no matter how ‘seamless’ it appears.) Furthermore,
it’s possible to become too precious about your writing (e.g. “My writing
can’t be changed.”) As this book stresses, theatre writing is a collaborative
and co-operative art. Changes happen all the time, not least in the writ-
ing of the developing drafts you will do. Or as George S. Kaufman said,
echoing Dion Boucicault, “Plays are not written; they are re-written.”
And he won a Pulitzer too.
Doctor Johnson once said that “People need not to be taught, so much
as reminded.” He was implying that a lot of the ‘wisdom’ that comes from
received cultural products (like books or plays) does not contain new or
original thoughts but instead deals with ideas that people already knew
but had perhaps forgotten. The thoughts were not new, but they were still
important—and in ‘reminding’ people of them, the writer is perform-
ing an important creative and civil duty. While this still applies today,
it’s also true that our age is more sceptical, more disruptive and more
382 7ංආඈඍඁඒ'ൺඅඒ
questioning—at least in its literary and artistic tastes. Leaving the job of
telling people only what they want to hear to more conservative (or lazy)
cultural artefacts, I’ll suggest that one of the great imaginative services
you can do for a modern theatre audience is to question something that
the audience has previously taken for granted, or regarded as eternally,
universally and incontestably ‘true’. In other words, you can attack a
‘motherhood statement’.
As you probably know, a motherhood statement is an assertion about
something that, on face value, no one could argue with. For example, the
statement that “Motherhood is a good thing” is probably the most basic of
motherhood statements. But what if it wasn’t a good thing? What would
you have then? You’d probably have a story. Or you might have an appall-
ing but extraordinary character. Or you might have Phaedra, who killed
her own children and became the basis of several great Greek tragedies
(some of them lost). Racine, one of the greatest French dramatists, was also
fascinated by this story. Phaedra’s story is shocking, irrational, fascinating,
exceptional—and heretical, because it implies that a basic tenet of faith
(the goodness of mothers) does not necessarily always apply.
Another motherhood statement is of a political nature: “Democracy
is always good for society”, a belief that was at least partially behind
WKH¿UVW$PHULFDQLQWHUYHQWLRQLQ,UDT%XWVRPH\HDUVDJR,OLVWHQHGWR
a fascinating discussion where the playwright Tom Stoppard discussed
a favourite play of mine. The play is a Swiss-German play called, in
English, The Visit of the Old Lady, by Friedrich Dürrenmatt. In that play,
a wealthy old billionairess, Claire Zachanassian, returns to the Swiss vil-
lage she grew up in, and where she met Alfred, the love of her life. The
locals are delighted to see this local-girl-made-good, and spend much
WLPHLPDJLQLQJWKHPDQ\¿QDQFLDOEHQH¿WVWKDW&ODLUHZRXOGEHVWRZXSRQ
the old town, which like many small communities, is desperately in need
of development and prosperity. Claire returns, to great acclaim, and she
GRHVLQIDFWR൵HUULFKHVWRWKHWRZQ%XWVKHKDVRQHVLPSOHFRQGLWLRQ
they must execute Alfred, her ex-lover who jilted and rejected her many
years ago. The townsfolk are outraged. But a few days pass, and they get
to thinking about Claire’s proposal. Then a few more days pass, and they
are seeing ‘the pros and cons’ of her shocking demand. Eventually, the
majority decide that it would be good for the whole community if Alfred
‘took one for the team’ and allowed himself to be executed.
This dark parable about ‘community’ is fascinating and entertaining in
its own right. But Stoppard went further: he contended that this play was
positing the shocking proposition that ‘democracy is not always a good
thing’. In other words, Stoppard was drawing attention to the inadequacy
of unchallenged, universal beliefs—or motherhood statements.
21st Century Playwriting 383
I could go on, but I’ll simply leave you with some more fundamental,
‘unassailable beliefs’ that may not necessarily be always and in every case
true. Here are some more motherhood statements:
See what I’m getting at? If ever you are stuck for a story, simply con-
sider a motherhood statement that has always slightly irritated you—and
imagine its reverse. People that imagining with characters, and you’re
halfway to a powerful (and shocking) story. Or you could consult a book
of proverbs or sayings, which are replete with motherhood statements.
6LPSO\¿QGWKHVD\LQJWKDWVHHPVPRVWDUJXDEOH²RUWKHPRVWVROLGDQG
trustworthy—and see what happens when you imagine a world where the
opposite of that ‘universal truth’ applies.
It may be heretical to think like this, of course. But it may also make
great theatre. At the risk of putting it too simply, I’d suggest this: Find a
motherhood statement, and let your story, characterization and the play’s
arguments and ideas prove—however temporarily—the opposite of what
is generally believed. Alternatively, you may just like to assert what the
intended audience would least like to hear about the conventional truth.
It may be uncomfortable for some audiences, but many will thank you.
They may even compare you to George Bernard Shaw, or Oscar Wilde, or
even Joe Orton, all of whom spent their careers playing devil’s advocate
and provocateur to generations of theatre audiences.
385
&ඁൺඉඍൾඋ
WORKING METHODS: HOW TO START WORK ON YOUR PLAY
This chapter is all about turning the dream of “writing that play”
into reality.
HAVE A PLAN
0\¿UVWVXJJHVWLRQLVVLPSOHKDYHDSODQ7KRXVDQGVRISHRSOHVD\
WRWKHPVHOYHV³,Q¿YH\HDUV,¶OOKDYHP\GHJUHH´2U³,QWHQ\HDUVZH¶OO
KDYHSDLGR൵WKHPRUWJDJH´:K\VKRXOGZULWLQJEHDQ\GL൵HUHQW"$Q\WKLQJ
worth achieving is probably ambitious. If it’s ambitious, it will probably
take a while to achieve. If it takes a while to achieve, it will need a plan.
Is it your intention to write a play? Or is it “to write a fantastic play,
the like of which no one has ever seen before”? The higher the ambition,
the more work it will take.
To get a writing plan going, you need to do three things:
First, you need to establish a creative goal for yourself. (e.g, to write
a short play, using an idea you’ve had for a while.) The idea probably
needs to be a good balance of “very exciting” versus “very achievable”.
Second, you need to work out the steps involved in achieving this
aim. Breaking down a complex play into viable steps is very liberating.
Finally, you should establish the amount of time you think it will take
to achieve the goal... and then double it. In my experience, most things
take much more time than originally anticipated. Ask yourself, “Am I
prepared to take twice or three times the length of time to complete this
creative project.” An honest answer may save you a great deal of time.
1. THE IDEA
It’s not enough to want to write. The best plays come from a burning
desire to have something to say. But what does it mean to ‘have some-
thing to say’? The phrase is often misunderstood. Having something to
386 7ංආඈඍඁඒ'ൺඅඒ
say does not mean that you have a neat, containable ‘message’ and all
the play has to do is deliver it like some sort of literary postman. The
best playwrights do not deliver a message. They deliver a world, or a
world-view. They show ideologies in action, but don’t preach them, and
rarely moralise over them. Most of all, the world they show is unique in
some way, with its own special oxygen. The characters who populate that
ZRUOGDUHLGHQWL¿DEO\KXPDQEXWDUHLQVHSDUDEOHIURPWKHZRUOGLQZKLFK
they live. Try separating Vladimir and Estragon (Waiting for Godot), or
Caliban and Ariel (The Tempest) from their worlds. Perhaps the clearest
expression of ‘having something to say’ that I can propose to you is that
you really do have something to say when the characters and their world
are quite original and special.
There is, however, another type of ‘idea’ that is less exalted but more
achievable for writers. That is the relative originality of the story idea.
Its basis is often the ‘what if?’ speculation. Imagine a boy who blinded
six horses with a metal spike. “What?!” you think. What if Tchaikovsky
didn’t die of cholera but was actually ordered to kill himself to prevent
a sexual scandal? What if you woke up one day and found you’d turned
into an insect?
Each of these three speculations has a quality of outrageousness, of
a violation of some order (moral, aesthetic or natural). These ideas have
an ability to jolt. One does a double-take on hearing them. “He turns into
a what?!” (Sadly, all three ideas have already been used.)
/XFNDQGJRRGSODQQLQJKRZHYHUFDQHQVXUHWKDW\RX¿QG\RXURZQ
LGHDV,I\RXFDQFROOHFWEXWWHUÀLHV\RXFDQFROOHFWVWRU\LGHDV.HHSD
¿OHRUWKUHHµ&RPLFLGHDV¶µ)LOPLGHDV¶DQG³6WDJH3OD\LGHDV´/RRN
in all the right places for them. The tabloid newspapers regularly print
small ‘news’ items which claim to be true: “Man Buries Grandmother in
Junkyard Rubbish”, “Woman Sleeps With Six Bishops”, “Strong Man
Promises to Eat a Toyota Corolla.” It’s a mad, fantastical world out there,
and the tabloids—and now, the internet—have it covered. Admittedly, it’s
the grotesque and bizarre, but is it any sicker or sillier than the story of a
woman who plots revenge by having a man’s children killed and served
up to him in a casserole? William Shakespeare quite liked that one. And
SHUVRQDOO\,¶GUDWKHUVHHDSOD\RU¿OPDERXWDPDQZKRWULHGWRHDWDFDU
than another story about a dysfunctional marriage.
An aside: How do you know if you’ve got a great idea? I’d suggest
four ways to test it.
x 'RHVWKHLGHDIHHOOLNHLWLVUHÀHFWLYHRIVRPHWKLQJJRLQJRQLQ
our era? I’m not talking ‘topicality’ here (which quickly dates)
but something that is mysteriously true to the Zeitgeist (spirit
of the age.)
Let’s assume, then, that you’ve found an idea that excites you, makes
you laugh out loud, and pumps creative adrenalin through your veins.
What next?
6RPHVWRULHVUHTXLUHORWVRIUHVHDUFK2WKHUVGRQ¶W7KHUHDUHGL൵HU-
ent types of research.
There is informational research. Let’s say you’re writing a play set in
WKHOXQFKURRPRIDFDUIDFWRU\<RXFDQGRERRNUHVHDUFKRUDFWXDO¿HOG
research, like the journalist who spent six months on a Toyota assembly-
line exposing its harsh conditions. The ritualism and intricacy of how a
car assembly-line actually works was one of the many fascinations of his
book. Far too often, an audience leaves a play thinking, “There wasn’t a
single thing there I didn’t know already. I learned nothing I couldn’t have
read in a two-page magazine article.”
There is also emotional and psychological research. This is an area
where the failure is often quite spectacular. The range and depth of emo-
tions is often inadequate to the human reality of the situation. To achieve
the illusion that ‘this character is richly human’ you need to provide that
character with a range of emotions, or a deeply symbolic state of being.
Both require that type of imaginative speculation: “What does she feel?
What is it like being inside her? What does she dream of? What do her
nightmares consist of? What is the secret language of the self that only
she can use?”
There is also narrative research. As writer, you’ll be searching for
the best way to tell the story, and how to tell it in theatre space. You’ll
388 7ංආඈඍඁඒ'ൺඅඒ
read works where a similar plot problem was solved. You’ll notice how a
SDUWLFXODU¿OPVROYHGDSORWWHFKQLFDOLW\WKDWVWXPSV\RX
The above research is important, but its principal value is to prompt
a rich collection of sketches. What is a ‘sketch?’ Put simply, a sketch is
either an inspiration or a speculation. It is a fragment of language that
you’ve suddenly thought of that is perfect for one of your characters. It
may be a joke. It could be an action that your main character does. You
just thought of it, and you’re very pleased with yourself
But a sketch is also a deliberate speculation. “What if instead of her
EHLQJDGRFWRUVKHLVD¿QJHUSULQWVSHFLDOLVW"´³:KDWLIWKHUHDUHWZRNLOO-
ers, not one.” As a playwright, you are there to shape material, but often
you need lots of material before you can start cutting, shaping and honing.
Research and sketching are most useful when they—
—attempt to clarify the dramatic ideas that your characters are
embodying. (“I think this play is really dealing with …”);
—result in a wonderful line (or ten) of powerful dramatic language;
—give you ideas about how to clarify the plot and the major dra-
matic actions.
Language sketching is a very useful tool. You simply get the characters
talking to each other. To establish the true nature of a dramatic relationship,
verbally unleash the two characters on each other. Write for page after page.
(TXDOO\LI\RXZDQWWR¿QGDQLQGLYLGXDOFKDUDFWHU¶VWUXHµYRLFH¶WKHQKDYH
him talk about himself. Use the “I” word frequently in his ramblings. (“I
EHOLHYHWKDW,¶PWUXO\;´,DOZD\V¿QGWKDW´/HWKLPUDYHDQGUDPEOH
on for pages. Eventually his true voice will emerge. You’ll throw away
ninety per cent of it, but the ten per cent you keep could be the key to the
whole play. David Mamet once said in an interview that he never starts a
play before he has about a hundred pages of dialogue between characters.
There are worse things to do with your time. There must be, because when
I’m watching plays I often feel a lack of sketching and deep preparation
in the play. Many playwrights obviously don’t sketch enough. Their ideas
DUHQRWGUDPDWL]HGGHHSO\RURUJDQLFDOO\7KHUHDGLQJLVVXSHU¿FLDO7KH
thinking isn’t deep or insightful. The language isn’t crystalline and symbolic
enough. All of these problems come from either a rushed writing process
or a lack of sketches—which is probably the same thing.
Remember what a sketch is: a sketch is an inspiration. Let your pen or
ODSWRSUXQRQIRUDVORQJDVLWÀRZVHDVLO\:KHQ\RXULQVSLUDWLRQVWRSVWKH
VNHWFKLV¿QLVKHG<RXUMRELVWRFROOHFWORWVDQGORWVRIWKHVHPRPHQWDU\
fragments of dialogue. You’ll need the best of them later. But a warning:
\RXUµIDYRXULWHOLQHV¶PD\QRW¿WWKHSOD\RUPD\GLVWRUWWKHVFHQH,QYHQW
wildly and freely, but ultimately the ‘great lines’ will be at the service of
21st Century Playwriting 389
a range of other things—plot, use of theatre space, the play’s tone, or the
larger meaning of the play itself.
LQWKHDLUDQGH[SHULPHQWZLWKGL൵HUHQWRUGHUV2UWU\WKHPEDFNZDUGV2U
alternate past and present. Remember, if you’re going in ‘correct’ temporal
order (from earliest point in time to latest) you will probably need to go
YHU\IDVW,QWKHDEVHQFHRIPDQLSXODWHGWLPHZKLFKSOD\VZLWKGL൵HUHQW
time periods, you need to use the one card left to you: speed. Theatre time
tends either to be manipulated or to be compressed (by speed.)
Once you’ve got an order (or disorder) that you like, the next step is
easy, as you’ve already done most of the work.
