Notices

233 -- 358/23
T & P Notices in Force

ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 04
26 January 2023
(Published on the ADMIRALTY website 16 January 2023)

CONTENTS

I Explanatory Notes. Publications List

II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services

For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: [email protected]
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: [email protected]
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: [email protected]
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2023. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
[email protected]
 I

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS

ON THE UKHO WEBSITE

The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
admiralty.co.uk/msi or the searchable NM Website www.ukho.gov.uk/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.

NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.

Software required:

Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website (www.adobe.com).

SEARCHABLE NOTICES TO MARINERS

Enter the www.ukho.gov.uk/nmwebsearch website and select the search option that you require
following the on screen instructions:

ƒ Search NMs by - Chart Number only

ƒ Search NMs by - Chart Number + Previous NM Number/Year
ƒ Search NMs by - Chart Number + Between Previous and Present Dates
ƒ Search for Single NM by NM Number/Year

To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.

NOTICES TO MARINERS ON-LINE

Enter the admiralty.co.uk/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List

FURTHER GUIDANCE NOTES

For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
ƒ File content and description
ƒ PC and printer specifications

CUSTOMER SERVICE

If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:

Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: [email protected]

Our Singapore team can also be contacted outside of UK hours on:

Tel: +65 6424 4200

Wk04/23 1.2
 ,

ADMIRALTY NOTICES TO MARINERS

7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10% LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH8.+27KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ  RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ 5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\

:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV

7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV

Planning for the future

Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.

Admiralty Way, Taunton, Somerset

TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
[email protected]
gov.uk/ukho

Find out more about our market-leading

ADMIRALTY Maritime Data Solutions:
admiralty.co.uk

and are trademarks of the Secretary of State for Defence

© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.

 Wk04/23
 I

EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as
this is held in greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon
information will be removed from new editions of each Sailing Direction volume, and AIS and Racon information present in
existing Sailing Direction volumes will no longer be updated. For accurate, up-to-date information on AIS and Racons, refer
to ADMIRALTY Radio Signals publications.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.

Wk04/23 1.4
 ,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV

 Wk04/23
 I
[04/23]
ADMIRALTY Charts affected by the Publication List

ADMIRALTY Charts ADMIRALTY Charts International Charts ADMIRALTY Publication

138 DE 31 INT 1202 NP 83

847 DE 43 INT 1231 NP 284(4)
869 DE 44 INT 1242
871 INT 1311
889 INT 1357
956 INT 1358 Erratum
1118 INT 1452
1183 INT 1561 1B Quarterly Pubs Wk52/22 – NP42C
1557 INT 1727
1901 INT 1777
1902 INT 1855
1967
2018
3567

ADMIRALTY Paper Chart SUNSET WITHDRAWALS

Charts to be withdrawn 20 APRIL 2023

8002 8092 8156 8219

8006 8101 8157 8232
8007 8121 8175 8233
8010 8124 8176 8277
8011 8125 8177 8284
8012 8126 8215 8285
8015 8127 8216 8297
8016 8152 8217
8054 8153 8218

PAPER CHART SUNSET

The UKHO has announced its intention to withdraw from paper charts by the end of 2026. This
decision has been taken to allow us to focus on our digital navigation products and services that meet
the needs of today’s and tomorrow’s seafarers.

The withdrawal of paper charts will be done in a phased approach over a number of years. Charts
withdrawn will be announced in this bulletin in advance.

We will provide more information in this bulletin as we begin the process.

For more information about our decision, timetable, and the impacts, please visit
https://www.admiralty.co.uk/sunsetting-paper-charts

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk04/23 1.6
 I
CHANGES TO REMAINING PAPER CHARTS

As the UKHO withdraws charts, as part of its sunset of paper charts, you should note the following;

1. We will not add detail from withdrawn charts to omission of detail areas on remaining smaller
scale charts.
2. Remaining ADMIRALTY paper charts may not provide suitable scale charting for your
purposes.
3. You are encouraged to obtain and use the best scale charting available for your purposes. These
may be charts produced by local hydrographic offices. Please consult your Distributor for more
information.

UKRAINE NAVIGATIONAL INFORMATION

Owing to insufficient information, it is not always possible to ensure that ADMIRALTY Nautical
Publications are completely up-to-date for new dangers or changes to aids to navigation.

Mariners are therefore advised to exercise particular caution when navigating in Ukrainian waters.

BALTIC SEA CHART DATUM 2000 (BSCD2000)

UKHO Products and Services, including foreign charts, in the Baltic Sea region are changing to a
new vertical reference system for depth and height information. During this transition period,
Charts may be referred to either mean sea level or the new BSCD2000. For further information
please contact the national charting authority and see ADMIRALTY Sailing Directions.
This note is to be reviewed in 2026.

PHOTOGRAPHY
ADMIRALTY publications utilise imagery from a wide variety of sources, mariners, port authorities and
other users. The UK Hydrographic Office (UKHO) welcomes new imagery of navigational aids,
landmarks, coastline, approaches to and from ports and berths. Imagery from the mariner's point of view
is especially helpful. Images can be sent to the UKHO using the email [email protected].
Please include the name and location of the feature in the image and how the image should be accredited
within ADMIRALTY publications.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.7 Wk04/23
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW ADMIRALTY CHARTS AND PUBLICATIONS

Reproductions of German Government Charts published 26 January 2023

Chart Title, limits and other remarks Scale Folio 2023 Catalogue
page

DE31 International Chart Series, Baltic Sea, Germany and Denmark, Rødbyhavn to 1:50,000 10 34
INT 1357 Dahmeshöved.
54° 11’·50 N —54° 40’·60 N., 011° 00’·00 E—011° 34’·00 E
Fehmarnsundbrücke (Fehmarn Sound Bridge). 1:12,500
54° 23’·50 N —54° 24’·50 N., 011° 06’·20 E—011° 07’·30 E

A new chart providing increased coverage of the Fehmarnbelt between

Germany and Denmark. (Published jointly by the UKHO and the
Hydrographic Office of Germany). This chart is included in the International
Chart Series.

DE43 International Chart Series, Baltic Sea, Germany and Denmark, Gabelsflach to 1:50,000 9 32
INT 1358 Fehmarnsund (Fehmarn Sound).
54° 17’·60 N —54° 37’·50 N., 010° 16’·50 E—011° 06’·80 E
A Heiligenhafen. 1:6,000
54° 22’·20 N —54° 22’·81 N., 010° 58’·75 E—010° 59’·65 E
B Entrance to Heiligenhafen. 1:12,500
54° 22’·00 N —54° 22’·90 N., 010° 58’·75 E—011° 02’·00 E

A new chart providing coverage of Gabelsflach to Fehmarnsund. (Published

jointly by the UKHO and by the Hydrographic Office of Germany.) This chart is
included in the International Chart Series.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk04/23 1.8
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 26 January 2023

Chart Title, limits and other remarks Scale Folio 2023 Catalogue
page

138 China - Hainan Dao, Xiuying Gangqu. 1:10,000 47 76

Includes significant safety-related information as follows: changes to depths,

coastline, channel limits and wrecks.

Note: On publication of this New Edition former Notice 4456(P)/22 is

cancelled.

847 International Chart Series, Sweden - East Coast, Norrköping and 10 36

INT 1231 Approaches.
A Approaches to Norrköping. 1:25,000
B Norrköpings Hamn. 1:15,000
C Continuation at Same Scale. 1:25,000

Includes changes to depths, dredged areas and buoyage. (A modified

reproduction of INT1231 published by Sweden.)

