0% found this document useful (0 votes)
3K views

Proteins Guided Learning

This document provides information about protein structure. It discusses the primary, secondary, tertiary, and quaternary structure of proteins. The primary structure is the sequence of amino acids in the protein chain. The secondary structure involves hydrogen bonds that cause the chain to fold into alpha helices or beta sheets. Tertiary structure describes how the secondary structures further fold into a three-dimensional shape, influenced by interactions between R groups. Quaternary structure involves multiple protein subunits associating through interactions to form a complete protein, such as the four polypeptide chains that make up hemoglobin.

Uploaded by

Mel Masculino
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
3K views

Proteins Guided Learning

This document provides information about protein structure. It discusses the primary, secondary, tertiary, and quaternary structure of proteins. The primary structure is the sequence of amino acids in the protein chain. The secondary structure involves hydrogen bonds that cause the chain to fold into alpha helices or beta sheets. Tertiary structure describes how the secondary structures further fold into a three-dimensional shape, influenced by interactions between R groups. Quaternary structure involves multiple protein subunits associating through interactions to form a complete protein, such as the four polypeptide chains that make up hemoglobin.

Uploaded by

Mel Masculino
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 17

Name: Jay Jhan Mae B.

Pante
Biomolecules: Proteins
There are four groups of biomolecules, this
activity will focus on PROTEINS.

As you progress through the slides (in order)


and complete tasks and observations that will
build your knowledge and understanding of
proteins.

This image shows the 3D structure of


MYOGLOBIN, which is an oxygen binding
protein found in skeletal muscle tissue.

Describe the molecule myoglobin in 5-10 words.

-protein found in striated muscles


Source: Wikimedia
-helix structure
Commons
1
The myoglobin shown is protein
made from smaller subunits called
AMINO ACIDS.

Move the shapes below to highlight


the amine group (NH2)in blue and
the carboxyl (COOH) in red.

2
The “R” group shown on the diagram refers to a side Source: https://en.wikipedia.org/wiki/Amino_acid

chain. All amino acids have the NH2 and COOH, but
they differ in the R groups. R groups also determine
the chemical and physical properties of the amino acid.

This is the side chain


for an amino acid
called methionine
(met).

Drag the side chain


to the appropriate
position on the
graphic.

Which element in the side chain is most likely


responsible for methionine unique properties?
sulfur
(Drag correct answer) __________
carbon hydrogen
(move the correct answer to the space above.) 3
There are 20 amino acids
Examines the structures, you can click on the
source for a larger version. Based only on
what you see…

What do all amino acids have in


common?

Amino group and carboxyl group

What differs between them?


R group in carbon 2

Source: Wikimedia Commons 4


Take a closer look at these amino acids.
Drag the shape and
resize to identify on
each amino acid the:

Carboxyl Group
(square)

Amine Group
(trapezoid)

R group (oval)

Which one of these is least like the others? Phenylalanine


5
Aromatic Amino Acids (AAA)
Amino acids are classified by their structure and
properties. You may have noticed on the last
slide that tryptophan had a ring in its structure.
These are called aromatic amino acids.

Tryptophan is also called an essential amino acid


because humans cannot synthesize it, and
instead must obtain it from their diets.

The image shows another aromatic amino acid,


histidine. Place the oval around the aromatic R
group in the compound.

Move this circle, resize if


needed by dragging the edge,
6
Compare valine to serine Valine

Write 1-2 sentences that describe how these


amino acids are similar and how they are different.
Use specific vocabulary to describe the molecules.

Amino and carboxyl groups are comparable.


Valine has a side chain with a nonpolar R group,
while Serine has a polar R group with an alcohol-
derived hydroxyl on it.

Serine
When the R group contains a hydroxyl, it is
considered to be polar because it can make
hydrogen bonds with other groups. Polar
molecules are hydrophilic (water loving), Which
of the two molecules is hydrophilic?

Serine

7
The diagram shows the reaction that
makes a DIPEPTIDE by combining two
amino acids - dehydration synthesis.

Where does the water molecule come


from?

the OH comes from the carboxyl group


of one amino acid and the H comes
from the amino group of the other.