This step is a very happy one, as it’s where you realise how much
great material you’ve already got. If you’ve sketched properly, that is, if
you’ve allowed the idea enough time to have simmered lots of thoughts,
ideas and great dialogue lines, then this step is harvest time, where you
reap all that you’ve sown. Simply sort all the ideas and sketches into
their scenes, based on the working Scene Breakdown that you’ve already
established. It’s a great feeling to realise you’ve got thirty pages of ideas
for the opening scene, especially when your instinct tells you that the
scene will only need to be about three pages long. It turns the next step
into a very unpressured one.
6. DO SOMETHING ELSE
HVSHFLDOO\LIWKHDVVHVVRUWKURZVLQVRPHLGHDVDVWRKRZWR¿[WKHP
So get an assessment from a professional organisation or an indi-
vidual, even if you have to pay him or mow her front lawn in gratitude.
Join the professional associations like the Writers Guild of America or
the Dramatists Guild of America. Enter your play in one of the great U.S.
play conferences, like the Valdez Last Frontier Theatre Conference, or
the Omaha Conference, or the Eugene O'Neill. You’re not a writer till
you say you are, or until you’ve got the membership card that proves it.
If you can’t believe in yourself enough to join a professional association,
why ask others to believe in you (or your work)?
Having got the great advice which allows you to see your play more
clearly, you can then settle down and do the rewrites. As I’ve already
mentioned, George S. Kaufman, echoing Dion Boucicault, said that plays
are not written; they’re rewritten. As a man who had sixteen Broadway
hits, he should know. Plays are hard work, no matter how exciting they
are to write. You’ve got to love the rewriting. Why shouldn’t you? With
HDFKUH¿QHPHQWRUHGLWLQJ\RX¶UHJHWWLQJWKHSOD\FORVHUWRLWVLGHDOVWDWH
You’re also getting the play closer to production. Unless you’ve already
rashly sent it out before it was ready. I’ll deal with that tragic state of af-
fairs in the next chapter.
%\WKHWLPH\RX¶UHDW\RXUIRXUWKRU¿IWKGUDIW\RXPLJKWEHJHWWLQJ
creatively stale, or just plain sick of the work. In this case, put it down for
a while. Unless they’re about ultra-fashionable trends, most plays don’t
date as quickly as you might fear. There’s often a period of several years
in which your play can be written and still feel as if it’s been written yes-
terday. So be patient. Let the work get rich and powerful, so it can realise
its own wonderful potential. You’ve really no choice in this. Half-baked
work rarely gets produced by the very best theatre companies.
Occasionally an established writer lets a turkey through, of course,
and it gets a reasonable audience, who go away disappointed. But it’s
QRWDQRSWLRQIRUDQHZZULWHU²XQOHVV\RX¿QGWKDW\RXUZRUNLVEHLQJ
produced only because you’re a new writer. (It happens, but unless your
work is good, next year there’s a whole new crop of equally (un)talented
young ‘uns, and at the age of 25 years old you’re consigned to history.)
Anyway, isn’t your aim to write wonderful, amazing theatre? Once
you recover your love of the play, and your energy has returned, start
on the next draft. Or the one after that. Be a bloodhound. Each new and
improved draft brings you closer to the fox.
393
&ඁൺඉඍൾඋ
THE MARKETPLACE (I): GETTING YOUR PLAY PRODUCED, NET-
WORKING AND WRITING FOR THE WORLD THEATRE MARKET
When all’s said and done, playwrights really have only two questions:
“How can I become a better playwright and artist?”, and “Where and how
can I get my plays produced?” All craft development, career advice, the-
atre workshops and script development have as their aim the satisfactory
answering of one of these two fundamental questions.
Your task, then, is twofold: to develop your artistry, while also sharp-
ening your awareness of the realities of theatre production in today’s world.
0RVWRIWKHERRNKDVEHHQFRQFHUQHGZLWKWKH¿UVWWDVN7KLVFKDSWHUZLOO
deal with the second.
Before that, however, some background is needed. American theatre is
young. It’s been young for over two hundred years, and will remain so for a
good deal longer. The reasons for this are complex, and have to do with a range
of things this book can’t cover: the place of theatre in the USA; the ‘adolescence’
in Jungian terms of the country and its culture—an aspect shared with several
RWKHU(QJOLVKVSHDNLQJFRXQWULHVWKHVWDWXVRI¿FWLRQDOLVHGLPDJLQDWLRQDQG
intelligence in the country’s dollar-value-system; the relative cultural innocence
of the average American theatre-goer; and not least, the sporadic or even hostile
attitudes and policies of some Administrations to the arts, especially its funding.
But for all that, artists still create, because that is what we do. But we need
to be aware of the climate we work in. If American society is young, American
professional theatre is even younger. There is much to celebrate, and much to
be wary of. We have a world-famous theatre heritage to be proud of and critical
of. We have commercial theatre as well as numerous fringe theatres, actor-
driven groups and other art-generating theatrical activity. We have a diversity
RIZULWLQJDFWLQJDQGSHUIRUPDQFHVW\OHV&UXFLDOO\DVWKH¿UVWFKDSWHULQWKLV
book indicates, we have a lively, timely and on-going debate about the type
RIWKHDWUHZHVKRXOGEHZULWLQJDWRSLF,VKDOOUHWXUQWRLQWKH¿QDOFKDSWHU
These things we can celebrate and be rightly proud of. American theatre
culture has enriched our society and helped to turn it into a great nation. But this
is no time for complacency. An awareness of the realities of theatre in America
LVDOPRVWDVLPSRUWDQWDVDUWLVWLFGHYHORSPHQW$V,ZDUQHGLQWKH¿UVWFKDSWHU
European and non-American work is increasingly being staged in the USA.
With all that in mind, let’s deal with the big question: How do you
become established in theatre so that your work is produced, and even
earn good money from it?
There is no one single answer to this question. Rather, there are many
factors that you should be aware of. First, should we even rely on playwrit-
394 7ංආඈඍඁඒ'ൺඅඒ
ing exclusively for our income? I’d broaden this question: should we rely on
DQ\WKLQJIRUDQH[FOXVLYHLQFRPH"$Q\VXEXUEDQ¿QDQFLDOH[SHUWZLOOWHOO
you never to put all your eggs in one basket. Diversity is strength. Variety
LVWKHVSLFHRIOLIHDQGVRXQG¿QDQFHV,NQRZZULWHUVZKRUHO\RQZULWLQJ
for all their income. Some live comfortably, but many of them are stressed
DQGRYHUZRUNHG(YHQLQ(XURSHPDQ\¿QHDUWLVWVOLYHIURPRQHJRYHUQ-
ment funding application to the next, and given the increasing parsimony
(even bankruptcy) of many European governments, it can be a demoralising
existence, suitable only for those who thrive on uncertainty and overdrive.
Even more miserable are some writers writing the shows you see on
television. Some television shows are wonderful, and are equally won-
derful to write for. (The growth of quality American television in the last
two decades is a story in itself. So is the proud TV tradition of the BBC
and ITV in England.) But other shows are not so wonderful, and in these
cases, the writers decided to become regular earners in writing, but in the
process they may well have stopped being creative artists. They write at the
beck and call of producers, rather than their own inner creative instincts.
Rather than write a story they are passionate about, they become profes-
sionally interested in the ‘professional, craft challenges’ of the writing
job at hand. They are like lawyers for hire. In some cases, they will have
IRUJRWWHQZKDWPDGHWKHPZDQWWRZULWHLQWKH¿UVWSODFHWKRXJKPDQ\
RIWKHPKDYHVRPHZKHUHDQXQSURGXFHGVWDJHSOD\RUDQXQPDGH¿OP
VFULSWWKDWWKH\RFFDVLRQDOO\GXVWR൵DQGJD]HDWZLVWIXOO\
If only so that you can avoid both wistfulness and having to dust, I’ll
cheer you up by saying that I strongly believe that you don’t need to be a
full-time theatre writer to have a career in theatre. Believe it or not, a few
hours of part-time writing per week can allow you to create work of power
DQGVWDWXUHKDYHDOLWHUDU\UHSXWDWLRQDQGHYHQGRYHU\ZHOO¿QDQFLDOO\
I know lawyers who write. Doctors who write. Poets who milk the
cows in between writing sessions. Many of America’s best playwrights
DOVRWHDFKDWRQHRIWKHJUHDWXQLYHUVLWLHVWKDWR൵HUWKHDWUHDQGGUDPDVWXG-
ies. Unless you are a monomaniac, these activities are not interruptions.
They are activities; a part of life; intellectually stimulating; a break from
writing; ‘grist for the mill’. In many cases, these jobs are easier ways to
HDUQ \RXU PRQH\ HVSHFLDOO\ ZKLOH \RX DUH GHYHORSLQJ DQG ¿QLVKLQJ D
SDUWLFXODUO\GL൶FXOWSOD\$QGLQWKDWVHQVHPRVWSOD\VDUHGL൶FXOW
For theatre writing is very exciting, but it is often very hard. It requires
concentration, and a well-developed ability to think and plan ahead. You
QHHGWREHDEOHWRGHOD\\RXUGHVLUHIRUJUDWL¿FDWLRQ-RXUQDOLVWVVHHWKHLU
work in print the next day. Television writers have only to wait a few
PRQWKV%XWQRYHOLVWV¿OPZULWHUVDQGSOD\ZULJKWVNQRZWKDWLWFDQEH
¿YH\HDUVRUPRUHIURP3DJHRU6FHQHWRERRNODXQFKRURSHQLQJ
21st Century Playwriting 395
night) and the free champagne. Seen like this, the champagne isn’t free.
You paid for it in sweat and tears.
18. Write for 3-4 years ahead! Plays are expensive and complex; they take
time
19. Develop an 'export strategy' . . . Where do you want to be produced?
then . . .
20. . . . visit the export market It's the best form of tourism --and may be
taax-deductable
21. Cultivate a 'stable' of directors: 'one Work out what directors are especially
director for each project' JRRGDWR൵HUWKHPSOD\VWKDWEXLOGRQWKLV
strength
22. Have a circle of actor friends who A private reading can only point out the
will (for good wine) do a private read- SUREOHPVWKH\FDQ
W¿[LWIRU\RX
ing for you
23. Have a monthly ('by the end of this A small step taken is still a step forward
month, I will . . . ') work plan
24. Have a simple & easy weekly work Writing is not a replacement for a happy life;
plan (1-2 simple actions each week) it's an addition to it
All this might seem to imply that you have no hope of earning good
money from playwriting in the U.S. or elsewhere. This simply isn’t true.
It works like this: Write a play for a small theatre company that only has
one season of a few weeks, and you’ll probably earn only a few thousand
GROODUVPD\EHOHVV7KLVLVDOUHDG\DVPXFKDVPDQ\¿UVWQRYHOLVWVHDUQ
Write for a big state theatre company or a very prestigious and established
New York theatre (like Manhattan Theatre Club), and it might very well
be the start of a long and lucrative career.
You’ve probably heard the statement, “In theatre, you can’t make a
living, you can only make a killing.” Getting a regular income from theatre
is not easy—but theatre is not a regular job. It’s closer to agriculture. You’re
a type of literary farmer. You grow something. The market either wants
it, or it doesn’t, in which case it returns the crop to you in an envelope. If
it wants it badly enough, the harvest check is bountiful, and Bob’s your
uncle, as my uncle used to say.
If the harvest check turns out not to be so bountiful, or if it’s slow in
coming, or doesn’t turn up at all, there are still many things you can do.
Here are eight ideas:
1. Try and choose activities that educate you as well as paying you.
When learning to write, I lobbied my local public radio station to al-
low me to do a whole range of things, none of which I was then much
TXDOL¿HGIRU8QGDXQWHG,EHJDQZULWLQJUDGLRIHDWXUHVDERXWFXOWXUDO
theatrical and historical things I was passionate about. This helped to
enculturate me—a persistent artistic problem with new writers. I also
21st Century Playwriting 397
translated German radio plays, and thereby got to know a vastly dif-
ferent dramatic aesthetic from the local scene in Australia. Naturally,
I also wrote radio plays which were broadcast on public radio, which
allowed me to work closely with actors who taught me a great deal
about how to write for them.
2. Be able and willing to diversify. Who says you are only a playwright?
,QP\YLHZDQGH[SHULHQFHSOD\ZULWLQJLVWHQWLPHVDVKDUGDV¿OP
ZULWLQJ:LWK¿OPWKHKDUGWKLQJLV¿QGLQJDSDUWLFXODUµDQJOH¶WR
the story which makes it both acceptable, (because it’s already half-
familiar) and yet new (via one or two truly ingenious plot twists.) Or
as Hollywood says, “Make it new—but not too new.” Another hard
WKLQJLV¿QGLQJWKHVL[RUVL[W\PLOOLRQGROODUVWRDFWXDOO\PDNHWKH
¿OP7KHUHDUHPRUHIDFWRUVLQYROYHGRIFRXUVH:K\D¿OPLVRQ
balance, easier to write than a play is a fascinating and enlighten-
ing subject, but sadly beyond the scope of this book. (Other than
WRVXJJHVWWKDWD¿OPLVDJUHDWO\DVVLVWHGDQGHYHQFRFUHDWHGE\
RWKHUPHGLDIRUH[DPSOHWKHUROHRIPXVLFLQPRGHUQ¿OPLVKXJH
DQG E ¿OP¶V JUHDWHU UHOLDQFH RQ UHDOLVP DQG LI \RX¶YH UHDG WKLV
book closely, you’ll know that stories which UHÀHFW social reality are
easier to write than stories which symbolise that reality.) I say this,
of course, without wishing to down-play the extraordinary narrative
DFKLHYHPHQWRIPDQ\¿OPV
3. So write your play, then forget all about it for a while. Go and write
WKDW¿OPLGHD\RX¶YHKDGIRUWZR\HDUV2UWKH79VLWFRP2UWKH
UDGLRSOD\2UWKH¿UVWQRYHO%HWKHRQHLQWHQZKRDFWXDOO\IROORZ
through with their plans, dreams, ideas and pipe-dreams. Write it.
Just do it, with or without sports shoes.
4. Choose exciting but realistic initial goals. To help you turn a pipe-
GUHDPLQWRDVHULRXVFUHDWLYH¿UHVWDUWZLWKRQHRIWKHVHSURMHFWV
• 7KHVKRUW¿OP+HUH\RXKDYHWRVLWLQ¿OPVFKRROFDIHWHULDV
and learn to pitch by interesting student directors in your idea.
Have a two-minute verbal spiel, a two-page summary of your
story, a run-down of the characters, and a great twist to the plot.
Appeal to the ambition of work-hungry directors who will
KXVWOHWKHLUZD\LQWRRQHRIWKHPDQ\VKRUW¿OPFRPSHWLWLRQV
with your script. But keep the copyright and ownership of it.