Note: On publication of this New Edition former Notices 3104(P)/22,

3139(P)/22 and 112(T)/23 are cancelled. This chart remains affected by
Notice 1433(T)/22.

889 International Chart Series, Sweden - East Coast, Väddö to Öregrund. 1:50,000 11 36
INT 1777 A Continuation at same scale. 1:50,000
B Öregrundsleden. 1:25,000
C Granön. 1:25,000
D Hallstavik. 1:12,500
E Östhammar. 1:12,500
F Öregrund. 1:12,500
G Hargshamn. 1:12,500

Includes changes to depths. (A modified reproduction of INT1777 published

by Sweden.)

Note: This chart remains affected by Notice 2510(T)/22.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.9 Wk04/23
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 26 January 2023 (continued)

Chart Title, limits and other remarks Scale Folio 2023 Catalogue
page

1118 International Chart Series, Spain - North West Coast, Ria De Ferrol. 1:10,000 18 40
INT 1855 43° 25’·50 N —43° 29’·49 N., 08° 22’·83 W—08° 15’·45 W

Includes changes to depths. (A modified reproduction of INT1855 published

by Spain.)

Reproduction of German Government Chart

Chart Title and other remarks Scale Folio 2023 Catalogue

page

DE44 International Chart Series, North Sea, Germany, Entrance to River Elbe. 1:50,000 9 32
INT 1452 Cuxhaven. 1:12,500

Includes changes to depths. (Published jointly by the UKHO and by the

Hydrographic Office of Germany.)

ADMIRALTY Publication

NP No. Title and other remarks Date Remarks

NP83 ADMIRALTY List of Lights and Fog Signals. 12/01/2023 Updated to Week 50/22
Volume K 3rd Edition 2023. First Updates in NM Week 04/23
Western Pacific Ocean, South of the Equator Volume K Edition 2 2022 is
Including Bismarck, Solomon, Coral and Tasman Seas cancelled.
ISBN Number: 978-0-70-772-4560

NP284 ADMIRALTY List of Radio Signals. 26/01/2023 Updated to Week 48/22 (01/12/22)
Meteorological Observation Stations First updates in NM week 04/23
Volume 4 4th Edition (2023). (26/01/23)

ISBN Number: 978-0-70-774-7385

The 3nd Edition (2022) of N284
is cancelled.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk04/23 1.10
 I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 09 FEBURARY 2023

New Editions of ADMIRALTY Charts

Charts to be 2023 Catalogue
Chart Title, limits and other remarks Scale WITHDRAWN Folio page

869 International Chart Series, Sweden - West Coast, Hunnebostrand to 1:50,000 869 10 32
INT 1311 Uddevalla and Gullholmen. INT 1311
A Malö Strömmar. 1:25,000
B Smögen and Kungshamn. 1:25,000
C Strandanäs. 1:25,000
D Uddevalla. 1:15,000
E Lysekil, 1:15,000
F Strömmarna. 1:10,000

Includes changes to depths, aids to navigation, marine farms, notes

and legends. (A modified reproduction of INT1311 published by
Sweden.)

871 England - South Coast, Rivers Tamar, Lynher and Tavy. 871 1 22
A River Tamar, Cargreen to Calstock. 1:12,500
B River Tamar, Calstock to Gunnislake. 1:20,000
C River Lynher. 1:20,000
D River Tavy. 1:20,000

Includes changes to depths from the latest British Government

Surveys.

956 International Chart Series, Sweden - East Coast, Gävle and 1:25,000 956 11 36
INT 1242 Approaches. INT 1242
A Holmuddsrännan. 1:12,500
B Gävle. 1:12,500
C Skutskär. 1:12,500

Includes changes to depths, swept areas and buoyage. (A modified

reproduction of INT1242 produced by Sweden.)

1183 International Chart Series, England - East Coast, Thames Estuary. 1:100,000 1183 7 24
INT 1561 INT 1561
Includes changes to depths from the latest British Government and
Port of London Authority Surveys.

1557 South China Sea, Gaolan Liedao, Zhuhai Gang Gaolan Gangqu. 1:20,000 1557 47 78

Includes significant safety-related information as follows: changes

to depths.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.11 Wk04/23
 I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 09 FEBURARY 2023

New Editions of ADMIRALTY Charts (continued)

Charts to be 2023 Catalogue
Chart Title, limits and other remarks Scale WITHDRAWN Folio page

1901 International Chart Series, England - South Coast, Plymouth Sound, 1:5,000 1901 1 22
INT 1727 Smeaton Pass and The Narrows. INT 1727
Continuation of Cattewater. 1:5,000

Includes changes to depths from the latest British Government

Surveys and amendments to maintained depth areas.

1902 England - South Coast, Plymouth, Hamoaze. 1:5,000 1902 1 22

Continuation of Ernesettle Pier. 1:5,000

Includes changes to depths from the latest British Government

surveys.

1967 England - South Coast, Plymouth Sound. 1:7,500 1967 1 22

River Plym. 1:15,000

Includes changes to depths from the latest British Government

surveys and other surveys.

2018 International Chart Series, Baltic Sea, Ystad to Öland and Stilo. 1:250,000 2018 10 34, 36
INT 1202 INT 1202
Includes changes to depths, submarine cables and pipelines, lights,
obstructions, restricted areas and notes . (A modified reproduction
of INT1202 published by Sweden.)

3567 North Atlantic Ocean, Føroyar (Faroe Islands) Northern Part. 1:100,000 3567 15 38

Includes significant safety-related information as follows: new

marine reserves and changes to larger scale chart limits, lights and
submarine cables.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk04/23 1.12
 I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

138 China - Hainan Dao, Xiuying Gangqu. 138

847 International Chart Series, Sweden - East Coast, Norrköping and Approaches. 847
INT 1231 INT 1231

889 International Chart Series, Sweden - East Coast, Väddö to Öregrund. 889
INT 1777 INT 1777

1118 International Chart Series, Spain - North West Coast, Ria De Ferrol. 1118
INT 1855 INT 1855

DE44 International Chart Series, North Sea, Germany, Entrance to River Elbe. DE44
INT 1452 INT 1452

ERRATUM

NM Weekly 52/22, Section 1B - CURRENT NAUTICAL PUBLICATIONS (Updated to 29th December 2022)

Page 1B-1, (1) Current Editions of ADMIRALTY Sailing Directions

NP 42C shows edition date 6th (2022), this edition date should read 6th (2020)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.13 Wk04/23
 IA
TEMPORARY AND PRELIMINARY NOTICES
In Force 20 January 2023

(Former In Force List dated 16 December 2022 is cancelled)

Cancelled Notices

Area Notice No.