Place the pink square around


the atoms that make the
water molecule in the
reactants.

Place the circle around


the peptide bond in the
dipeptide. 8
Notice that to make this Tripeptide, 2 molecules of
water or created when two peptide bonds are formed.
The bonds form between the C=O and the N.

On polypeptide below, circle


each individual amino acid.
Use copy/paste to make additional circles.
Resize circle if needed.

How many amino


acids are in this
polypeptide?

9
Use the amino acid molecular structure
chart to identify each one on this chain.

Leucine
Cysteine
Tyrosine
Glutamic Acid

amino acid molecular structure chart 10


Each protein has a unique sequence of amino acids, this is
called its PRIMARY structure.

These are the 154 amino acids found in myoglobin.


Each of the 20 amino acids is represented by a letter.
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKA
SEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVL
QSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Use the chart to name the first four amino acids in the myoglobin
protein primary structure.

Methionine (Met), Glycine (Gly), Leucine (Leu), Serine (Ser)

11
A protein chain will fold into a SECONDARY structure due to hydrogen bonds.
There are two basic configurations: beta sheet and alpha helix.

How many hydrogen bonds are shown in the beta sheet? 8

How many amino acids are shown in the beta sheet? 16

How many hydrogen bonds are shown in the alpha helix? 6


How many amino acids are shown in the alpha helix? 10
12
The next type of protein structure is the TERTIARY structure, the pleat or
helix folds into a 3 dimensional shape.
Complete the table below describing each
of the four types of bonds involved in
protein folding in the tertiary structure.

Type of Bond Description

Hydrophobic Amino acids orient toward


center to avoid water

Hydrophilic Amino acids point toward


Interactions water

Ionic interactions Charged R groups bond


together

Hydrogen bonds Hydrogen and highly


electronegative atoms attract

Confused? Check out this video:


https://youtu.be/hok2hyED9go?t=224
13
Source: Wikimedia
Myoglobin is an example of a tertiary
structure. It consists of 154 amino acids.

Check out the 3d version of myoglobin that can


be manipulated to get a better view:

https://proteopedia.org/wiki/index.php/Myoglobin

There are no beta sheets in myoglobin. How 8


many alpha helices are present in myoglobin?

Compare the 3d model to the picket fence


model, what is the identity of the orange Iron(Fe)
structure in the middle of the 3D model?

14
Many proteins have a QUATERNARY structure which
consists of more than one amino acid chain.
Hemoglobin, a protein found in blood has the
function of carrying oxygen. It is made of
multiple polypeptide chains. Each chain has
a HEME group, which has iron. Heme groups
are indicated on the image in green.

Count the heme groups to determine


many polypeptide chains are needed 4
to build one hemoglobin protein:

A single change in an amino acid in


one of these sequences leads to
blood cells that have the wrong Sickle Cell Anemia
shape. What disorder is this?
Source: https://en.wikipedia.org/wiki/Hemoglobin
If you don’t know, click here. 15
Complete the chart comparing the different protein structures:

Structure Bonds or interactions Description

Primary Peptide bonds between Single chain of amino acids

Secondary Peptide bonds + H-bonds Chain is folded into alpha helix


or beta pleated sheet

Tertiary Peptide bonds H bonds Secondary protein folds into a


Disulfide 3D shape based on R group
hydrophobic interactions
hydrophilic interactions
ionic

Quaternary Peptide bonds H bonds 2 or more tertiary proteins


Disulfide come together
hydrophobic
hydrophilic interactions
Ionic

16
Compare the myoglobin protein (top) to the hemoglobin
protein. Use specific terms from this exercise in your
description. How are they alike and how are they different?

Both proteins are consisting of amino acids. Peptide bonds


hold amino acids together. And both interact with R groups
to fold into their shapes. Hemoglobin appears to contain
more amino acids and is bigger than Myoglobin.
Hemoglobin is quaternary structure (4 polypeptides), and
Myoglobin is tertiary structure(1 polypeptides).

17

You might also like