• 7KHIHDWXUH¿OP$V,MXVWLQGLFDWHGWKHFUXFLDOWKLQJKHUH
is the idea and its narrative execution; that particular piece
398 7ංආඈඍඁඒ'ൺඅඒ
6. Work for the theatres you wish to write for. I was a very incompetent
theatre usher for a time, and got to see A Doll’s HouseWZHQW\¿YH
times in a row. If Quentin Tarantino can work in a video store, you
FDQZRUNLQVRPHIURQWRIKRXVHFDSDFLW\7KHER[R൶FHZLOODOVR
JLYH\RXDJRRGIHHOIRUWKHSXEOLF¶VVRXOLQDOOLWVPDJQL¿FHQWÀDZV
and occasional imperfections.
7. Get professional. Put “Writer” on the passport. Get your WGA mem-
bership card or join New Dramatists or whatever is thriving in your
area. In other words, join whatever writing associations you can. Put
your hand up for whatever the script development organisations are
R൵HULQJ*HWWKHVFULSWVRIWZDUHWKDWWKHSURIHVVLRQDOVXVH-RLQLQ
the strikes, meetings, boycotts and other agit-prop lobbying that the
Guild may ask for, so that the conditions you write under get better.
There’s a lot of work to be done.
I’ve probably seen almost as much American theatre outside the USA
as within its borders, so in at least one sense I’m an expert in ‘What type
of American theatre travels well, and succeeds internationally’. I’m not
talking about the Broadway musicals which are increasingly designed
and manufactured by corporate concerns. If you are lucky enough to
hold stock in one of those companies that create mass-market musicals,
I wish you well. But that is not what I’m talking about here. I’m talking
about the plays that are mostly the product of a unique, single imagination
(a.k.a. the playwright.)
Generally, the American plays that speak to international audiences,
don’t do so because of the actual stories they tell. It’s not just about ‘a
great story’. In fact, the story is almost an ‘excuse’ to create a certain type
of spatial and imaginative tone (or tonality). It is my view that the magic
of internationally successful American plays relates to four principal nar-
UDWLYHWRQHVHDFKRIZKLFKFUHDWHVDSDUWLFXODUDQGVSHFL¿FVSDWLDOWRQH
I list these four types below.
In each of the types, you’ll notice that I use the word “enchanted”.
7KLVZRUGUHTXLUHVH[SODQDWLRQ0\GLFWLRQDU\GH¿QHVWKHZRUG³HQFKDQW´
DV ³WR FKDUP GHOLJKW HQUDSWXUH RU EHZLWFK OLWHUDOO\ RU ¿JXUDWLYHO\´
The most successful American plays coax their audiences into an almost
complete belief in the narrative world that the characters belong to. It’s a
state of grace, a fantasy; a type of Paradise-on-earth that audiences long
to enter and feel they ‘belong to’. But that’s not the only type of enchant-
ment that is possible.
But such optimistic states are not the only type of enchanted world
available to you, as an American playwright.
But perhaps the greatest master of the central image that lifts a play
out of its familiar, melodramatic or banal milieu is Henrik Ibsen.
In play after play, a central image lifts the play to a point where the
audience knows it is dealing with the secret mysteries of life. Some-
times the enchanted, symbolic image is a wild duck hidden in the
attic. Other times, the whole household is the image, as in A Doll’s
House. Perhaps Ibsen’s greatest achievement is to make characters
themselves more symbolic than real—and get away with it. Hedda
Gabler, John Gabriel Borkman, or the Rat-Wife in Little Eyolf are
more metaphysical creations than ‘real’. But who said theatre was
a realistic medium? This gives us all a hint: when characters are
¿UVWFRQQHFWHGLQWRWKHLUµPHWDSK\VLFDOLQWHQVLW\¶WKHUHVWIROORZV
naturally. Often we ‘create’ this level last—or more likely, simply
impose it on the play. But what if “to live the ideal life” (as Gregers
Werle says in The Wild Duck) formed our ¿UVWpoint of characteriza-
tion? What would happen? We might end up with an extraordinary,
enchanted character—and a central image for the whole play.
obscenity of the 20th century and its wars and depredations, the
metaphor of ‘the infernal’ is vigorous and hysterical enough to be
a suitable artistic response to our recent history. But the Gothic
also acts as an appropriate human response to life’s puzzles and
pain, especially when experienced by a group that knows nothing
of the 20th century—the young. To young people, the Gothic is
the principal aesthetic response to the madness of growing up
in our complex civilisation. The Gothic—best understood as an
infernal, pessimistic and nightmarish vision of human life—is
more than a consoling fantasy for life and its troubles. It’s very
exciting as a narrative world in itself. In the last thirty years
young audiences in particular, in various media have adopted it
as a type of banner of identity: when life is mad and inexplicable,
there’s less to explain, and a lot to enjoy.
I hope it’s clear from this example what a Temporary Certainty is.
New information brings about a new situation. With each new situation or
certainty, the audience thinks to itself, “Oh, so that is what’s really going
on. Now I understand!” But the audience’s certainty about the situation
is only temporary, because the next piece of new information changes it
yet again. The audience then re-settles into the new situation—until the
next round of information changes the situation again...
See it like this: Character A plays a card (say an 8 of Spades). So
Character B plays a Ten, which tops the 8 card. Character A looks defeated,
EXWLW¶VDEOX൵KHSXOOVRXWD.LQJRI+HDUWVRQO\WR¿QGWKDW&KDUDFWHU
B tops this with a superior Ace.
As I discussed in Chapter 21, the Temporary Certainty and Phase
:ULWLQJWHQGWRZRUNWRJHWKHU6SHFL¿FDOO\WKH\FRPELQHLQWKLVZD\D
phase is a series of ‘beats’, but it is dominated by a single driving impulse:
for example, “to put even more pressure on the other character”, or “to
lull her into a false sense of security”.
Most phases have a Phase Climax (usually new and surprising in-
IRUPDWLRQZKLFKVLJQL¿FDQWO\FKDQJHVWKHVLWXDWLRQ,Q0DFKLDYHOOLDQ
21st Century Playwriting 407
plotting the rule is this: the character who has the secret knowledge holds
the power. New Information creates both the new Temporary Certainty
as well as the climax of the old phase, and the response to this new infor-
mation helps to drive the next phase—until still more new information
changes that as well.
)RU UHDVRQV RI NLQGQHVV DQG DUWLVWLF FRPUDGHVKLS QR VSHFL¿F SOD\-
wrights or play examples are given here. It is not my intention to name-and-
shame. Theatre is hard enough without artists criticising each other. But I’ve
seen examples of most of the following four types in various regions of the
USA and at American theatre conferences. The plays may receive a local
production, but rarely make it to New York, let alone the big wide world
beyond. Frequently, the plays that are workshopped in those Conferences
tend never to receive professional productions. This is not really the fault of
the Conferences. It usually stems from the technical and cultural immaturity
of the playwright. This immaturity reveals itself in several ways, including
a preference for the following four unsuccessful play types:
“Write about what you know” would have to be one of the most use-
less pieces of writing advice ever given to young writers—and it is given
frequently. The problem with young writers is that they are young and
have much less life-experience than writing often needs. In any case, the
GH¿QLWLRQRIµZKDW\RXNQRZ¶LVYHU\XQFOHDU'RHVWKLVOLWHUDOO\PHDQWKDW
you should write only about the family you grew up in, the marriage you
personally lived through, or the only home town you’ve ever really known
well? I prefer the view of the British playwright Howard Brenton who once
told an audience that “Writers should write about whatever excites them
and they personally strongly respond to.” A writer’s need to understand
a world will give her all the ‘knowledge’ she will need. In the USA, this
Familiar-and-Unenchanted play type often appears as a well-meaning work
DERXWDG\VIXQFWLRQDOIDPLO\LQDVSHFL¿FUHJLRQ6DGO\DOWKRXJK)ODXEHUW
said that ‘All great art is provincial’, it’s not enough just to set a play in
a particular province or region; otherwise, all American theatre would be
of the quality of A Streetcar Named Desire. The purpose of Place (a town,
DUHJLRQHWFLVQRWWRUHÀHFWWKDWUHJLRQEXWWRsymbolise it. That is, the
writer has to make that place symbolic of a place in the human imagina-
tion. For example, imagine saying to yourself: “This town my play is set
in resonates with the craziness/loneliness/madness that I feel permeates
408 7ංආඈඍඁඒ'ൺඅඒ
much human life”. A play like that would remind its audiences that the
greatest plays are deep allegories of human experience, inner and outer.
If an audience wanted social accuracy, it would watch a documentary.
The problem of an American play being too familiar or too ordinary is
QRWFRQ¿QHGWRWKRVHSOD\VVHWLQDQ\VSHFL¿FUHJLRQRI$PHULFD,URQLFDOO\
it’s also a problem of many New York-based plays, which assume that
New York is enough of an Enchanted World to be interesting in its own
right. Thus, I’ve seen many plays (some produced, others not) which are
little more than sit-com drafts, but with the ‘allure’ of being about life in
New York. While I love New York as one of the great cities in the world,
it’s not enough for a play just to come from New York. It also should be
EULOOLDQWDQGR൵HUGHHSLQVLJKWVLQWRWKHP\VWHULHVRIWKHKXPDQPLQG
heart and soul. The setting or place becomes the great focusing agent for
that deep examination.
%\µ([RWLF¶,PHDQDZRUOGWKDWLVGLVWDQWDQGGL൵HUHQWLQVRPHZD\
from our own. It might be geographically distant (e.g. a play set in the
tropics or the icy north). It might be from an earlier period (e.g. the 19th
century). A play might be racially, culturally or nationally distant (e.g. a
play about a French rural family). Of course, one person’s exotica is an-
other person’s familiarity. A play set in Alaska might be exotic to a New
York audience—but it’s the norm for an Alaskan (or Canadian) audience.
I’m sorry to criticise this type of play, for it’s often the work of a cultur-
ally ambitious writer—which is very praise-worthy. The desire to examine
a world beyond that of your own everyday world is probably the mark of a
¿QHDUWLVWRQKLVZD\WRPDWXULW\$WKHDWUHZULWHUZKRKDVLPPHQVHFXULRVLW\
is a very good thing. Being interested in other places, other worlds or other
ways of life and thought should be natural and satisfying for a developing
playwright. The problem comes when all the emphasis is on the Exotic at the
expense of the Enchanted. Without the deep allegory—i.e. the feeling that
a particular play is telling us something important about life—the audience
will watch ‘from a distance’. It will watch the characters but not identify with
them. It won’t say “Those characters are me”. Remember that an audience
LVDOZD\VVHO¿VKVRWRVSHDN,WKDVWKHFKRLFHRIHQJDJLQJZLWKDSOD\RU
walking out. Every member of an audience asks herself: “What’s in it for
me, if I engage with this play?” If a play is about ‘those strange people in
that far-away country who have no connection to human life, let alone me’,
then the audience will be reduced to watching; to simply being voyeurs. The
reasons why Exotic plays fail are complex, but I’ll have more to say later
LQWKLVFKDSWHURQZKDW,FDOOWKHµ'RXEOH'LVWDQFH(൵HFW¶)RUQRZ,¶OO
21st Century Playwriting 409
MXVWVD\WKDWWKHSOD\VWKDWDUHYHU\GL൵HUHQWDQGGLVWDQWIURPDQDXGLHQFH
tend to fail because the dramatic language chosen by the playwright fails.
Exotic worlds need more of a metaphysical level to their dramatic language
than most other play types.
This last failed type usually appears when the theme and plotting
is all about business, capitalism and related areas of American life. The
plotting is busy and full of dastardly machinations by characters in sharp
EXVLQHVVVXLWV,QRWKHUZRUGVWKLVW\SHLVUHDOO\DµEXVLQHVV¿OP¶EHLQJ
performed in theatre space. Once again, however, the failure is principally
one of dramatic language, but it’s also a failure of characterization tech-
nique. Plotting alone doesn’t create the special spatial atmosphere we call
‘dramatic tone’. Like all the other failed types, if the dramatic language
LVQRWVXEWO\V\PEROLF¿OOHGZLWKµVRPHWKLQJHOVH¶LQFOXGLQJZRUGVWKDW
reveal a character’s inner life without her knowing it), then all the plotting
in the world will not make up for the lack of a dramatic language with its
own mysterious power and inner life.
But how does one create dramatic language that possesses its own
mysterious power and inner life? Many years ago, as a beginning play-
wright, I asked myself the same question—because no one else I asked
seemed to know.
410 7ංආඈඍඁඒ'ൺඅඒ
7KLVLVWKHFUXFLDO²DQGGL൶FXOW²TXHVWLRQWKDWQHHGVWREHDQVZHUHG
Geniuses like Shakespeare and Chekhov understood instinctively how to
create magical, enchanted worlds. The rest of us have to consciously develop
it in our craft. But as I’ve said earlier in the book, a playwright’s develop-
ment is more learned than born-that-way—even in Shakespeare’s case.
Here are ten ways that will help you create a tone of enchantment
in your plays.
1. Unless you are creating demonic or Gothic enchantment, realise that
creating principal characters with a capacity or proven ability to
love is one of the best ways. This may sound sentimental until you
realise that, in Western culture—especially the English-speaking
ones—‘love’ is seen as the doorway to the sense of metaphysical
mystery that creates a feeling of grace and enchantment. Love is not
just sexual or romantic love. In drama, love is closer to a belief that
‘this other person is my Second Self. He/she is that one person in a
thousand who instinctively understands my secret, buried soul that I
keep hidden from all others. But when I am with him/her, something
mysterious, wonderful and imaginatively-freeing is happening.’
5. If you are creating a Gothic world, where dark forces reign, try and
OLQN WKLV E\ VSHFL¿F GLDORJXH KLQWV WR D PRUHRUOHVV conscious
feeling on the part of some or all of the characters that ‘we are in a
type of Hell’. We are ‘cursed’ with knowledge and awareness of our
situation—perhaps the supreme truth that the Expulsion from the
Garden of Eden has to teach us. Or use the motivic writing technique
that I discussed in Chapter 11. I once heard the British writer Shirley
Gee discuss a very useful technique related to motivic writing. She
said that she consciously explored the major key words or ideas of
her play—and then made sure those very words went into the mouths
of every important character in that play she was writing. Thus, a
play about ‘hope’ would have that word (and its variants) used by
every major character in the play. If you use this technique subtly,
the audience will feel a deep philosophical unity to the play without
being aware exactly how that unity is created. After all, this technique
was good enough for Shakespeare. He uses the word “honest” or
“honesty” forty-nine times in Othello, as well as the word “lie” and
LWVYDULDQWVWZHQW\¿YHWLPHV
7. %HIRUHJHWWLQJWRRKHDYLO\LQYROYHGLQSORWWLQJ¿UVWWU\WRSDLQW\RXU
plot in broad emotional and psychological tonal ‘colors’. A direc-
tor once told me of hearing August Wilson discuss plotting in these
terms: “First, throw in some greed,” Wilson said. “Then mix in some
jealousy. Then stir in some betrayal...” If you can see your plotting as
an ‘excuse’ to paint in vivid, intense emotional/psychological colors,
you’ll be helping to create an enchanted world. The director Terry
Clarke once asked a writer friend of mine, “Tell me what your play is
about in four qualitative nouns.” The director was asking my friend to
pin down her play by its spiritual qualities. She answered, “It’s about
hope. Longing. Dread. And fear.” Without realising it, she was already
half-way along the path to creating a metaphysical, enchanted world.