2 2762(P)/21, 2939(P)/21, 312(T)/22, 1075(T)/22, 2915(T)/22, 3254(T)/22, 3378(T)/22, 5187(P)/22
3 4973(T)/16, 1031(T)/19, 4314(P)/22, 4330(P)/22
4 3740(T)/19, 2997(T)/21, 5339(P)/21, 5475(T)/21, 2624(T)/22, 3104(P)/22, 3139(P)/22, 4096(P)/22, 4370(T)/22,
4485(T)/22, 4791(T)/22, 4855(T)/22, 107(P)/23, 112(P)/23
5 1264(P)/22, 3108(T)/22, 3428(T)/22, 3938(T)/22, 4964(T)/22
6 3404(T)/22
7 4282(T)/22, 5100(T)/22
8 2012(T)/21, 5157(T)/22
11 3693(T)/21, 2646(P)/22, 4156(T)/22, 5156(T)/22
12 5332(T)/19, 4624(P)/22
14 4840(T)/21, 822(T)/22, 2376(T)/22, 3921(T)/22, 4456(P)/22
15 648(T)/22, 1323(T)/22, 2977(T)/22, 3241(T)/22, 4828(T)/22, 5116(T)/22
16 4765(T)/21, 3448(T)/22, 4448(P)/22, 4835(T)/22
17 6183(T)/20, 2139(T)/22, 4725(T)/22, 4799(P)/22, 5206(P)/22
18 3147(T)/21, 3521(T)/22
20 1040(T)/21
21 4795(P)/22
24 393(T)/19, 214(P)/21
25 4701(P)/21
26 4764(P)/22

No. of No- Charts affected Locality & Subject Folio(s)

tice

2. BRITISH ISLES
397(T)/14 2792 ...................... IRELAND, West Coast: Light-beacons; Pontoon.............................................. 4
5111(P)/16 8156 ...................... ENGLAND, East Coast: Landmark................................................................... 8
5048(P)/17 8156 ...................... ENGLAND, East Coast: Landmarks ................................................................. 8
3771(P)/18 871, 1902 ............. ENGLAND, South Coast: Works....................................................................... 1
3869(P)/18 8156 ...................... ENGLAND, East Coast: Jetty; Berth................................................................. 8
4041(P)/18 8156 ...................... ENGLAND, East Coast: Note............................................................................ 8
2900(T)/19 106, 1503, 1504 .. ENGLAND, East Coast: Offshore installation; Works ...................................... 7
4297(T)/19 2388 ...................... SCOTLAND, West Coast: Scientific instruments ............................................. 5
5544(T)/19 2022 ...................... ENGLAND, South Coast: Works; Lights .......................................................... 1
5730(P)/19 2905 ...................... SCOTLAND, West Coast: Works; Pontoons; Dredging area; Reclamation area 5
6271(P)/19 2628 ...................... ENGLAND, South Coast: Maintained channels; Dredged areas; Depths; 1
Works; Jetty........................................................................................................
97(T)/20 3273, 3274 ........... WALES, South Coast: Buoy .............................................................................. 2
445(P)/20 1125, 2667, 2704. IRELAND, West Coast: Submarine cable ......................................................... 4
825(T)/20 1994, 2000 ........... SCOTLAND, West Coast: Pier .......................................................................... 3
1684(P)/20 2011....................... WALES, North Coast: Light; Obstructions; Buoy; Works................................. 3
1755(T)/20 741 ........................ SCOTLAND, East Coast: Wreck....................................................................... 6
3360(P)/20 8156 ...................... ENGLAND, East Coast: Radio reporting point................................................. 8
3728(T)/20 2046 ...................... IRELAND, South Coast: Buoy .......................................................................... 2
3755(P)/20 8156 ...................... ENGLAND, East Coast: Restricted area ........................................................... 8
4224(P)/20 1977, 1978 ........... WALES, North Coast: Depths............................................................................ 3
5185(T)/20 1464 ...................... WALES, North Coast: Wreck ............................................................................ 3
195(T)/21 2036, 2045 ........... ENGLAND, South Coast: Beacon..................................................................... 1

1A.1
Wk04/23
 IA
2. BRITISH ISLES - continued
202(T)/21 2254, 2739 ........... IRELAND, West Coast: Buoy............................................................................ 4
453(P)/21 223 ........................ SCOTLAND, East Coast: Depths ...................................................................... 6
1219(P)/21 30, 1267, 1613, ENGLAND, South Coast: Depths; Drying heights; Rocks ............................... 1
1900 ......................
2077(P)/21 2482 ...................... ENGLAND, East Coast: Works ......................................................................... 8
2466(T)/21 1076, 1482 ........... WALES, South Coast: Buoy .............................................................................. 2
2574(P)/21 1077, 1889 ........... SCOTLAND, East Coast: Works; Quay ............................................................ 6
2581(P)/21 1078 ...................... SCOTLAND, East Coast: Depths; Dredged depths; Works .............................. 6
2612(T)/21 1479 ...................... SCOTLAND, East Coast: Buoy......................................................................... 6
2887(T)/21 2723, 2725, 2752 IRELAND, North Coast: Obstructions .............................................................. 3, 4
2967(P)/21 121, 1190.............. ENGLAND, East Coast: Depths ........................................................................ 7
2991(T)/21 1866 ...................... SCOTLAND, West Coast: Works; Berth ........................................................... 3
3025(T)/21 1838 ...................... IRELAND, West Coast: Buoy............................................................................ 2
3815(T)/21 2845 ...................... CHANNEL ISLANDS, Alderney: Beacon ........................................................ 16
3907(T)/21 219, 1119, 1239, SCOTLAND, Shetland Islands: Light ............................................................... 6
1942, 2182C, 3299
3979(T)/21 222, 1462 ............. SCOTLAND, East Coast: Works ....................................................................... 6
4077(T)/21 2 ............................ CELTIC SEA, Irish Sector: Scientific instruments ............................................ 6
4238(T)/21 2045, 2450 ........... ENGLAND, South Coast: Measuring instruments; Buoyage............................ 1
4681(T)/21 2021, 2035 ........... ENGLAND, South Coast: Works; Buoyage ...................................................... 1
5223(T)/21 1188, 5614_17...... ENGLAND, East Coast: Restricted area; Slipway; Works................................ 2, 7
5224(T)/21 1320, 1826, 5613_1 IRISH SEA: Buoyage; Automatic Identification Systems................................. 2, 3
5234(P)/21 1178, 1410, 1482, WALES, West Coast: Depths ............................................................................. 2, 3
1973, 5621_2 .......
505(P)/22 1840, 5623_6, IRELAND, West Coast: Works; Breakwater; Light-beacon; Light ................... 2
5623_7 ..................
591(T)/22 1951, 5613_4 ....... ENGLAND, West Coast: Buoyage .................................................................... 2, 3
770(T)/22 1951, 1953, 1978, ENGLAND, West Coast: Scientific instruments; Buoyage ............................... 2, 3
5613_3 ..................
798(T)/22 3496 ...................... ENGLAND, East Coast: Pier; Works................................................................. 7
917(P)/22 2126 ...................... SCOTLAND, West Coast: Depths; Rock; Drying height .................................. 3
1072(T)/22 1121, 1411, 1415, IRELAND, East Coast: Buoyage; Automatic Identification Systems ............... 2, 3
1468, 5609_1,
5621_1, 5621_7 ...
1073(T)/22 807, 808, 3140, CHANNEL ISLANDS, Guernsey: Buoyage; Measuring instruments .............. 16
3654 ......................
1076(P)/22 2793, 5600_21 ..... ENGLAND, South Coast: Works....................................................................... 1, 2
1081(T)/22 1981, 5613_8 ....... ENGLAND, West Coast: Perch; Buoy............................................................... 2, 3
1082(T)/22 1121, 1123, 1178, WALES, West Coast: Buoy; Automatic Identification System.......................... 1, 2, 3
2649, 5620_1,
5620_3 ..................
1092(T)/22 1543, 5614_2 ....... ENGLAND, East Coast: Lights ......................................................................... 2, 7
1095(T)/22 1127, 1770, 1778, SCOTLAND, West Coast: Light........................................................................ 2, 3, 5
2169, 2635, 2723,
2724, 5611_1........
1103(T)/22 2793, 5600_21 ..... ENGLAND, South Coast: Buoy ........................................................................ 1, 2
1108(T)/22 1994, 5610_3 ....... SCOTLAND, West Coast: Buoyage .................................................................. 2, 3
1377(T)/22 2041, 5600_10 ..... ENGLAND, South Coast: Buoy ........................................................................ 1, 2
1442(P)/22 8002 ...................... ENGLAND, South Coast: Automatic Identification System; Landmark .......... 1
1471(P)/22 1415, 1447, 1468, IRELAND, East Coast: Buoyage; Works; Channel limits ................................. 2, 3
5621_10, 5621_12,
5621_5, 5621_7 ...
1662(T)/22 807, 808, 3654, CHANNEL ISLANDS, Guernsey: Light-beacon .............................................. 2, 16
5604_10, 5604_9 .
1705(P)/22 1757, 2905, SCOTLAND, West Coast: Depths ..................................................................... 2, 5
5616_10, 5616_25,
5616_26, 5616_9 .
1749(P)/22 2566 ...................... ENGLAND, East Coast: Berths; Quay; Dredging area; Works......................... 7

1A.2
Wk04/23
 IA
2. BRITISH ISLES - continued
1855(P)/22 8002 ...................... ENGLAND, South Coast: Dredged depths........................................................ 1
2038(P)/22 1183, 1406, 1607, ENGLAND, South East Coast: Works; Submarine cable.................................. 2, 7, 8, 9
1610, 1630, 1872,
1873, 1874, 2449,
5605_1, 5605_11,
5606_1, 5606_2,
5606_4, 5607_1 ...
2077(P)/22 2126, 2131, 2220, SCOTLAND, West Coast: Wreck ...................................................................... 2, 3
5610_13 ................
2187(T)/22 2878, 3273, 3274, WALES, South Coast: Buoy; Wave recorder; Obstructions .............................. 2
5620_11, 5620_12
2233(T)/22 2625, 5600_12 ..... ENGLAND, South Coast: Works; Buoyage ...................................................... 1, 2
2352(T)/22 1413, 2011, WALES, North Coast: Wrecks; Buoy ................................................................ 2, 3
5609_12 ................
2356(T)/22 1652, 2450 ........... ENGLAND, South Coast: Buoy; Automatic Identification System .................. 1
2360(T)/22 1864, 2220 ........... SCOTLAND, West Coast: Pier; Works.............................................................. 3
2372(T)/22 2878, 3273, 3274, WALES, South Coast: Buoyage; Wrecks........................................................... 2
5620_11, 5620_12
2441(T)/22 44, 1121, 1411, IRELAND, East Coast: Buoyage; Automatic Identification System................. 2, 3
1468, 5609_1,
5612_24, 5621_1,
5621_18, 5621_5 .
2446(P)/22 2825, 5616_24 ..... SCOTLAND, Hebrides: Works.......................................................................... 2, 5
2519(T)/22 536, 2451, 5605_5 ENGLAND, South Coast: Scientific instruments.............................................. 1, 2
2598(T)/22 2424 ...................... IRELAND, South Coast: Buoy .......................................................................... 2
2636(T)/22 442, 1613, 2454, ENGLAND, South Coast: Pilot boarding places ............................................... 1, 2
3315, 5601_2,
5602_8 ..................
2694(T)/22 146, 1446, 5617_16 SCOTLAND, East Coast: Buoyage ................................................................... 2, 6
2721(T)/22 1077, 1889 ........... SCOTLAND, East Coast: Wind turbine; Light.................................................. 6
2740(P)/22 2, 35, 219, 245, SCOTLAND, Shetland Islands: Works; Submarine cables ............................... 2, 3, 5, 6,7,
1119, 1233, 1234, 15
1239, 1778, 1942,
1954, 2162, 2169,
2171, 2182C, 2207,
2208, 2249, 2250,
2379, 2388, 2562,
2568, 2581, 2584,
2617, 2723, 2771,
3282, 3283, 3284,
3292, 3298, 3299,
4140, 5611_10,
5611_11, 5611_18,
5611_4, 5611_8,
5616_16, 5616_2 .
2747(P)/22 35, 1796, 2126, SCOTLAND: Submarine cables ........................................................................ 2, 3, 5, 6
2131, 2171, 2249,
2568, 5610_12,
5611_13, 5616_14
2835(T)/22 633, 5621_13 ....... IRELAND, East Coast: Outfall; Works ............................................................. 2, 3
2837(T)/22 219, 1239, 1942, SCOTLAND, Orkney Islands: Light ................................................................. 6
1954, 2182C, 2250
2867(T)/22 1462, 5617_18 ..... SCOTLAND, East Coast: Dredging area; Depths; Works................................. 2, 6
2946(T)/22 2566 ...................... ENGLAND, East Coast: Buoy; Wreck .............................................................. 7
3028(T)/22 1934, 5615_20, ENGLAND, East Coast: Works ......................................................................... 2, 7
5615_21 ................
3101(P)/22 871, 1902, ENGLAND, South Coast: Depths; Drying heights; Wreck; Obstructions ........ 1, 2
5602_17, 5602_19
3345(T)/22 35, 2249, 2581 .... SCOTLAND, Orkney Islands: Light ................................................................. 6