412 7ංආඈඍඁඒ'ൺඅඒ
8. 5HDOLVH WKDW QDUUDWLYH WRQHV KDYH DQ H൵HFW RQ WKHDWUH VSDFH )RU
example, a bitter, claustrophobic and emotionally destructive rela-
WLRQVKLSVKRXOGKDYHWKDWVDPHH൵HFWRQWKHWKHDWUHVSDFHWKDWWKH
audience is watching and feeling. (See next suggestion.)
10. Finally, related to the last point, ask yourself, “What temperature
do I want for my theatre space—at least for this play I’m writing?”
A ‘chilly’ temperature or atmosphere is created not just by ‘cold-
hearted characters’. More importantly, it’s created by a sparse use
of dramatic language, where silence rules more than words. If you
WKHQ¿WWKHVSDWLDOWHPSHUDWXUHWRWKHSV\FKRORJLFDODQGHPRWLRQDO
world that your characters live in, you’ll be very close to getting the
VSHFL¿FHQFKDQWHGH൵HFW\RXZDQWIRU\RXUSOD\
7LPHFUHDWHVDGLVWDQFLQJHৼHFW
*HRJUDSK\FUHDWHVDGLVWDQFLQJHৼHFW
1DWLRQDOLW\FXOWXUHHWKQLFLW\DQGUDFHFUHDWHDGLVWDQFLQJHৼHFW
A play set in a culture or ethnicity far removed from the lived, social
H[SHULHQFHRIWKHDXGLHQFHFUHDWHVDGLVWDQFLQJH൵HFW
When meeting some of the many people who will help you get your
plays produced, always be careful what you say. If you promise to do
something for them (e.g. send them ‘that book we spoke of’, then do it.)
Understand the G-E-E Principle.
Until you are rich and famous—and many playwrights have become
both of those—there is no adequate way to pay people for the help they
will give you along the way; apart from actually paying them. If you are
too poor to pay for some professional help, then you need to understand
what I call the “G-E-E’ Principle, as in ‘Gee whiz!” If a senior or more
416 7ංආඈඍඁඒ'ൺඅඒ
successful artist helps you, then pay them in Gratitude. I’ve often helped
new or struggling fellow writers, only to never hear from them again;
QRWHYHQDQHPDLOWRVD\µ7KDQN\RX¶6XFKDFWLRQGRHVQ¶WR൵HQGPHLW
puzzles me. When a fellow-artist has helped you, this is the beginning
of what you (should) hope is a longer relationship, based on respect and
consideration. Constantly thanking people who help you in your career
or your writing will ensure they keep on doing so.
But that is not the only way you can ‘pay’ people. Paying your
KHOSHUVLQ(QWKXVLDVPLVDOVRYHU\H൵HFWLYH*LYHQWKHFKRLFHEHWZHHQ
spending an unpaid hour helping Writer A, who complains about the
hardships he’s faced and is generally miserable to be with; and Writer
B, who is not only grateful for you spending your time with her, but is
bubbling over with enthusiasm and joy at being able to ‘talk writing’
ZLWK\RX²,¶GFKRRVH:ULWHU%DQ\GD\7KH¿QDOZD\\RXFDQµSD\¶
WKRVHDUWLVWVZKRKHOS\RXLVWKURXJKEHLQJYHU\YHU\(൶FLHQW,I\RX
promise to follow up on something that interested the person helping
you, then have that information emailed to him or her by the next day,
if possible. What you said you’d do, you not only did—but did it with
DGPLUDEOHVSHHGDQGH൶FLHQF\3UDFWLVLQJWKHWULSOHJLIWRI*UDWLWXGH
(QWKXVLDVPDQG(൶FLHQF\LQ\RXUGHDOLQJVZLWKWKRVHZKRKHOS\RX
will have people falling over themselves trying to make your path to
production much easier.
Writers are not natural ‘allies’ to each other; actors, directors and
producers are our real allies. But this does not mean that artistic com-
radeship and generosity should not be applied between writers. Quite the
reverse. Try and make it a principle not to criticise other writers, even/
HVSHFLDOO\LIWKH\ZULWHGL൵HUHQWO\IURP\RX6HQG\RXUZULWLQJµULYDOV¶D
congratulatory note when they succeed. They’ll be shocked, and you’ll
have done something to help reduce their own natural writerly paranoia
and competitiveness. I did this not so long ago with a note to a fellow
ZULWHU²DQGVKHQRWRQO\WKDQNHGPHEXWWROGPHWKDWWKLVZDVWKH¿UVW
time another writer had ever congratulated her.
Ban bad-mouthing & go for the positive.
This is closely related to the previous tip. Lose the ‘chip on shoulder’
& ‘anger toward the world’ because the road to production can be much
longer than you initially realized. Remember this: No one gets what they
think they deserve. That’s life. Full of luck (deserved and underserved).
Grace, generosity and modesty will not only help you cope with the in-
21st Century Playwriting 417
evitable setbacks—they’ll ensure you remain a pleasant, decent person.
7KLVLVDOVRLPSRUWDQW3HUVRQDOO\,¿QGWKDWµ2SHQLQJ1LJKWV¶DUH
not half as much fun as the pleasure I had in writing the play, or the fun
of working with a wonderful bunch of actors in bringing the play to life.
Loving every step is vital. For example, “Today, I have to read that book
that is vital for the political background to the new play I’m writing.”
What could be more enjoyable? Sometimes there will be tasks that are
OHVVWKDQSOHDVDQWEXWHYHQDGL൶FXOWWDVNFDQEHEURNHQGRZQLQWRVWHSV
that make the task more achievable, if not more enjoyable.
Accept that things always take longer than hoped, and you’ll need help
along the way.
Know that your success depends on many others (see the G-E-E
Principle above.) Always remain loyal to the people who helped you
get where you wanted to. It all comes down to what might be called the
First Principle of Artistic Behavior: Be generous to others. Unless you
DUHDJHQLXV1HZVÀDVK7KHUHDUHQRJHQLXVHVFXUUHQWO\DOLYHLQZRUOG
theatre.) Be or become a very pleasant person to be around. It’ll help you
in more areas than just your theatre work. Work on being the best artist
that you can be. And the best human you can be, as well. I’m no saint,
but because I’ve been generously helped to become a good theatre writer,
I’ve decided that fairness dictates that I return the favor and help others
wherever possible. That’s why my personal motto is: “Artists help each
other; the rest are businessmen.” What’s yours?
418 7ංආඈඍඁඒ'ൺඅඒ
I’ve many more career tips, which I discuss in Chapter 33, so I’ll
R൵HUD¿QDOWKRXJKWKHUH5HPHPEHUWKDWDVORQJDV\RXDUHGULYHQE\
DQHHGWRFUHDWHDQGWUHPHQGRXVMR\LQVRGRLQJWKHQ\RXZLOO¿QGDQ
audience—and a market—for your work. But knowing some of the above
PLJKWVDYH\RXWLPHLQ¿QGLQJWKRVHSHRSOHZKRZLOOKHOS\RXUHDOLVH
your dramatic vision—and kick-start your theatre career.
There will be many occasions where the town or city you live in does
21st Century Playwriting 419
not have a theatre company right for the type of work you want to write.
Even—or especially— if you live in the great theatre city of New York,
there’ll be many occasions where you need to meet a wonderful director
ZKRP\RXEHOLHYHZRXOGGRDEULOOLDQWMREDWGLUHFWLQJ\RXUXQ¿QLVKHGSOD\
Some years ago I decided to ‘create’ an American theatre career for
myself. I’d had some American productions, but nothing of extraordinary
note. In Europe, however, I’d had many productions, which I’d done noth-
ing to get. That is because in Europe, due to the government-subsidized
nature of the funding, the arts are run by the artists. In the USA, the vast
phalanx of agents, managers and associated people are a vital part of what
is essentially a commercial theatre. It’s one reason why it helps to have
an (American) manager/agent on your side.
I had none, however. But I set out to get one. I wrote over two hun-
GUHGDQG¿IW\OHWWHUVWROLNHO\DJHQWVDQGPDQDJHUV,UHFHLYHGYHU\IHZ
responses, even though I had a fairly impressive production track-record.
I eventually decided that there was something wrong with the letter itself.
So I rewrote the letter, to look like this:
Dear Ms X,
We haven’t met, but I’m an Australian playwright who has the luck
and privilege of being one of the most internationally-produced
Australian playwrights. I’ve worked with Oscar-winners Geof-
IUH\5XVK&DWH%ODQFKHWWDQGKDYHMXVW¿QLVKHGDSOD\ZULWWHQ
VSHFL¿FDOO\ IRU WKH UHFHQW 2VFDU1RPLQHH -DFNL :HDYHU ZKR
performed it to great success in Sydney, Australia.
I’m currently working on a play for four actors based on the amaz-
ing but little-known true stories of a Jewish man who in the last
days of World War II was taken in by a German couple, who hid
him in their attic. But the amazing twist to this story came when
the couple decided, for economic reasons, to lie to the Jewish
man, and trick him into believing that the War was still continuing.
As soon as I heard about this story I decided that I had to write it.
I think it has huge international potential. I’m going to be in Los
Angeles next month, and was wondering if you had 20 minutes
WREULHÀ\PHHWZLWKPH)URPHYHU\WKLQJ,¶YHUHDGDERXW\RX
I’d be honored and delighted just to meet you.
For your information I enclose a fuller Biog at the end of this letter.
Timothy Daly
420 7ංආඈඍඁඒ'ൺඅඒ
You may have read the above Sell Letter and thought, “Well, that’s
all right for him. He’s worked with these stars. I haven’t!” But a great
Sell Letter can still be written, even if you have very few credits or Star
Connections to your name.
A week later, I got a reply from an extraordinary Los Angeles-based
woman, who soon after became my producing partner. The rest of this story
is still being made. But I hope you can see the point I am making—that it
all depends on what you say in your letter. Let’s examine the ‘structure’
of the Sell Letter I wrote:
Mr X/Ms X,
Paragraph 1: We haven’t met, but .... (in this short paragraph, you put a
combination of Background and Boasting. Sum yourself and your
writing up in the most succinct and impressive way you can, indicat-
ing any prizes, awards, fellowships—anything!—that you’ve won in
WKH¿HOGRIOLWHUDWXUHRUWKHDWUHRULI\RX¶YHDUHDOO\LQWHUHVWLQJMRE
outside theatre, don’t hesitate to mention it, especially if it has some
bearing on the play you’re writing.
Paragraph 2: I’m currently working on a play/story about... (Some plays
and their plots pitch better than others, so choose the most pitch-
able play you have. This crucial second paragraph is the paragraph
that contains the Killer Pitch, the single-sentence summary (or two
sentences at most) that contains something startling, and something
incongruous and/or bizarre.
Paragraph 3: I’ll be in L.A./New York next month. (The aim of this Para-
graph is simple: State what you want from him/her, and indicate how
easy and undemanding their granting of your request is! If you’re only
asking for 10 minutes of their time—that might be possible. If you are
asking them to read—unpaid—a 90-page script, that could mean that
your letter is immediately dispatched to the ‘Too Hard File’—usually
a round, metal container under someone’s desk.)
$¿QDOVXJJHVWLRQ'RQ¶WJRRYHUDVLQJOHSDJH*RRGDQGVXFFHVVIXO
theatre people are busy. A one page letter should contain enough tantalis-
ing information to get their attention.
There will be times when you need to take a big step and go out and
meet someone who is important to your theatre career. Such a request
21st Century Playwriting 421
might be made in your initial letter to them. But if you can get a meeting
with someone on the creative, artistic side of the theatre—in fact, with
anyone professionally connected with the theatre—then try not to belabor
them with the story of your play. (Unless the story is so amazing that your
listeners can instantly ‘see’ the evening you’re interested in creating for
their theatre.) The word ‘interest’ is crucial: Seek to interest them in the
idea behind the play, or your sense of ‘the evening I have in mind’. The
story of your play is simply one aspect of the wonderful theatrical experi-
ence you’re working on giving the audience.
This pre-talk is vital. In some European, British and Australian the-
atres, many progressive theatres will only ZRUNZLWK\RXLI\RXKDYH¿UVW
pitched/discussed/excited them with the concept of the theatre evening
you have in mind. All over the world, theatres that are committed to new
work—i.e. the theatres that will welcome you—are less interested in
µ¿QLVKHG¶SHUIHFWVFULSWV²PRVWO\EHFDXVHWKRVHVFULSWVDUHnot perfect,
and more importantly, even if well-written they are not innately suited to
WKHVSHFL¿FWKHDWUHFRPSDQ\WKH\DUHR൵HUHGWR
Finally, don’t be heart-broken by rejection. If you treat everything in
life— especially creativity, invention and play writing—as a delightful
game, you’ll enjoy the journey toward your artistic goals so much more.
,¶OOKDYHDORWPRUHWRVD\LQWKH¿QDOFKDSWHURQKRZWRHQMR\WKHJDPHRI
Life and Art. But for now, with the next chapter, it’s time to look at how
the theatre industry works from the inside—when they produce your work.
423
&ඁൺඉඍൾඋ
THE MARKETPLACE (II): WHAT TO DO WHEN YOUR PLAY IS
SCHEDULED FOR PRODUCTION
The great day has arrived! You got home from work, threw the keys
down and checked the message machine. There’s a message from someone
connected to Young & Hungry Theatre Company. You’d sent them the
enquiry letter—then the script—so long ago you hardly remember. But
you listen anyway to the message they left. They love the work you sent
them. They ask if you have an agent. They ask you to come in and talk to
them. You are delirious with joy. And why not? You’ve worked hard for the
day when such promising news as this arrived by telephone. (Good News
tends to arrive by phone. Bad News comes usually by post. Or not at all.)