1A.3
Wk04/23
 IA
2. BRITISH ISLES - continued
3375(T)/22 1978, 5609_13 ..... WALES, North Coast: Works; Submarine pipeline; Lights ............................... 2, 3
3379(T)/22 1464, 5609_8 ....... WALES, North Coast: Buoy .............................................................................. 2, 3
3381(P)/22 1478, 1482, 1973, WALES, West Coast: Marine farm; Buoyage; Works........................................ 2, 3
5620_7, 5620_8,
5620_9 ..................
3383(T)/22 3282, 3284 ........... SCOTLAND, Shetland Islands: Current meter; Buoy....................................... 6
3555(T)/22 1407, 1409 ........... SCOTLAND, East Coast: Buoy......................................................................... 6
3621(T)/22 2800 ...................... IRELAND, East Coast: Buoy ............................................................................ 3
3682(T)/22 1975, 3741, ENGLAND, East Coast: Wreck......................................................................... 2, 7
5607_3, 5607_9 ...
3766(T)/22 1183, 1491, 1610, ENGLAND, East Coast: Buoyage ..................................................................... 2, 7
2052, 2692, 2693,
5607_2, 5607_4,
5607_5, 5607_6 ...
3777(P)/22 1152, 1176, 1182, WALES, South Coast: Wreck ............................................................................ 2
5608_13 ................
3781(T)/22 1149, 1168, 5603_4 ENGLAND, West Coast: Obstruction................................................................ 1, 2
3875(T)/22 2021, 5600_4 ....... ENGLAND, South Coast: Works....................................................................... 1, 2
3936(P)/22 1820, 2709, 3339 IRELAND, West Coast: Depths......................................................................... 4
4068(T)/22 2208, 5616_15 ..... SCOTLAND, West Coast: Scientific instrument ............................................... 2, 5
4082(T)/22 2036, 5600_13 ..... ENGLAND, South Coast: Works; Buoyage ...................................................... 1, 2
4265(T)/22 2379, 5611_20...... SCOTLAND, West Coast: Scientific instruments; Buoy................................... 2, 5
4290(T)/22 190, 5617_2 ......... SCOTLAND, East Coast: Buoyage; Automatic Identification System ............. 2, 6
4381(P)/22 2625, 2629, 2631, ENGLAND, South Coast: Works; Jetties........................................................... 1, 2
5600_12 ................
4450(P)/22 115, 219, 1119, SCOTLAND, Shetland Islands: Submarine power cable; Works...................... 6, 7
1233, 1239, 1942,
1954, 2182C, 3281,
3283, 3294, 4140
4453(T)/22 3281, 3283, 3294 SCOTLAND, Shetland Islands: Current meter; Buoy....................................... 6
4527(T)/22 1320, 1826, 2010, ENGLAND, West Coast: Buoy.......................................................................... 2, 3
5613_1, 5613_14 .
4535(T)/22 2566 ...................... ENGLAND, East Coast: Buoyage ..................................................................... 7
4647(P)/22 2162, 2581 ........... SCOTLAND, North Coast: Depths.................................................................... 6
4657(P)/22 2022, 2036, 2037, ENGLAND, South Coast: General information ................................................ 1, 2
2038, 2625, 2628,
2629, 2631, 3418,
5600_12, 5600_13,
8002 ......................
4743(T)/22 2171, 2389, 2390, SCOTLAND, West Coast: Measuring instrument; Buoy .................................. 2, 5
5611_15, 5611_9..
4750(P)/22 2500 ...................... SCOTLAND, West Coast: Works; Harbour developments ............................... 5
4754(T)/22 2255, 2268, 5601_8 ENGLAND, South Coast: Works....................................................................... 1, 2
4897(P)/22 2199 ...................... SCOTLAND, West Coast: Submarine cable...................................................... 3
4951(T)/22 2094, 5613_19 ..... IRISH SEA: Wreck; Restricted area .................................................................. 2, 3
4958(T)/22 1237, 2198, IRELAND, North East Coast: Buoy .................................................................. 2, 3
5612_14 ................
5104(T)/22 44, 1411, 5612_1, IRELAND, East Coast: Buoyage; Automatic Identification Systems ............... 2, 3
5621_3 ..................
5167(T)/22 134, 152, 2566, ENGLAND, East Coast: Buoy........................................................................... 2, 7
2567, 5615_4 .......
86(T)/23 2131, 2381, 2382, SCOTLAND, West Coast: Scientific instruments; Buoyage ............................. 2, 3, 5
5610_10 ................
113(T)/23 2209, 2528, 5616_4 SCOTLAND, West Coast: Measuring instruments; Buoyage ........................... 2, 5
195(T)/23 1652, 2045, 2450, ENGLAND, South Coast: Marine farm; Buoyage ............................................ 1, 2
5605_3 ..................

1A.4
Wk04/23
 IA
2. BRITISH ISLES - continued
256(P)/23 2, 219, 245, 1233, SCOTLAND, Shetland Islands: General information ....................................... 6, 7, 13,15
1239, 2182C,
2182D, 3282, 4140
3. NORTH RUSSIA, NORWAY, THE FÆROE ISLANDS AND ICELAND
4644(T)/12 2961 ...................... RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
3336(T)/18 2966 ...................... RUSSIA, Barents Sea Coast: Jetties .................................................................. 14
4351(T)/18 2966 ...................... RUSSIA, Barents Sea Coast: Buoy.................................................................... 14
1959(P)/19 1429, 4101 ........... NORWAY, West Coast: Works; Submarine pipeline; Offshore installation....... 13
4860(T)/20 2683, 4100 ........... NORWAY, North Coast: Buoyage...................................................................... 14
359(T)/21 2683 ...................... NORWAY, North Coast: Buoy ........................................................................... 14
4485(P)/21 2683 ...................... NORWAY, North Coast: Offshore installation................................................... 14
1273(T)/22 2682, 3136 ........... ARCTIC OCEAN: Measuring instruments ....................................................... 14, 15
1859(T)/22 1429 ...................... NORWAY, West Coast: Buoy............................................................................. 13
2567(T)/22 2683, 3137, 4010 NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 14, 15
3259(P)/22 2352, 2683 ........... NORWAY, North Coast: Offshore installation; Submarine power cable; Works 14
4422(P)/22 1427, 1428, 2182D NORWAY, West Coast: Works; Precautionary area ........................................... 13
4526(T)/22 2897, 2901, 2902 ICELAND: Buoyage .......................................................................................... 15
4531(T)/22 2899 ...................... ICELAND: Measuring instruments; Buoyage; Automatic Identification 15
Systems ..............................................................................................................
4943(P)/22 1427, 2182C, NORWAY, West Coast: Submarine power cable; Precautionary area; Works ... 6, 13
2182D ...................
4. BALTIC SEA AND APPROACHES
4859(T)/17 944 ........................ DENMARK, Islands: Leading line .................................................................... 10
3341(T)/18 902 ........................ DENMARK, Islands: Works; Buoyage.............................................................. 10
729(T)/19 2945 ...................... GERMANY, Baltic Coast: Restricted area ........................................................ 10
747(T)/19 894 ........................ DENMARK, East Coast: Submarine pipelines; Buoyage ................................. 10
2822(T)/19 857, 858 ............... SWEDEN, West Coast: Depths.......................................................................... 10
4290(T)/19 2264 ...................... RUSSIA, Baltic Sea Coast: Mooring buoys ...................................................... 11
4460(T)/19 875 ........................ SWEDEN, West Coast: Depth; Maximum authorised draught.......................... 10
6402(P)/19 2014, 2018, 2248, BALTIC SEA: Submarine pipelines .................................................................. 10, 11
2264, 2816, 2817
309(T)/20 2018, 2040, 2288 POLAND: Measuring instruments; Buoyage .................................................... 10
917(T)/20 857, 858 ............... SWEDEN, West Coast: Depths.......................................................................... 10
2602(T)/20 2098, 3864 ........... FINLAND, West Coast: Buoyage ...................................................................... 11
2825(T)/20 2227, 2241, 2248 ESTONIA: Restricted area................................................................................. 10, 11
4144(P)/20 929 ........................ DENMARK, East Coast: Works ........................................................................ 10
4640(T)/20 2241, 2248 ........... ESTONIA: Restricted area................................................................................. 10, 11
5618(T)/20 2227 ...................... ESTONIA: Restricted area................................................................................. 11
5964(T)/20 2218, 3818 ........... FINLAND, South Coast: Spoil ground.............................................................. 11
1502(T)/21 911......................... SWEDEN, West Coast: Restricted area ............................................................. 10
1866(P)/21 2014, 2018 ........... GERMANY, Baltic Coast: Submarine cables .................................................... 10
2011(T)/21 2048, 2054, 2288, LATVIA: Scientific instrument.......................................................................... 10
2816, 2817 ...........
2426(T)/21 923 ........................ DENMARK, Islands: Works.............................................................................. 10
2663(T)/21 2612, 3839 ........... FINLAND, West Coast: Fairways; Swept areas; Buoyage; Recommended 11
tracks ..................................................................................................................
2786(P)/21 2276 ...................... LITHUANIA: Breakwater; Works..................................................................... 10
2921(T)/21 2276 ...................... LITHUANIA: Dolphins ..................................................................................... 10
3082(P)/21 2817 ...................... BALTIC SEA: Submarine cable ........................................................................ 10
3880(T)/21 2843 ...................... SWEDEN, East Coast: Maximum authorised draughts; Berths ........................ 10
3881(P)/21 845 ........................ SWEDEN, East Coast: Works; Lights; Floodlights ........................................... 10
4256(T)/21 2452 ...................... POLAND: Works ............................................................................................... 10
4379(T)/21 2218, 3818 ........... FINLAND, South Coast: Works; Buoyage ........................................................ 11
4671(T)/21 2059, 2816, 2817 ESTONIA: Buoy ................................................................................................ 10
5030(T)/21 2219, 3818 ........... FINLAND, South Coast: Works; Buoyage ........................................................ 11
5052(T)/21 876 ........................ SWEDEN, West Coast: Depth ........................................................................... 10

1A.5
Wk04/23
 IA
4. BALTIC SEA AND APPROACHES - continued
5452(T)/21 2164 ...................... FINLAND, West Coast: Buoyage ...................................................................... 11
5471(T)/21 2106, 2117, 2942. GERMANY, Baltic Coast: Buoy........................................................................ 10
5477(T)/21 2098, 2252, 3800 FINLAND, West Coast: Virtual aids to navigation............................................ 11
5485(T)/21 3440, 3825 ........... FINLAND, Saaristomeri: Buoy ......................................................................... 11
298(P)/22 800, 803, 810 ...... SWEDEN, East Coast: Works; Buoyage; Lights; Depths.................................. 10
780(T)/22 2260 ...................... FINLAND, South Coast: Fairway; Depth.......................................................... 11
791(T)/22 2218, 3818 ........... FINLAND, South Coast: Buoyage .................................................................... 11
792(T)/22 2218, 3818 ........... FINLAND, South Coast: Bridge; Works; Vertical clearance; Horizontal 11
clearance.............................................................................................................
1111(P)/22 2106, 2117, 2942. DENMARK, Islands: Restricted areas; Buoyage; Works .................................. 10
1196(T)/22 2218, 3818 ........... FINLAND, South Coast: Works; Buoyage ........................................................ 11
1433(T)/22 847 ........................ SWEDEN, East Coast: Bridge; Works; Fairway................................................ 10
1672(T)/22 858 ........................ SWEDEN, West Coast: Dolphin; Buoy ............................................................. 10
1864(T)/22 2248, 2264, 3813 FINLAND, South Coast: Scientific instruments; Restricted area...................... 11
2032(T)/22 689, 821, 831, 832, SWEDEN, East Coast: Works; Lights ............................................................... 10, 11
881, 2073 .............
2172(T)/22 940, 2583 ............. DENMARK, Islands: Channel; Buoyage .......................................................... 10
2205(T)/22 2227 ...................... ESTONIA: Restricted area................................................................................. 11
2319(T)/22 938, 2106, 2596 .. DENMARK, Islands: Works; Bridge; Vertical clearance .................................. 10
2351(T)/22 2276 ...................... LITHUANIA: Quay; Works............................................................................... 10
2457(T)/22 958 ........................ DENMARK, Islands: Beacon ............................................................................ 10
2495(T)/22 2637 ...................... POLAND: Dredged area; Works........................................................................ 10
2510(T)/22 889 ........................ SWEDEN, East Coast: Jetty; Works; Buoyage.................................................. 11
2659(T)/22 430 ........................ DENMARK, East Coast: Works; Vertical clearance.......................................... 9
2660(T)/22 940 ........................ DENMARK, Islands: Works.............................................................................. 10
2666(T)/22 2636, 2688 ........... POLAND: Works; Buoyage; Fairway................................................................ 10
2823(T)/22 2018, 2816 ........... POLAND: Buoy................................................................................................. 10
2938(T)/22 2040, 2048, 2288, LITHUANIA: Scientific instruments; Restricted area....................................... 10
2816 ......................
3074(T)/22 2014, 2018, 2040, POLAND: Buoyage ........................................................................................... 10
2288, 2816 ...........
3138(T)/22 810 ........................ SWEDEN, East Coast: Bridge; Works; Horizontal clearance; Channel; 10
Fairway...............................................................................................................
3255(T)/22 902, 903 ............... DENMARK, Islands: Scientific instrument....................................................... 10
3304(T)/22 810 ........................ SWEDEN, East Coast: Works; Submarine pipeline; Buoyage .......................... 10
3353(T)/22 2532, 2942 ........... DENMARK, Islands: Depths............................................................................. 10
3402(T)/22 2620, 3863 ........... FINLAND, West Coast: Swept areas; Maximum authorised draught ............... 11
3411(P)/22 2218, 3818 ........... FINLAND, South Coast: Works; Bridge; Buoyage; Fairway............................ 11
3424(T)/22 3828 ...................... FINLAND, South Coast: Buoy .......................................................................... 11
3431(T)/22 2059, 2816, 2817 ESTONIA: Scientific instruments; Restricted areas .......................................... 10
3435(T)/22 2260, 3813 ........... FINLAND, South Coast: Works ........................................................................ 11
3442(T)/22 2276 ...................... LITHUANIA: Buoyage ..................................................................................... 10
3585(T)/22 2048 ...................... LITHUANIA: Buoyage ..................................................................................... 10
3625(T)/22 3823, 3826 ........... FINLAND, Saaristomeri: Buoy ......................................................................... 11
3907(T)/22 2597 ...................... DENMARK, Islands: Buoyage; Lights.............................................................. 10
4014(T)/22 810 ........................ SWEDEN, East Coast: Works; Bridge............................................................... 10
4110(T)/22 811......................... SWEDEN, East Coast: Works............................................................................ 10
4719(T)/22 2018, 2816 ........... SWEDEN, South Coast: Submarine pipelines; Works ...................................... 10
4788(T)/22 2677, 2678 ........... POLAND: Light; Buoyage ................................................................................ 10
4886(T)/22 2014, 2018, 2040 POLAND: Measuring instruments..................................................................... 10
4954(T)/22 2859 ...................... LATVIA: Buoyage ............................................................................................. 10
4961(T)/22 2073, 2817 ........... SWEDEN, East Coast: Buoy ............................................................................. 10, 11
4963(T)/22 858 ........................ SWEDEN, West Coast: Buoy ............................................................................ 10
5033(T)/22 811......................... SWEDEN, East Coast: Works............................................................................ 10
5050(T)/22 2018, 2040 ........... POLAND: Buoy................................................................................................. 10
5068(T)/22 2082, 2252, 2817, FINLAND, West Coast: Light; Radar beacon.................................................... 10, 11
3803 ......................