You turn up at the theatre company, trying to keep your palms from
sweating. You meet the company dramaturg, or the Manager, or the As-
VLVWDQW'LUHFWRU7KH\JLYH\RXLQVWDQWFR൵HHVLW\RXGRZQSUDLVHWKH
play, and generally make light conversation (which only makes you more
tense.) In reality, they are waiting for The Person Who Really Makes All
The Decisions to enter the room. This P.W.R.M.A.T.D. (or Artistic Director
IRUVKRUW¿QDOO\HQWHUVDQG\RXWDON7KHGUHDPFRPHVWUXHZKHQWKH3
word (Production) is mentioned. Or the S word. Artistic directors Schedule
work. This means he wants to produce your play in May of next year,
because that’s when the main actor involved can do it (they’ve already
checked that). And without this particular actor, you wouldn’t even be
WKHUHKDYLQJEDGFR൵HHZLWKDQ\RIWKHP
6RWKHGUHDPKDVFRPHWUXH<RXU¿UVWSOD\RUVL[WKLVDERXWWREH
SURIHVVLRQDOO\SURGXFHG<RXU¿UVWFUHGLW$JLJ$WODVW$GUHDPFRPH
true; a fantasy; a home run, all in one! You can’t wait to get home and tell
your mother, your partner, your workmates and your landlord.
I’m not going to ruin the pleasure by listing all that can go wrong from
this moment on—like the Main Actor who takes the traditional theatre
saying too literally, and breaks a leg two days before Opening Night; or
the chosen director who Schedules a mid-life crisis in the small hours
LPPHGLDWHO\SULRUWR\RXU¿UVWGD\RIUHKHDUVDO)RUHYHU\IHDU\RXPD\
have, there is an anecdote where it really happened. I once had an actor
pull out one week before Opening Night of my play The Private Visions of
Gottfried Kellner. The season was saved when my then dramaturg went on
in his place—and gave a wonderful performance—despite almost having
a nervous breakdown in the process. I hope that never happens to you, but
if it does, you’ll realise that’s what theatre is: full of people with highly
424 7ංආඈඍඁඒ'ൺඅඒ
talented, highly sensitive natures who can behave in all manners from the
saintly to the demonic. But, given that most people are not in theatre for
the money, you’re likely to experience behavior that is, at the very least,
highly expert and professional. Often, it’s exemplary.
FINDING AN AGENT
,W¶VWLPHWR¿QGDQDJHQW,QP\YLHZWKHEHVWWLPHWRJHWDQDJHQWLV
when you’re hot and have a hit on your hands. That’s when they make the
call to you. But if that hasn’t happened, the next best situation to be in is
when you’ve written a work that is about to be produced, professionally
or otherwise. The original caller from the theatre company probably asked
if you had an agent. You most probably answered, “I’m about to get one.
I’m meeting a couple next week.” Soon after this conversation occurs,
you should lift the phone and dial the Writers Guild or New Dramatists,
or your playwright friend, and ask for their list of agents.
<RX VKRXOG XVH \RXU ¿UVW SURIHVVLRQDO SURGXFWLRQ DV WKH EDLW WKDW
catches a good agent. The books of some of the longest-established agents
are closed. But they open, from time to time. If they think you’re brilliant
HQRXJKWKH\¶OOGH¿QLWHO\RSHQ%HZDUHRIDWUDS6RPHDJHQWVZLOORQO\
UHSUHVHQW\RXIRUWKHSXUSRVHRIWKDW¿UVWSURGXFWLRQ7KH\WDNHWKHEDLW
but swim away from the hook. You need an agent to assist you in good
and bad times, not one who will simply throw a standard contract at you
and never talk to you again.
When you deal with an agent, you are preparing yourself for a long-
term professional relationship. The crucial word is ‘professional’. Some
younger agents have lots of enthusiasm, but have a lot to learn. On the
other hand, some older agents are tired, and may be about to retire. It’s
best to talk to other writers. Ask who represents them, and what it’s like
being represented by that agency.
Before you decide which agent you’ll go with, however, ask yourself
one question: “Do I need an agent?” The answer to this question depends
on the country. American writers probably need an agent because in the
USA it’s the middle-men and women who run what I’ve already said is
mostly a commercial theatre. Simply getting an Artistic Director’s atten-
tion can call for professional intervention (for example, the agent probably
already knows many Artistic Directors in many cities.)
,Q(XURSHDV,PHQWLRQHGLQWKHODVWFKDSWHULW¶VDYHU\GL൵HUHQWVLWX-
ation. European arts are run by artists; or rather, they are run by Cultural
Politicians. The average Artistic Director of even a small provincial theatre
has often got there as much by her networking and political skills as by
her directing ability. This is not a criticism. It’s just how it works there.
21st Century Playwriting 425
On the other hand, I’ve experienced a great openness in Europe to foreign
artists, especially in France. And they’re not half as anti-American as ru-
PRUZRXOGKDYH\RXEHOLHYH%XWWKHWKHDWUHVFHQHGRHVZRUNGL൵HUHQWO\
there. Artists tend to deal with fellow-artists quite directly, and don’t seem
to hide so much behind a wall of professional protection (management,
secretaries, “Agency Submission Only” etc). But once you’ve got the
GLUHFWRU¶VDWWHQWLRQ\RX¶OO¿QGWKDWWKHDWUHLVDPRVWO\ZHOOUHJXODWHG
industry all over the world. Contracts are quite standard and unsurprising
(thanks to the various Writers’ and Dramatists’ Guilds), and, once you
are known, most theatre companies deal with writers on a personal basis
rather than through their agents. But if you’re getting more than half a
dozen enquiries per week about your plays—any fewer enquiries you
can deal with yourself— the secretarial services of an agent can be very
XVHIXOHVSHFLDOO\ZKHQ¿HOGLQJUHTXHVWVIRUDPDWHXUULJKWVRISOD\V\RX
wrote ten years ago.
When I began writing, one of the main reasons I wanted an agent was
EHFDXVHLWZDVFRQ¿UPDWLRQWKDWI truly was a writer. If you don’t need
VXFKEROVWHULQJWKHQGRQ¶WEHSXWR൵E\DODFNRIDJHQF\UHSUHVHQWDWLRQ
It’s quite common not to have one. At one American theatre Conference
I went to recently, I was the only writer there who had American man-
agement—and I am a foreigner. But many of the writers there had been
produced professionally. For over the years, you’ll develop lots of contacts,
professional and personal relationships that make theatre life and work so
wonderful. And it’s a rare writer in theatre who gets so many productions
WKDWWKHSDSHUZRUNJHWVLPSRVVLEOH%XWLI\RXJHWLQWR¿OPZULWLQJRQWKH
other hand, think again about such Lone Rangering. You don’t just need an
DJHQWIRU¿OPZULWLQJ²\RXQHHGDODZ\HU7KHFRQWUDFWVDUHELJJHUWKDQ
the Bible, so it’s best to get a good entertainment lawyer for such things.
Despite my quibbles, let’s assume that you’re going to get an agent.
The best agent is one with whom you get on personally. You probably
even like her. A good agent should share your belief in yourself and your
talent. But they’re not there to nurse you, or become your best friend. It’s
their expertise in contracts and the marketing of your plays that is of most
importance. You can fall in love later. Especially if, rarest of all, they have
a career plan for you. Nowadays, I don’t have an agent. I have a manager
(and now, almost a friend) who’s also my producing partner. She plans
my career in alignment with my creative impulses.
I’m sure you’ve walked out of a theatre one night, having seen a show
that was mediocre, or worse. You wondered why that play was produced,
426 7ංආඈඍඁඒ'ൺඅඒ
HVSHFLDOO\FRQVLGHULQJWKDW\RXURZQIDUVXSHULRUVFULSWZDVR൵HUHGWR
them and rejected only six months previously. If you’ve already begun to
write plays, you will have experienced the exquisite torture of rejection.
A letter arrives whose very blandness seems to imply, “You are extremely
untalented. Why did you send us your rubbish?”
Rather than develop paranoia and depression, you might be better
R൵WKLQNLQJDERXWZK\VRPHSOD\VDUHSURGXFHGDQGRWKHUVDUHQ¶W+HUH
LVP\8QR൶FLDO/LVW
Most rejected plays are not very good. Nearly all, in fact. Many have
wonderful potential, but most theatre companies haven’t the time (and
some haven’t the interest) to carefully nurture and develop work until
it realises its full potential. If you’re lucky enough to receive an honest
answer (as distinct from a bland pro forma letter), some weaknesses may
be pointed out that you can work on.
You wouldn’t think this might be a problem, but it can be. Indeed, a
play can be too small for the theatre space it’s been written for. At a cer-
tain level of production, and with the most prestigious theatre companies
working in the biggest theatres, their problem is that most work they get
is far too small (in imaginative conception, use of stage or ‘production
values’) for the big theatres they work in. As I’ve implied in this book,
it’s the small thinking and lack of artistic ambition in many playwrights
that is a big factor in today’s problems.
If your work is organically large, and tries to do sensational things in
DELJVSDFHZLWKDFDVWRIWZHOYHWKHQJRIRULW<RXPD\¿QG\RXUVHOILQ
the biggest theatre in your state, with royalties to match. Alternatively, your
ELJFDVWSOD\PLJKW¿QGDSURGXFHULQWKHDFWLQJLQVWLWXWLRQVDQGGUDPD
schools attached to universities who are always looking for large-scale
work for their Third Year students to work on. It helps if you went to a
particular institution and can use the alumnus card in your favor.
The subjective taste of the resident artistic director is both the strength
and weakness of most theatre companies. Personally, I think that the
structure of one supreme, governing A.D. is wrong for healthy theatre,
428 7ංආඈඍඁඒ'ൺඅඒ
but that’s another story. There’s nothing much you can do about this
problem. He’ll either like it, or he won’t. She’ll either fall in love with
your play, or she won’t.
This is where a company says to you, “We really like your play on
the Irish Potato Famine. But we just did a play on that very same subject
last year.” With my part-Irish background, I’d say you can never have too
many plays on the Potato Famine, but many theatre companies disagree.
Here are some other ‘balance problems’ that theatres are wary about:
— not too many one-person shows. (Saves money, but looks cheap.)
— not too many comedies, farces. (Makes the theatre look like an entertain-
ment center or a commercial producer, having nothing to say about
the big issues. Could lose subsidy or benefactors—if it gets any.)
—not too many Jewish plays. (They love theatre, and lots of them go, but
the ideal of theatre artists is to speak to all sectors of the community.)
—not too many serious, social-issue plays (they win awards, but unless
they’re excitingly done, they look like the Discussion Plays that they
often are, and they can often fail to bring an audience.)
—not too many large cast plays. (This will bankrupt all but the biggest
companies.)
²QRWWRRPDQ\RYHUVHDVKLWV%XWWKLVGHSHQGVHQWLUHO\RQWKH¿QDQFLDO
resources of the company. Some are so cash-strapped, they are on a
permanent drip-feed to Broadway and the West End.)
—not too many plays about minorities or poor people that don’t much go
to theatre. (But here, I’m getting satirical; and, in fairness, there are
wonderful exceptions to even this.)
&ඁൺඉඍൾඋ
LIFE IN THE REHEARSAL ROOM: WORKING WITH ACTORS,
DIRECTORS AND DRAMATURGS
Related to this, I’d have to say that the concept of ‘the writer’s vision’
is frequently misunderstood. As a writer myself, I know that the original
vision that gives birth to a new play may be nothing more than a line of
dialogue, or a single image. The originating vision is often useful for
giving you a feel for the tone of your new play, but the work has hardly
EHJXQ6RPHWLPHV\RXKDYHWRH[SDQGTXDOLI\²RUDEROLVK²WKHVSHFL¿F
details of that original image. Of itself, an image doth not a play make.
The real work of play-making has yet to be done.
So let’s get back to our friends—the people who can help us make our
work as wonderful as it should be. It’s quite well known what a theatre
director is. But a dramaturg? It has to be one of the ugliest words in the
dictionary. It’s not even in some dictionaries. But its job is one of beauty.
Put simply, a dramaturg is that person who helps you get the play writ-
ten—or helps you perfect it.
7KHRUHWLFDOO\WKHUHDUHGL൵HUHQWW\SHVRIGUDPDWXUJDSURGXFWLRQ
dramaturg (who may assist in a play’s production); a company dramaturg
(a type of literary manager who reads lots of scripts and makes recom-
mendations to the artistic director.)
But for playwrights, the only dramaturg that matters is the play-
building dramaturg, the one who meets you once a month, and works at
a table with you, scene by scene, as the play gets written. This person was
WKHRQH\RX¿UVWVSRNHWRDERXW\RXUSOD\<RXLQWHUHVWHGKHULQ\RXULGHD
She was excited. You may have got funds to pay her, or she simply did it
because the play sounded so wonderful that she freely gave of her own
time to work with you. (Such saints still exist in theatre everywhere.) You
PHWKHUHYHU\WKUHHRUIRXUZHHNVERXJKWKHUFR൵HHDQG\RXGLVFXVVHGWKH
scenes that you’d written and rewritten. She inspired you with the power
of your own idea. She criticised weaknesses, and went into raptures when
your writing started to make the play soar. She soon got to know your writ-
ing technique, in all its talent, tricks and laziness. In short, she challenged
\RXWREHWKHZRQGHUIXOZULWHU\RXKRSHG\RXZHUH6L[W\¿YHFR൵HHV
ODWHUWKHZRUNLVUHDG\:KHQLW¶V¿QDOO\VFKHGXOHG\RXNQRZKRZPXFK
you owe this woman. With any luck, she’ll be in the programme, and may
¿QDOO\UHFHLYHVRPHRIWKHUHFRJQLWLRQDQGHYHQPRQH\WKDWVKH¶VRZHG
21st Century Playwriting 431
You may be thinking, “But don’t directors do all that anyway?” The
answer, quite simply, is an emphatic “No.” Some used to, especially early
in their careers, and one or two still do. A few directors will spend a lot of
WLPHLQWKHPRQWKVEHIRUHSURGXFWLRQWU\LQJWRKHOSWKHZULWHU¿[SUREOHPV
in the play before it’s too late. Even if they succeed, they usually don’t
enjoy it much. Why should they? Directors are usually not very skilled at
SOD\EXLOGLQJDQGWKH¿[LQJRIVWUXFWXUDOSUREOHPVLQDSOD\$GLUHFWRU¶V
great skill—and most of his training or experience—is in producing a
play that is already complete and wonderful. It is the very completeness
RIWKHSOD\DQGLWVULFKYLVLRQWKDWVRLQVSLUHGWKHPLQWKH¿UVWSODFH%XW
given the laudable culture of promoting new work in the U.S., a lot of
directors are working on a lot of new plays. But they are often not very
good at bringing a new play to perfection.
So, if you’re lucky, you’ll get to work with a skilled dramaturg.
Ideally, a good dramaturg will be a writer himself. If he is not a writer,
then he will have such a knowledge of writing that he can get you out of
problems you’ve written yourself into. At the very least, he will have an
immense knowledge of play structure. (As this book tries to show, most
play problems are structural, but in a complex way, involving an organic
fusing of character, language and form.)