1A.6
Wk04/23
 IA
4. BALTIC SEA AND APPROACHES - continued
5095(T)/22 2014, 2018, 2040 POLAND: Works ............................................................................................... 10
5098(T)/22 2688 ...................... POLAND: Measuring instruments; Buoyage .................................................... 10
5106(T)/22 2014, 2015, 2018, POLAND: Measuring instruments..................................................................... 10
2040, 2288, 2636,
2677, 2679, 2688,
2816 ......................
5122(T)/22 2048 ...................... LITHUANIA: Buoyage; Scientific instruments; Restricted area ...................... 10
5123(T)/22 798 ........................ SWEDEN, East Coast: Depths; Swept area ....................................................... 10
5158(P)/22 3800 ...................... FINLAND, West Coast: Fairway ....................................................................... 11
5164(P)/22 3864 ...................... FINLAND, West Coast: Fairways; Depths; Swept areas; Works ...................... 11
5178(T)/22 2211, 3819............ FINLAND, South Coast: Works ........................................................................ 11
28(T)/23 2227 ...................... ESTONIA: Restricted area................................................................................. 11
65(T)/23 2215, 2816, 2817 ESTONIA: Buoyage .......................................................................................... 10
108(P)/23 876 ........................ SWEDEN, West Coast: Maximum authorised draughts .................................... 10
194(P)/23 2218 ...................... FINLAND, South Coast: Recommended track; Maximum authorised draught; 11
Light; Beacon; Light-beacon; Fairway; Depths; Swept areas............................
208(T)/23 810 ........................ SWEDEN, East Coast: Bridge; Fairway; Works; Horizontal clearance ............ 10
221(T)/23 2856 ...................... SWEDEN, East Coast: Maximum authorised draught; Berths; Depth .............. 10
241(T)/23 3828 ...................... FINLAND, South Coast: Buoy .......................................................................... 11
302(T)/23 798, 2055, 2059 .. SWEDEN, East Coast: Measuring instruments ................................................. 10
346(P)/23 800, 802, 803, 810 SWEDEN, East Coast: Buoyage; Lights ........................................................... 10
349(T)/23 820 ........................ SWEDEN, East Coast: Buoy ............................................................................. 10
354(T)/23 870 ........................ SWEDEN, West Coast: Marine farms ............................................................... 12
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM
4360(T)/18 128 ........................ BELGIUM: Moorings ........................................................................................ 9
1038(P)/19 1408, 2182A......... NORTH SEA, United Kingdom Sector: Works; Platform; Obstructions .......... 7
2320(T)/19 323, 1406, 1610, BELGIUM: Wreck; Virtual aid to navigation .................................................... 1, 7, 9
1872, 1873, 2449
1049(P)/20 2182A, 2182B...... NETHERLANDS: Submarine power cable....................................................... 7
2778(T)/20 295, 1427, 1428 .. NORTH SEA, Norwegian Sector: Well ............................................................. 6, 13
4568(T)/20 294, 295, 1427 .... NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 13
1292(P)/21 2182B.................... NORTH SEA, Netherlands Sector: Submarine power cable ............................. 7
2167(T)/21 1872, 1873, 1874, BELGIUM: Buoy............................................................................................... 9
2449 ......................
2490(P)/21 274, 1405, 1427, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Offshore 6, 7, 13
2182C.................... installation ..........................................................................................................
2497(P)/21 274, 292, 1405, NORTH SEA, Norwegian Sector: Submarine cable.......................................... 6, 7, 13
1427 ......................
2831(P)/21 1408, 1633 ........... NETHERLANDS: Wrecks................................................................................. 7, 9
2953(P)/21 1405, 1422, 1427, NORTH SEA: Works; Submarine cable ............................................................ 9, 13,19
4102 ......................
3014(P)/21 8297 ...................... NETHERLANDS: Platforms; Restricted areas ................................................. 9
3182(P)/21 1546 ...................... NETHERLANDS: Obstruction.......................................................................... 9
3799(P)/21 1408, 1504 ........... NORTH SEA: Submarine cable......................................................................... 7
4161(P)/21 1405, 1427, 4140 NORTH SEA, Norwegian Sector: Submarine cable.......................................... 7, 13
4725(P)/21 8012 ...................... BELGIUM: Dredged areas; Dredged depths ..................................................... 9
5190(P)/21 8011....................... NETHERLANDS: Lights .................................................................................. 9
5251(P)/21 292, 1405, 1427, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Submarine 6, 13
2182C.................... cable ...................................................................................................................
5500(T)/21 295, 1427, 1428 .. NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 13
153(P)/22 8010, 8011............ NETHERLANDS: Buoyage .............................................................................. 9
428(T)/22 124 ........................ NETHERLANDS: Buoyage .............................................................................. 9
447(T)/22 295 ........................ NORTH SEA, United Kingdom Sector: Platform; Chains and anchors ............ 6
660(T)/22 125, 1408, 1631 .. NETHERLANDS: Wells; Obstruction............................................................... 7, 9
762(P)/22 8012 ...................... NETHERLANDS: Virtual aids to navigation .................................................... 9
887(P)/22 8011....................... NETHERLANDS: Light .................................................................................... 9

1A.7
Wk04/23
 IA
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM - continued
918(P)/22 8011....................... NETHERLANDS: Lights .................................................................................. 9
1239(P)/22 8010 ...................... BELGIUM: Virtual aids to navigation; Light-beacon; Light; Leading line....... 9
1271(P)/22 292, 1405, 1427, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Precautionary 6, 13
2182C.................... area .....................................................................................................................
1352(P)/22 8297 ...................... NETHERLANDS: Works; Wind farm; Restricted areas ................................... 9
1354(P)/22 8016 ...................... NETHERLANDS: Jetties; Pontoon ................................................................... 9
1898(P)/22 272, 273, 1405, NORTH SEA, United Kingdom Sector: Submarine pipeline ............................ 2, 7, 13
2182B, 5615_23...
2301(P)/22 125, 126, 1408, NETHERLANDS: Submarine cables; Works.................................................... 2, 7, 9
1631, 2182A,
5614_25 ................
2493(P)/22 5606_1, 5607_1, BELGIUM: Restricted area; Wind farm ............................................................ 2, 9
8297 ......................
2521(P)/22 106, 126, 1408, NORTH SEA: Submarine cable......................................................................... 2, 7, 9
1504, 1543, 1546,
1631, 2182A,
5614_2, 5614_6 ...
2707(T)/22 274, 1405, 1427 .. NORTH SEA, Norwegian Sector: Buoy............................................................ 7, 13
2729(P)/22 8011....................... NETHERLANDS: Buoyage .............................................................................. 9
2925(P)/22 8015, 8016 ........... NETHERLANDS: Berths .................................................................................. 9
3054(P)/22 295, 1427 ............. NORTH SEA, Norwegian Sector: Works; Wind turbine; Precautionary area ... 6, 13
3107(T)/22 1457 ...................... NETHERLANDS: Light .................................................................................... 9
3109(P)/22 8010 ...................... BELGIUM: Notes .............................................................................................. 9
3152(T)/22 1408, 1632, 2182A, NORTH SEA, Netherlands Sector: Virtual aids to navigation........................... 2, 7, 9
2182B, 5614_25...
3325(P)/22 125, 1408, 1631 .. NETHERLANDS: Wind farm; Works ............................................................... 7, 9
3445(T)/22 292, 1427, 2182C NORTH SEA, Norwegian Sector: Buoy; Precautionary area ............................ 6, 13
3756(P)/22 272, 1405 ............. NORTH SEA, United Kingdom Sector: Works; Offshore installation .............. 7, 13
4098(T)/22 1406, 1630, 1872, BELGIUM: Buoy............................................................................................... 2, 7, 9
1874, 2449,
5606_1, 5607_1 ...
4106(T)/22 207, 8015, 8016 .. NETHERLANDS: Ferry route........................................................................... 9
4227(T)/22 323, 1630, 1872, BELGIUM: Buoy............................................................................................... 1, 9
1873, 2449 ...........
4340(P)/22 8012 ...................... BELGIUM: Dredged areas; Dredged depth....................................................... 9
4517(T)/22 124 ........................ NETHERLANDS: Restricted area; Buoyage .................................................... 9
4681(T)/22 1457 ...................... NETHERLANDS: Buoy.................................................................................... 9
4687(P)/22 126, 1546 ............. NETHERLANDS: Wreck .................................................................................. 9
4718(P)/22 8015 ...................... NETHERLANDS: Light .................................................................................... 9
4758(P)/22 125, 130, 1408, NORTH SEA: Submarine cable......................................................................... 2, 7, 9
1504, 1535, 1543,
1631, 2182A,
5614_1, 5614_2,
5614_25 ................
4759(P)/22 292, 1427, 2182C NORTH SEA, Norwegian Sector: Submarine cable; Precautionary area.......... 6, 13
4947(P)/22 295, 1427 ............. NORTH SEA, Norwegian Sector: Works; Wind turbine; Submarine power 6, 13
cables; Precautionary area..................................................................................
5062(T)/22 1631, 1632, 1633, NETHERLANDS: Traffic separation scheme ................................................... 7, 9
2182A, 2182B,
DE 50, DE 87.........
5110(T)/22 1187, 1408, 1503. NORTH SEA, United Kingdom Sector: Buoyage; Automatic Identification 7
System; Scientific instrument ............................................................................
30(P)/23 120 ........................ NETHERLANDS: Buoyage .............................................................................. 9
110(T)/23 126 ........................ NETHERLANDS: Buoy.................................................................................... 9