2QDVLPSOHUOHYHOWKHGUDPDWXUJZLOOEHWKDWYLWDOµ¿UVWDXGLHQFH¶
OLVWHQLQJDQGUHDGLQJIRUWKHOLNHO\H൵HFWRI\RXURZQZULWLQJRQWKHDXGL-
ence. The experienced directors and dramaturgs can tell very accurately the
OLNHO\H൵HFWRI\RXUSOD\LWVVWRU\FKDUDFWHUVDQGODQJXDJHRQLWVIXWXUH
audience. They tend to know a lot about acting, too, and can recognise
EDGZULWLQJDPLOHR൵
On a micro-level, the dramaturg will show you how to edit your own
work—or even do some of it for you. I’ve already mentioned that over-
writing is one of the biggest problems in new and developing plays; but
many writers are so inexperienced, or so close to their own work that they
cannot edit their own plays. Every line is ‘precious’. A strong dramaturg
will challenge such self-indulgence.
On a human level, a good dramaturg will encourage you when you
IHHOGRZQDQGWKLQNWKDWWKHSOD\ZLOOQHYHUEH¿QLVKHG7KH\SUREDEO\
like you personally, and think that not only are you talented, but that this
particular play will make an evening of rich and powerful theatre. They
keep you happy, energised and on schedule. Until your belief in yourself
as a theatre artist is very strong, the value of having a trusted adviser-
cum-supporter can’t be underestimated.
Up to eighty or ninety per cent of the problems and challenges of a
play can be solved by ‘table work’, where writer and editor/dramaturg work
periodically on the developing script. Ideally, both will be quite experi-
432 7ංආඈඍඁඒ'ൺඅඒ
Having made your play so wonderful that a director falls in love with
it, and wants to direct it, you can relax for a while, and enjoy your triumph.
It is a triumph, for many more plays are written than are produced. To
have not only written a good play, but a play that excited a director is no
small achievement. Drink two glasses of good wine, then keep working.
You probably achieved your artistic and theatrical triumph because
you understood what a director’s job is, and gave her a script that allowed
her to do the job properly. Let me summarise what a director does. (In
brackets, I will indicate what implications these have for you, as a writer.)
Let’s assume that your play has been scheduled to open in a month.
Current practise gives you between three and four weeks in the rehearsal
room. But that fourth week of rehearsals might be shortened by previews,
dress rehearsal, technical rehearsals (where the actors run through the
play while the lighting and sound cues are perfected). To give you an
idea of what you’re in for, here is a description of the general ‘shape’ of
the rehearsal period, though I should warn you that a rehearsal period can
vary wildly in how the time is used. Every single rehearsal period of my
RZQSOD\VKDVKDGDGL൵HUHQWµÀDYRXU¶DQGXVHRIWLPH7KHIROORZLQJ
therefore, is necessarily general.
This ‘inaction’ used to irritate me. But experience soon taught me that
this was a crucial period for the actors and director. The actors are trying
to link their intuitive responses to the play with all they know about art,
life and theatre. But the director, most important of all at this time, is (as
WKHSOD\ZULJKW1LFN3DUVRQVRQFHSHUFHSWLYHO\SXWLWWU\LQJWR¿QGDQG
communicate the controlling idea of the piece. Not a single ‘message’
but a sense of a dramatic ‘world’ and what laws and principles govern it.
After a surprisingly early lunch, a model of the stage design will be
wheeled in, and the designer will explain how the play will work. All
gather round, staring at a little painted wood, paper and cardboard model.
Most ask a question or two, even you (who has hardly spoken all morn-
ing, being either too nervous, stunned or exhilarated.) You probably don’t
fully understand the set. And the designer has to spend a fair bit of time
explaining why there’s a Doric column in the middle of the living room.
It’s a strange aspect of theatre etiquette that only rarely is the set chal-
lenged. Even those actors who must work with it and who, days or weeks
ODWHUWHOO\RXFRQ¿GHQWLDOO\WKDWWKH\ZHUHKRUUL¿HGDWWKHYHU\VLJKWRI
it. The reason is, of course, that actors, like writers, have little power in
this regard. The design is actually not entirely the stage designer’s. More
usually, it’s the product of a consensus between director and designer, and
much of the challenging and re-designing has already occurred weeks
before the rehearsal—or should have.
6RRQHURUODWHULQWKDW¿UVWZHHNWKHDFWRUVJHWXSDQGVWDUWµPRYLQJ
the piece’. That is, they start walking around, scripts (and sometimes cof-
fee) in hand, getting a feel for how the play works in the theatre space.
If problems have already been detected (following another actors-only
read-through next morning), you may be called aside and shown the
nature of the problem. You give a cheery wave to the actors (some of
whom already seem a fraction less friendly) and rush home to rewrite
the scene in question.
For the actors, however, it’s time for some straight talking. The play
is subjected to much ‘table reading’ (by the actors), much trying out of key
scenes, and much honest appraisal of what seems to be (not) happening.
And since you’re at home, frantically rewriting Scenes Two, Three and
Four-A (2nd Version along with an “Optional 3rd Version which I thought
we might also try”), you won’t hear the rising chorus of anguish— not
least because the director is protecting you. The last thing the theatre
company needs is a Traumatised/Paralysed Writer, who’ll be of no use to
DQ\RQHLQ¿[LQJWKHSOD\
21st Century Playwriting 437
The week thankfully ends, somewhere between guarded optimism
and a growing sense of the work still to be done. Weekend holidays are
cancelled and everyone tries to get lots of sleep. They’ll need it.
Week Two
7KLVLV&ULVLV:HHN,IWKHSOD\LVLQJRRGVKDSHLW¶OOVWLOOEHGL൶FXOW
,IWKHSOD\QHHGVVLJQL¿FDQWUHZRUNLQJWKHVHFRQGZHHNEHFRPHV+HOO
On Earth, even for unbelievers. If the play was ever funny, it no longer
seems so. Repetition killed the laughs days ago. Now, it’s a matter of
actors getting deeply into the nature of the character(s) they are playing
on top of learning the lines—even as you change them. For it’s a sad
characteristic of most new theatre, regardless of the country of origin,
that the ‘World Premiere’ of a play is both a workshop of the play and a
production of it—all in 3-4 pressured weeks. You’ll be there, doing what
\RXFDQPDNLQJFR൵HHEULQJLQJWKHUHZULWHVRUPHUFLIXOO\VWD\LQJDZD\
either because the actors have discovered a way to ‘make the scene work’,
or because it’s too late and/or it’s beyond repair, and “we’re going with
what we have”. The play is already out of your hands.
Perhaps your play was never really ‘yours’ to begin with? As the
originator of a creative vision (or just a story) that eventually became a
play, you know what made you write the piece. But that may not be the
reason the actors and company are producing the work. For a production
is a statement of collaborative intent. Many agendas (see Chapter 5 on
‘Audience’) are at work in the public performance of what was once a
very private, personal story. But don’t complain—unless you’re one of
those rare writers who believes that there’s only one thing worse than not
being produced. For the rest of us, the Production Week is a fascinating
DQGH[FLWLQJSHULRG<RXDWWHQGLQFUHDVLQJO\H൵HFWLYHUHKHDUVDOVOHDGLQJ
up to a ‘Tech Run’ where the play stops and starts so the lighting and
sound cues can be organised. (Advice: Don’t attend these rehearsals unless
VSHFL¿FDOO\UHTXHVWHG7KH\¶UHIUXVWUDWLQJIRUDOOFRQFHUQHGEXWIRU\RX
WKHQHZZULWHU\RX¶OOEHEHZLOGHUHGDQGTXLHWO\KRUUL¿HGE\WKHZD\WKH
subtle elegance and rhythmic poise of your writing is constantly interrupted
by the shouts of people on ladders and in lighting boxes. And don’t expect
words of comfort or praise from these technicians; lighting designers have
theatre’s most phlegmatic sensibilities. They’ve seen everything, literally.
Just be glad that you’ve got such a competent professional to make your
literary dreams look and sound so good.)
438 7ංආඈඍඁඒ'ൺඅඒ
$IWHUWKH7HFK5XQXVXDOO\FRPHVWKH'UHVV5HKHDUVDOZKHUHLW¿QDOO\
looks much like the play you wrote, even if it’s substantially changed in
the rehearsal period (which it probably has). You may have Done Some
Publicity (newspaper, radio interviews) where you practise talking intel-
ligibly about the play. The purpose of publicity is obvious: you’re there
to interest total strangers in spending their money on a ticket to your play.
6RGRQ¶WEHWRRSRQWL¿FDWLQJHVRWHULF²RUVHOIDEDVLQJ0DNHWKHWRQH
of your interview sound a bit like the tone of the play—whatever it is. If
it’s funny, be funny yourself. If it’s bleak, grim or tragic, try and give the
impression that the play is topical/important/based on a fascinating and
provocative paradox/whatever you can think of in the over-lit blur of the
recording studio. Practise talking about the play to your neighbour or his
dog. Prepare notes of key ideas you want to get across in the interview, but
don’t read from them, except for the crucial facts (starting time, address of
theatre etc). But most of all, give some energy to the interview. The world
is already too full of authors who mumble and murmur their way through
interviews and book readings. It’s an odd fact that theatre is an extrovert’s
EXVLQHVVWKDW¶V¿OOHGZLWKLQWURYHUWV0RVWDFWRUVQRWWRPHQWLRQZULWHUV
are introverted. The gestures and exuberant foyer-language are just for
show (pun intended). So if you can learn to sound as fascinating as your
play is, the interview will one day become one of the pleasures of the job.
I’ve learned a few things over the years on how to work—and not
work—with actors. I’ve been privileged to work with some extraordinary
DFWRUV2VFDUZLQQHUV*HR൵UH\5XVK&DWH%ODQFKHWWDQGWZLFH2VFDU
nominated Jacki Weaver amongst them. They’ve taught me much of what
I know about how to write for actors.
Here are some suggestions on how to work and deal with actors when
you’re present at rehearsals.
1. Accept the fact that you are probably the least experienced person
in the rehearsal room. Be professional, friendly, open to ideas—and
don’t talk too much. (More on that below.)
2. Don’t try and coach actors in their parts. In fact, you should rarely
even advise them directly. Talk via the director. Address a concern
to the director— in private, if necessary. Actors can get perplexed if
there are too many cooks working on the stew. Instead of stopping
rehearsals to discuss a problem, simply make detailed notes and go
over them in detail afterwards with the director.
21st Century Playwriting 439
3. Listen to the actors. They are not the enemy. They are paid to help
make your play wonderful. Generosity, energy and big-heartedness
are common attributes of the American actor.
5. /HWWKHDFWRUVXVHWKHLULQVWLQFWVHVSHFLDOO\LQWKH¿UVWIHZGD\V$F-
tors are wonderful at sensing problems—in dialogue, psychology
and the actability of certain passages. Use their radar, then go home
DQGWU\WR¿[WKHSUREOHPV
6. Don’t talk too much, especially in the discussion on your play. You’re
there to listen. You’re not there to defend the work. Analysis of a
problem is not a personal criticism of you. As far as possible, leave
your anxieties at home, and take careful notes of what is said. You’re
there to be objective, especially about your own work. Besides, writ-
ing down detailed notes looks much better than sitting there trembling.
If you lower your head and work the 2B pencil, you might even look
highly professional, no matter how much you’re inwardly quaking.
7. Realise that it’s probably going to be a tough period for all concerned.
Rehearsals of new work are often quite challenging experiences.
Suddenly a scene is found to be unplayable in its current version.
Or a speech is too long. Or a story-twist doesn’t make sense. If this
LV\RXU¿UVWSOD\LW¶VOLNHO\WREHDQDJRQ\HFVWDV\H[SHULHQFHZLWK
SUREDEO\DORWRIWKH¿UVW7KDW¶VEHFDXVH\RX¶UHQRW\HWUHOD[HGHQRXJK
to realise that “It’s just a play”. The fear and egotism of the young
writer emerges: “It’s not just a play. It’s MY play!” Relax. You’ll be
writing more after this.
,W¶V¿QDOO\DUULYHG2SHQLQJQLJKW<RXSXWRQWKHQLFHFORWKHVZDON
in and hope. You watch the show, but can’t tell if it’s any good, as it’s
all a rather numbing experience. You feel like you felt on your wedding
440 7ංආඈඍඁඒ'ൺඅඒ
day, where everyone but you seemed to be having a wonderful time, and
maybe you were too, but you were too dazed to feel it.
You smile and blush your way through opening night. It will be years
before you realise that opening nights are ‘your night’, where the one
person who is most meant to enjoy it is you, the writer. But that lesson
is years ahead.
The pain and pleasure of opening night is nothing to the reviews, how-
ever. It’s an exquisitely torturing experience to open a paper (or nowadays,
WKHSDSHU¶VZHEVLWHDQG¿QG\RXUVHOIDQG\RXUZRUNGLVVHFWHGOLNHDODE
rat. It’s the closest you’ll come to feeling what a politician goes through.
7KHUHLQDIHZFROXPQVLVD¿QDOGH¿QLWLYHMXGJPHQWRQ\RXWKHSOD\
its strengths (if there are any), its faults (there’ll always be those), and
any other details about the evening that you’d rather not have mentioned.
As I said, it’s torture. There’s only one thing worse than opening night
and the reviews. And that’s no opening nights and reviews. We live in a
paradoxical creative world. Writers are intensely private people, but we
work in an industry which needs (no, insists) that the most private inner
world be put on display for the entertainment of the paying public. You
may distance the world from your inner life by, for example, writing a play
that you are less intimately connected to. There is a good chance, however,
WKDWWKLVSOD\ZLOOKDYHQR¿UHDQGQRSRZHU$V,VDLGHDUOLHUWKHEHVW
plays have a need to be written. Your job is to transmute your inner life
into tellable stories. Not direct autobiography, but transformed experience.
Life will give you the experience, but this book, I hope, will give you the
skills to transform that experience into useable theatre craft— and artistry.
441
&ඁൺඉඍൾඋ
21 YEARS—21 LESSONS
At the time of writing this chapter, I’ll have been in theatre for twenty-
one years. To save you making some of the mistakes I made, I’ll give you
a rough summary of some things I’ve learned—about the art, craft, career
and aesthetic politics of writing—over the last two decades. Naturally, for
HYHU\µOHVVRQ¶WKHUH¶OOEHDQH[FHSWLRQRUTXDOL¿FDWLRQEXW,KRSHPRVWRI
the following precepts ring true, or that your own experience has proven
a glorious exception:
1. You cannot control your career; you can only control the growth of
your art.
No one can really control the growth of ‘reputation’, for reputa-
tion is mostly what others think of you. And reputation largely
LQÀXHQFHVRXUFDUHHUV:KLOH\RXFDQDWWHPSWWRLQÀXHQFHWKDW
it’s not fully controllable, except by doing great work. Even then,
ZKHQ\RXGRJUHDWZRUNLWFDQVWLOOEHLQVX൶FLHQWO\UHFRJQLVHG
(Talk to actors, if you’re unsure of this.) So the only solution is to
move on, and keep your own artistic development ‘on schedule’.
The growth of how much you learn and when—this is totally un-
der your control. What others think of you and your work, is not.
explicitly tell you what your writing should sound like, feel like
or be like. The problem is even worse for painters and other
visual artists, as their galleries would much prefer them to have
a consistent type of work to sell to the public.
8. $OZD\VWDNHWKH¿UVWSURGXFWLRQR൵HUHG
A decade ago, fresh from the success of one of my plays, the
director I was working with (without telling me) passed on a
SURGXFWLRQR൵HUIURPDPRGHUDWHO\LPSRUWDQWWKHDWUH)HVWLYDO
The director thought “we can do better than Festival X”. So she
knocked it back. To this day, the play has never appeared in that
city, which is a loss for me, if not the city in question.
10. Most plays don’t need to be written; or at least, don’t need to be seen.
Related to the previous point, in the absence of a fashionable
ÀDYRXURUFRQWHPSRUDQHLW\WR\RXUZRUN\RXFDQDOZD\VJRIRU
444 7ංආඈඍඁඒ'ൺඅඒ
14. You can’t make a living from theatre… You can only make a killing.
So goes the old theatre saying. It’s true and untrue at the same
time. My rough estimate (based on experience) is that you need
DJRRGVROLGµKLW¶HYHU\\HDUVRUVRWRVWD\¿QDQFLDOO\YLDEOH
Otherwise, it’s up to your ingenuity—and frugality. Personally,
I’ve always tried to choose work that helped me grow artisti-
cally—for example, teaching, script analysis, working for public
radio by providing radio plays, radio features and translations
of works that I loved and knew were enriching me as a creative
artist.
lucky breaks.”) So get ready for those lucky breaks and know
that the world will make room for your success just as it did for
mine and countless others.
&ඁൺඉඍൾඋ
BECOMING A SUCCESSFUL ARTIST
,W¶VWLPHZHGH¿QHGDOLWWOHPRUHSUHFLVHO\MXVWZKDWµVXFFHVV¶LVIRU
an artist working in contemporary theatre.
The First Level of Success consists in actually carrying out the intention
of writing. If I had a dollar for every person, from the plumber to my
neighbour the poet, who told me they’d “love to write a play”, I could
take several of the Rockefellers out to dinner and come home with
spare change. In other words, those who actually start writing have
already achieved more than many who simply dream about doing it.
As the shoe ad says, “Just do it”. You’re never ‘ready’ to start. Only
starting will help to make you ready.
The Second Level of Success consists in ¿QLVKLQJwhat you started. Now,
sometimes there is a good reason for abandoning a work midway
WKURXJK%XWHYHQWXDOO\VRPHWKLQJKDVWREH¿QLVKHGKRZHYHUURXJKO\
and tentatively. Even if there’s a touch of self-delusion (where you
forget for a moment the long weeks of redrafting that will be involved.)
The Third Level of Success consists in revising what you thought you’d
¿QLVKHGIt was the 19th Century Irish playwright Dion Boucicault
who said that “Plays are not written, they’re rewritten.” The thought
that a play is often rewritten numerous times might be depressing to
consider, until you realise several things: a) you are doing what you
love; b) the work is getting better; and c) on Opening Night, none
of it will matter. Remember that the true form of your play often has
to be discovered—in the actual writing itself. No amount of scene
breakdowns or plot options can replace the act of trying the new ideas
out in fully (re-)written scenes. In my own case, I often feel like a
blood-hound on the scent, and that I’m closer to catching the elusive
hare with each foray into the writing wilderness. I once sealed a play
commission by a single answer: To the question, “Are you a quick
writer?”, I replied, “No, but I’m a quick re-writer.” And that’s the
truth: each re-write is quicker than the last.
The Fourth Level of Success consists in sending your work ‘out there’. If
Erle Stanley Gardner, the creator of the Perry Mason series, could
21st Century Playwriting 451
collect over three hundred rejection letters, then, out of sheer self-
respect, we should be trying to gather at least half that number. For
a while in my own career, I could only measure my progress by the
increasing generosity of the rejection letters.
The Fifth Level of Success consists in writing more than one work. I once
met a young writer who had sent his work to the best theatre company
in his home state, and was waiting to hear back. The answer seemed
a long time coming, so I suggested he “Start work on Opus 2”. He
UHSOLHG³,¶PRQO\JRLQJWRZULWHDVHFRQGSOD\LIP\¿UVWLVSURIHV-
sionally produced.” I’ve not heard of the writer since. My aim was
QHYHUWRKDYHP\¿UVWZRUNSURGXFHGor else. My aim was to live a
life of creative delight by working in theatre, in any way possible. In
some cases, I’ve ‘trashed’ whole plays for the chance to work with an
actor I admired. In one case, I knew that he would drastically distort
my original vision of the work, but the chance to watch his acting at
close range was irresistible. That way I learned so much about the
intricate and intimate dynamics of the one-person show I was writing
for him, the ‘loss’ of my original conception of the play was well worth
LW%HVLGHV,NQHZ,KDG¿IW\SOD\VLQPH<RXKDYHWRR,¶PVXUH
The Sixth Level of Success consists in being produced by a group containing
no more than one member of your immediate family. In other words,
when you are being produced by almost anyone/any group, no matter
how ‘amateur’, student or non-union, then you have already reached a
level of success that the ‘wannabes’ of this world can only dream of.
The Seventh Level of Success consists in being produced by a recognised
professional theatre company. Incidentally, by the time this happens,
the ecstatic novelty of “A Life in the Theatre” may have long-since
ZRUQR൵,¶YHEHHQSURGXFHGDOORYHUWKHZRUOGEXWWKHRQO\JHQXLQH
XQFRQWUROODEOHH[FLWHPHQWFDPHIURPP\YHU\¿UVWSURGXFWLRQ$IWHU
that, it was either ‘business’, or just deeply satisfying and pleasurable
(which is easier on the nerves anyway.) In any case, I think our aim
should be to love what we discover ‘on the page’, because loving the
act of writing is important—if we wish to keep writing.
The Eighth Level of Success consists in being produced outside your re-
gion. Everywhere I travel, whether in the USA, Australia or Europe,
there is a strong level of ‘regional protectionism’, whereby local
writers are encouraged and even protected. All other factors being
HTXDOLWLVWKHORFDOZULWHUZKRZLOORIWHQEHSURGXFHG¿UVW7KLVLV
important and good, but when that same local writer wishes to be
SURGXFHGRXWVLGHKHUKRPHUHJLRQVKHZLOO¿QGWKDWWKHVDPHIRUFHV
452 7ංආඈඍඁඒ'ൺඅඒ
that promoted her career will now be working to block it. For every
region has its local writers who deserve support ahead of the out-of-
town newcomer, no matter how good she is.
1. Get famous. Theatre is a social event that loves the frisson of the
new, and the “hot”. Become a name that people recognise. This is
one solution, but it’s not necessarily the best. For a start, you don’t
have a lot of control over your career. So many other factors are at
play. But there’s an even better way than simply ‘setting out to get
famous’. It’s where you set out to become an extraordinary artist.
Doing this might give you access to the second solution...
2. ,QHYHU\UHJLRQ¿QGVRPHRQHZKRFDQEHDQDGYRFDWHIRU\RXDQG
your work. In an ideal world, this would be your agent, but agents
are not always the best advocates for your work. My own experience
is that an agent will respond to the career you currently have; but a
manager will help you plan and actually achieve the career you most
want. Additionally, depending on which country you’re wanting to
work in, fellow-artists are sometimes much better at helping you in the
GLUHFWLRQ\RX¶UHZDQWLQJWRJR6R¿QGWKHGLUHFWRUZKRVHFRPSDQ\
you enjoy, and whose aesthetic you (mostly) share. Let them do the
lobbying for you. You should concentrate on writing brilliant plays.
4. +DYHVRPHWKLQJWRR൵HUWKHQHZUHJLRQVWDWHFRXQWU\WKDW\RXZDQWWR
work in. Get your local theatre to work on exchange seasons (involv-
ing your work), or sharing productions. Let the theatre professionals
talk to each other, while you do what you do best—write. But if neces-
sary, go to the new region yourself and start talking to fellow artists.
BECOMING AN ARTIST
Theatre is hard. You have to love doing it. Love getting it right. It’s
not a career, it’s a calling. It’s not a phase of life, it’s a way of life. Lots
454 7ංආඈඍඁඒ'ൺඅඒ
,ඇൽൾඑ
A.
Abigail’s Party 117
Absent Friends 275
Absurd Person Singular 113, 264
Acting Wave 161,215
Actor 206, 207
Actors, Acting 35, 43, 52, 56, 69, 76, 77, 136, 138, 141, 151, 158, 160,
169, 183, 187, 190, 199-206, 208
A Doll’s House 43, 82, 98, 103, 104, 213, 234, 272, 277, 377, 399, 403, 410
Adverbs 217
Aesthetic, developing your own 12, 15, 17, 18, 24, 26, 35, 46, 144, 170,
176, 182, 302, 339, 356, 427
After the Fall 323
Aftershocks 115
Agents 419, 424, 425, 444, 445, 452
Angels in America 184, 192, 380
After the Fall 323
A Hard God 113, 162
Albee, Edward 117, 232, 245, 377
Allen, Woody 122, 126
A Lie of the Mind 138
A Life in the Theatre 115
A Lie of the Mind 138
A Life in the Theatre 115
Amadeus 114
A Man For All Seasons 264
Ambiguity 128, 156, 282, 446
$PHULFDQ%XৼDOR97, 116, 275, 404
American Days 114
American reality 412
456 7ංආඈඍඁඒ'ൺඅඒ
Amphitheatre 85
A Mouthful of Birds 169
and a nightingale sang 113
An Enemy of the People 21
Angels in America 184, 192, 380
Annie Hall 122, 126
Antony and Cleopatra 82, 114
Arcadia 264
Archer, William 104
Aristotle 276, 328, 339
A Streetcar Named Desire 232, 264, 402, 407
Artaud, Antonin 22
Arturo Ui 283
As You Like It 116
A Tuscan Funeral 263
Auburn, David 403
Audience 13, 15, 16, 17, 18, 21, 23, 24, 25, 30, 31, 36, 38, 40, 42, 67-50,
51-68, 73, 75, 78, 79, 80, 81, 82, 84, 85, 87, 89, 93, 94, 95, 99, 105,
107, 116, 119, 127, 128
August, Osage County 361, 377, 404
Australian theatre 11, 241, 351, 421
Avignon Festival 453
Ayckbourn, Alan 20, 21, 82, 113, 114, 116, 135, 230, 264, 275
B.
Bach, Johann Sebastian 305
Back of the Throat 375
Ball Boys 115
Balodis, Janis 113
Bartholomew Fair 112
Basic Instinct 262
21st Century Playwriting 457
Beckett, Samuel 24, 31, 40, 72, 94, 135, 167, 169, 174-176, 179, 182,
227, 305, 344, 369, 453
Beethoven 264
Beethoven, Ludwig van 23, 305
Benefactors 113, 150, 282
Bennett, Alan 182
%HUNR൵6WHYHQ
Biedermann and the Arsonists 183
Blanchett, Cate 12, 419, 438
Bliss 264
Bochert, Wolgang 86
Border 117, 404
Breaking The Code 264, 375
Breaking the Silence 114, 215
Brecht, Bertolt 18, 22, 24, 84, 221, 283
Brigadoon 402
Brighton Beach Memoirs 113
British theatre 16, 20, 58, 63, 72, 142, 194, 200, 206, 232, 241, 333, 351,
360, 375, 400, 402, 408, 411, 421, 447
Brittanicus 234
Brown, Paul 115
Browne, Francis Fisher 246, 247
Buried Child Syndrome 234, 278
Butley 228, 232, 333-335
C.
Cage, John 59
Caine, Michael 225, 413
Caravan 114
Career 11, 16, 119, 354, 380, 383, 393-399, 416, 419, 421, 425, 441-447,
449-453
458 7ංආඈඍඁඒ'ൺඅඒ
D.
Dada 22
Dags 113
Damiano, Daniel 113
Dancing at Lughnasa 31, 66
Daniels, Sarah 115
Danny and the Deep Blue Sea 31
Daphnis and Chloé 263
Day of the Dog 113
Dead Heart 82, 117
Dead Man’s Cell Phone 376
Death and the Maiden 377
Death of a Salesman 82, 114, 117, 303, 304, 374
'H¿QLQJZDQW
Delblanc, Sven 25
Derrida in Love 140, 147
Derrida, Jacques 22
Detective shape in novels 275-276
Detective shape in plays 277-278
Dialogue 23, 39, 43, 77, 81, 119-131, 133-165, 167-185, 204-206, 254,
288, 327, 365-366, 388, 390, 411, 430, 439
Dialogue directions 151-154
460 7ංආඈඍඁඒ'ൺඅඒ
E.
Earth Spirit 369
Edgar, David 115
Editing 392, 431
Edmond 82, 137
Edson, Margaret 381
21st Century Playwriting 461
(JOR൵(OL]DEHWK
Einstein 113
Elisha, Ron 113
Emerald City 100, 114, 188, 234, 234, 279
Emotion 47, 52, 53, 56, 57-58, 60, 63, 64, 66, 69, 70, 71, 76, 78, 90, 92
Empathy 238, 332
Enchantment 399-405, 409-413
Endgame 343
Endings 36, 87, 92, 108, 111, 221, 285, 288, 305, 320, 321, 327, 333-337,
351, 362, 363, 381, 410
Entertaining Mister Sloane 93
Equus 98, 112, 229, 350, 402
Ethics 278-280, 322, 365
Existential spectrum 223
Expressionism 22, 339
F.
Family 31, 67, 88, 92, 93, 97, 116, 171, 231, 256, 271, 282, 328-330,
376, 377, 407, 408
Fantasy 48, 54, 60, 64-65, 221, 239, 240, 242, 262-263, 293, 401
Fatal Attraction 251, 262, 368
Fatboy 360
Faustian bargain 111, 114, 231
F-Buttons 47, 62-68
Fear of Flying 368
)HDWXUH¿OP
Feelings-life (of a character) 63, 218
)HL൵HU-XOHV
Fergusson, Francis 347-348
Feydeau, Georges 114
Fifty Shades of Grey 368
462 7ංආඈඍඁඒ'ൺඅඒ
Film 18, 22, 26, 33, 40, 42, 43, 44, 46, 57, 61, 64, 65, 79, 84, 86, 98, 103, 11,
122-123, 126, 159, 181, 185, 214, 221, 232, 271, 278, 280, 296, 341,
369, 370, 388, 395, 396, 397, 398, 399, 409, 424, 433, 442, 445, 454
Film dialogue 122-123, 159, 168
First draft 319, 390-391
Fishgirl 264
Fitzgerald, F.Scott 45
Fixed-set play 80, 113,
Flaubert, Gustave 328, 407
Fool for Love 82
Formalism 126, 144, 162, 178, 180, 185, 195
Fornès, Maria Irene 22
Fragment writing 305-313
Frayn, Michael 112, 113, 150, 282
French theatre 15, 16, 84, 171, 382, 412, 447, 453
Frenzy (F-Button) 66, 138, 363,
Frenzy 264
Freud, Sigmund 19, 22, 222, 306,
Freytag, Gustav 246-247
Friel, Brian 31, 66
Frisch, Max 183
Furious 264
G.
Gallasch, Keith 211, 234, 278
Gardner, Erle Stanley 451
G-E-E principle 414-415, 416
Gee, Shirley 411
Generational writing 355-372
German theatre 16, 26, 67, 72, 136, 369, 400, 447, 453
Glengarry Glen Ross 93, 94, 102, 106, 112, 210, 211, 285, 291-295, 316,
21st Century Playwriting 463
374, 405
God of Carnage 15, 372, 412
Gorky, Maxim 30, 112, 115, 116, 275
Gothic 67, 278, 351, 356, 361, 362, 364, 403, 404, 409, 410, 411
Gow, Michael 113
Gray, Simon 112, 115, 232, 245, 275, 333
Gray, Spalding 182
Grenfell, Joyce 182
Guindi, Yusef El 375
H.
Hall, Katori 380
Hamlet 65, 70, 71, 93, 94, 99, 101, 138, 176, 195, 221, 222, 228, 249,
270, 276, 315, 316, 350, 365
Hampton, Chrisopher 114, 232, 377
Handke, Peter 72, 172-173, 367
Happy Days 344
Hastings, Michael 113, 115
Heartbreak House 115
Heaven Knows 262,
Hedda Gabler 71, 93, 106, 128, 163, 229, 232, 403
Heightened language 70-71, 150-151, 195
Hibberd, Jack 116, 117, 129, 197
Holmes-Watson principle 211
Hotel Sorrento 97
How the Other Half Loves 82
Huis Clos 30, 115, 250
Humanism 17-26, 144, 167, 339, 361
Hutton, Arlene 195
Huxley, Aldous 370
Hwang, David 378
464 7ංආඈඍඁඒ'ൺඅඒ
I.
Iceberg principle 191, 290
Ideas for plays 42
I Dream Before I Take the Stand 195-196
Imagistic writing 148-150, 151, 261, 265
Inge, William 278
,QVLJQL¿FDQFH263-264
International market 16-17, 67, 188, 200, 237, 372, 376, 381, 399-409, 447
Interval 95, 228, 315-317, 355
Ionesco, Eugène 50, 93, 167, 305, 335, 343
,:DVDQ,Q¿QLWHO\+RWDQG'HQVH'RW132
Ibsen, Henrik 21, 22, 24, 40, 43, 80, 93, 94, 98, 103-104, 112, 114, 160-
161, 212, 213, 229, 241, 272, 349, 350, 377, 403
J.
John Gabriel Borkman 82, 114, 403
Jonson, Ben 112, 225, 283, 415
Journalistic topicality 366, 380, 387, 446
Joyce, James 22, 345
Juice 264
Julius Caesar 40, 71, 73, 93, 98, 114, 228, 246, 263, 274
Jumpers 137, 183
Jung, Carl Gustav 22, 222, 228, 393
K.
Kafka Dances 11, 115, 178, 265, 345, 378
Kane, Sarah 20, 127, 135, 169, 193, 343, 360, 364, 365, 441
Kaufman, George S 114
Kaufman, Moisés 115, 381, 392
Kenna, Peter 113, 162
King Lear 21, 65, 87, 88, 89, 91, 93, 147, 305, 322, 329
21st Century Playwriting 465
Kushner, Tony 184, 192, 380
L.
/D*UDQGH%RXৼH243
Language notation 151
Leigh, Mike 117
Lettice and Lovage 264
Letts, Tracey 404
Leyner, Mark 143
Liberal Anxieties 373-380
Life and Limb 162-163
Life X 3 372
Lifehouse 190
Linear writing 18, 22, 95, 201, 272, 299, 306, 347, 389
Link words 155, 159
Lists 162-163, 169
Litany 147
Little Eyolf 403
Little Murders 80, 117
Lloyd George Knew My Father 263
Long Day’s Journey Into Night 116, 215-217, 282
Loot 264, 280
Love in a Cold Climate 265
Lulu 369
Luv 114, 264
M.
0%XWWHUÀ\378
Macbeth 99, 100, 116, 200, 202, 232, 246, 316, 318, 319, 349, 350,
405-406,
MacDonald, Donald 114
466 7ංආඈඍඁඒ'ൺඅඒ
Mackerel 80
Major Action 91, 95-97, 229, 315, 318
Mamet, David 40, 62, 82, 94, 112, 115, 116, 127,128, 129, 134, 137, 139,
160, 223, 254, 285, 287, 290, 291-296, 305, 353, 374, 388
Marat/Sade 265
Marketplace 15-17, 387, 393-396, 399-404
Marlowe, Christopher 114, 415
Masterpieces 115, 230
McDonald, Sharman 113
Metaphysical 57, 89, 141, 150, 161, 176, 178, 202, 232, 250, 261-262,
322-323, 350, 363, 364, 402, 403, 408, 410, 411
Miller, Arthur 15, 16, 22, 24, 40, 61, 105, 113, 114, 117, 127, 232, 239,
277, 278, 303, 304, 323, 404, 414
Miss Smilla’s Feeling for Snow 263
Modernism 15, 16, 17-26, 50, 144, 167-176, 181, 183, 361, 365, 369
Molière, Jean-Baptiste Poquelin 127, 348
Moment writing 33, 43, 103, 105, 128, 147, 149, 156, 251, 256, 272,
288, 306-313
Monteverdi, Claudio 180
Morality 16, 89, 99, 100, 111, 161, 280, 283, 365
Mother Courage 84
Motherhood statements 39, 52, 381-383
Mozart, Wolfgang Amadeus 63, 98, 127, 371, 402
Much Ado About Nothing 211
Multi-linear writing 302-306, 355
Murphett, Richard 181-182
My Vicious Angel 265
Myth 69, 111, 161, 179, 231, 281, 304, 367-370, 374,
N.
‘Night Mother 107
Nagy, Phyllis 115
21st Century Playwriting 467
Narrative disturbance 92-95, 274-275, 315
Narrative form 39, 41, 69, 112, 389
Narrative levels 88,
Networking 415-418
Nicholson, William 113
Noh theatre 346
Norman, Marsha 107, 320
Northern Lights 262
Novel writing 39, 44, 121-122, 123, 126, 128, 231, 276, 395, 396, 397, 433
Nowra, Louis 31
O.
O’Neill, Eugene 30, 116, 215-217, 231, 282
Oakley, Barry 241
Oblomov 243
2GHWV&OL൵RUG
Oedipus Rex 97, 101, 112, 276, 350
Olivier, Laurence 200
One-act play 94, 285
Opening night 395, 399, 417, 439-440, 450
Orton, Joe 239, 280, 383
Osborne, John 63, 174, 178, 226
Oswald, Debra 113
Othello 64, 70, 71, 97, 107, 210, 249, 322, 411
Our Country’s Good 113
Overwriting 156-158, 431, 435
P.
Pandora’s Box 369
Paradise Lost 265
Parallel dialogue 161
468 7ංආඈඍඁඒ'ൺඅඒ
Q.
Quartermaine’s Terms 112, 115, 245, 275
Question in dialogue 131, 140-146, 195
Quick Death 181
R.
Racine, Jean 84, 234, 382
Ransom 264
Realism 60, 65, 116, 126, 127, 134, 151, 158, 178, 188, 194, 196, 221,
249, 361, 364, 366, 397, 409, 444
Reddin, Keith 162
Redemptive states 231-232, 280
Reed, Rex 19
Rehearsal 43, 177, 208, 331-337, 423, 429-430. 434-439
Rejected plays 120, 425-428
Relationship journey 30, 252-253, 255-259
Relatively Speaking 114
R-E-M levels 249-250, 363-364
Repetition 73, 126, 131, 149, 158, 162, 167-169, 441,
Resolution 108-109, 320, 335-337
Reveal 295
Reversal 32, 91, 104-106, 259, 287, 289, 296, 300, 319, 328, 337
Reza, Yasmina 15, 372
Rhetoric 71, 77, 127, 146-148,
Rhythm 43-44, 54, 70, 71, 75, 89, 121, 126, 128, 135, 141, 149, 156, 158,
160, 167-169, 187, 191, 195, 226, 264, 265, 412
Richard III 97, 112, 202
Road 123-127, 140
Rockabye 72
470 7ංආඈඍඁඒ'ൺඅඒ
Romeo and Juliet 66, 71, 93, 95, 108, 134, 168-169, 229
Romeril, John 127, 262
Royal Hunt of the Sun 113
Ruhl, Sarah 376, 402
Russell, Willy 239, 317
S.
Sartre, Jean-Paul 30, 116, 250, 323
Scanlan 116
Scene breakdown 389-390, 397, 450
Scene climax 106, 288-289
Scene contrast 290-291, 297
Scene issue 287, 288, 296
Scene premise 287
Schimmelpfennig, Roland 47, 67
Schisgal, Murray 114
Schönberg, Arnold 413
School for Scandal 98
Season’s Greetings 263
Sell letter 418-421
Serious Money 151, 283
Sets 29, 73, 79-83, 85, 86, 112, 113, 117, 119, 264, 360, 361
Sewell, Stephen 82, 127, 138, 156, 189-190, 262, 288
Shadowland 113
6KD൵HU$QWKRQ\
6KD൵HU3HWHU
Shakespeare, William, also see individual plays 15, 21, 24, 25, 31, 36,
40, 61, 63, 65, 66, 71, 72, 81, 82, 89, 91, 100, 127, 135, 161, 169,
183, 199, 200, 202, 219, 228, 229, 232, 246, 336, 341, 349, 350,
386, 404, 410, 433
Shanley, John Patrick 31, 127, 379
21st Century Playwriting 471
Shaw, George Bernard 247, 383
Shepard, Sam 41, 67, 82, 127, 138, 278, 343, 404, 441
Shirley Valentine 239, 316
Shue, Larry 114
Simon, Neil 16, 25, 113, 114
Simultaneity 154, 182, 340, 346
Six Characters in Search of an Author 115
Sketching your play 94, 306-313, 371, 387-389, 390-391
Sleuth 113, 264
Social realism 60, 81, 127, 150, 178, 187-189, 194, 201, 397, 409
Spatial axis 76-78, 342
Spatial energy 131, 230, 342
Spatial tones 361
Spectrum of possibilities 200, 223, 224-225, 253-254
6SHHFKÀDZV
Speed 98
Starting work on your play 385-391
Starts-to-go-stops technique 298
Status Quo 23, 92, 273, 300, 306
Steiner, George 377-378
Stockhausen, Karlheinz 26, 59
Stoppard, Tom 137, 144, 183, 200, 382-383
Story 18, 23, 24, 30, 38, 39-40, 41, 42, 49-50, 55, 57, 68, 69, 78-79, 89-
109, 111-112
6WRU\GH¿QLWLRQ
Story objective 231
Story shape 91-109
Story types 112-117,
Strindberg, August 22, 24, 136, 182, 183,
Structural models 273-283
Styan, J.L. 87-89, 247
472 7ංආඈඍඁඒ'ൺඅඒ
T.
Taking Steps 113, 264
Tamburlaine 114
7DUWXৼH243, 348
Taylor C.P. 113
Television writing 26, 43, 81, 103, 108, 122-123, 185, 194, 394, 395,
398, 404, 434,
Temporary Certainty 66, 405-406
Ten-minute play 398
Texture 41, 71, 72, 130, 134, 141, 151, 187-197, 291, 295, 339, 366
That Time 135, 169
The American Self 367-370
The Bald Prima Donna 171
The Blind Giant is Dancing 82, 138, 189, 288
The Bourgeois Wedding 263
The Bourne Conspiracy 262
The Caretaker 137
The Cherry Orchard 114, 209, 214, 235, 251, 261, 323,
The Crucible 105, 107, 108, 234, 320, 374, 404, 412, 414
The Don’s Last Innings 117, 161
The Entertainer 174
21st Century Playwriting 473
The Floating World 262
The Glass Menagerie 64, 261, 402
The Government Inspector 112
The Governor’s Family 265
The Heidi Chronicles 115, 174
The Hothouse 115, 174
The Iceman Cometh 30
The Ipcress File 262
The King and I 402
The Laramie Project 115
The Last Tycoon 45
The Lesson 48-50, 93, 335
The Lower Depths 30, 115, 116, 275, 323
The Master Builder 93, 95, 98, 103, 114, 160-161, 231
The Milk Train Doesn’t Stop Here Anymore 261
The Moonwalkers 139
The Mountaintop 380-381
The Mousetrap 50
The Nerd 114
The Odd Couple 114
The Perfectionist 22, 113, 234
The Philanthropist 114
The Picture of Dorian Grey 369
The Portage to San Christobal of A.H. 377
The Previous Woman 47
The Price 113
The Private Visions of Gottfried Kellner 265, 423
The Real Thing 183
The Ride Across Lake Constance 72, 172-173
The Secret Diary of Adrian Mole, Aged 13 3/4 265
The Silent Woman 263
474 7ංආඈඍඁඒ'ൺඅඒ
U.
Uhry, Alfred 114
Ulysses 344-345
Unbalanced texture 141, 192
Uncle Vanya 141, 192
Underwriting techniques 156-160, 204-208
Universalisms 67, 325-333, 336, 370, 372
Ustinov, Peter 182
V.
Valdez Last Frontier Theatre Conference 392
Vampire movies 108, 271, 335, 404
Venus and Adonis 263
Vicarious relationship to audience 18, 25, 52, 54, 253, 271, 359, 376, 413
Volpone 243, 283
W.
Wagner, Richard 23, 108, 121, 231, 305, 342, 349, 369, 415
Waiting for Godot 30, 97, 116, 386
War Horse 16
Wasserstein, Wendy 115, 174
Wedekind, Frank 369
Welcome the Bright World 82
Wellman, Mac 22
Wertenbaker, Timberlake 113
When I was a Girl I Used to Scream and Shout 113, 265
Whitemore, Hugh 264, 375
Who is Harry Kellerman and Why is He Saying These Terrible Things
476 7ංආඈඍඁඒ'ൺඅඒ
Z.
Zeitgeist 367-371, 387
21st Century Playwriting 477
7ංආඈඍඁඒ'ൺඅඒ
Photo by: Maya Perez