1A.8
Wk04/23
 IA
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM - continued
115(P)/23 2, 121, 129, 266, NORTH SEA, United Kingdom Sector: Works; Wind farm; Buoyage; 2, 6, 7
268, 1190, 1191, Restricted area; Submarine cable .......................................................................
1882, 2182A,
2182B, 5614_21,
5614_22, 5614_25,
5615_23 ................
214(T)/23 126 ........................ NETHERLANDS: Buoy.................................................................................... 9
222(T)/23 110, 116, 122, 125, NORTH SEA, Netherlands Sector: Measuring instruments; Buoyage .............. 7, 9
266, 1546, 1632,
1633, 1874, DE 90
353(T)/23 130 ........................ NETHERLANDS: Buoy.................................................................................... 9
355(T)/23 114......................... NETHERLANDS: Buoy.................................................................................... 9
6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL
1512(T)/18 3220 ...................... PORTUGAL, West Coast: Buoyage .................................................................. 18
5180(P)/18 3258 ...................... PORTUGAL, West Coast: Buoyage; Light-beacons ......................................... 18
476(T)/19 3257 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
6434(T)/19 83 .......................... PORTUGAL, South Coast: Depths.................................................................... 18
929(P)/20 1142....................... SPAIN, North Coast: Lights; Coastline; Wrecks................................................ 17
2884(T)/20 3224 ...................... PORTUGAL, West Coast: Scientific instrument ............................................... 18
4135(T)/20 87, 3635, 4103 .... PORTUGAL, West Coast: Buoy ........................................................................ 18
4149(P)/20 2819, 2820 ........... FRANCE, West Coast: Depths; Drying height; Rock........................................ 17
5157(T)/20 2663, 2998, 2999 FRANCE, West Coast: Measuring instruments; Buoyage................................. 17
5580(P)/20 3636 ...................... PORTUGAL, West Coast: Breakwater; Works; Buoyage; Light....................... 18
501(T)/21 3258 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
807(P)/21 2522 ...................... FRANCE, West Coast: Submarine cable; Wind farm........................................ 17
1829(T)/21 2136, 2146, 2613 FRANCE, North Coast: Buoy; Wreck; Restricted area ..................................... 16
3602(T)/21 3258 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
3888(T)/21 89, 3636 ............... PORTUGAL, South Coast: Buoy ...................................................................... 18
4019(T)/21 3221, 3222 ........... PORTUGAL, West Coast: Buoy ........................................................................ 18
4184(T)/21 3221, 3222 ........... PORTUGAL, West Coast: Dredged area; Depths.............................................. 18
5462(T)/21 2148, 2451 ........... FRANCE, North Coast: Restricted area............................................................. 1, 16
380(T)/22 2148, 2451, 2613, FRANCE, North Coast: Restricted area............................................................. 1, 16
2656, 2675 ...........
459(T)/22 3427, 3428, 3429 FRANCE, West Coast: Buoyage; Measuring instruments................................. 16
550(T)/22 3257, 3634 ........... PORTUGAL, West Coast: Works; Spoil grounds .............................................. 18
1062(T)/22 93 .......................... PORTUGAL, South Coast: Buoyage ................................................................. 18
1320(T)/22 3635 ...................... PORTUGAL, West Coast: Buoyage .................................................................. 18
1333(T)/22 3258, 3634 ........... PORTUGAL, West Coast: Works; Dredging area; Channel .............................. 18
1411(T)/22 20, 1104, 2350, FRANCE, West Coast: Measuring instruments; Buoyage; Automatic 1, 16,17
2356, 2522, 2643, Identification Systems; Scientific instruments; Tide gauge ...............................
2655, 2675 ...........
1449(T)/22 89, 3636 ............... PORTUGAL, South Coast: Buoyage ................................................................. 18
2044(P)/22 2743 ...................... FRANCE, West Coast: Anchorage area ............................................................. 17
2051(P)/22 8092 ...................... SPAIN, South West Coast: Restricted area ........................................................ 20
2069(T)/22 73 .......................... SPAIN, South West Coast: Buoy; Pier; Works................................................... 18
2431(T)/22 2146, 2613, 2656, FRANCE, North Coast: Wreck; Buoy; Automatic Identification System; 1, 16
2675 ...................... Restricted area ....................................................................................................
2591(T)/22 3224, 3636 ........... PORTUGAL, West Coast: Buoy ........................................................................ 18
2836(T)/22 3427, 3429 ........... FRANCE, West Coast: Measuring instrument................................................... 16
2948(T)/22 20, 2356, 2643, FRANCE, West Coast: Scientific instruments ................................................... 1, 16
2647, 2649, 2655
3037(P)/22 2136, 2613, 2656, FRANCE, North Coast: Submarine cables; Wind farm; Restricted area........... 1, 16
2675 ......................
3405(T)/22 3635 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
3595(T)/22 1173, 1174............ SPAIN, North Coast: Pier; Works ...................................................................... 17
3796(T)/22 1112....................... FRANCE, North Coast: Port development; Works............................................ 16

1A.9
Wk04/23
 IA
6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL - continued
3926(T)/22 20, 2522, 2986 .... FRANCE, West Coast: Works; Wind farm; Restricted areas............................. 16, 17
4084(T)/22 83 .......................... PORTUGAL, South Coast: Buoy ...................................................................... 18
4109(T)/22 3257 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
4177(T)/22 2029, 2669, 3659 FRANCE, North Coast: Works; Measuring instruments; Buoyage ................... 16
4280(T)/22 3635 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
4284(T)/22 83, 89, 91, 93 ..... PORTUGAL, West Coast: Marine farm; Buoyage ............................................ 18
4293(T)/22 2146, 2148, 2450, FRANCE, North Coast: Restricted area............................................................. 1, 16
2451, 2613, 2656,
2675 ......................
4815(T)/22 3222 ...................... PORTUGAL, West Coast: Beacon..................................................................... 18
4864(T)/22 3258 ...................... PORTUGAL, West Coast: Buoyage .................................................................. 18
7. NORTH ATLANTIC OCEAN
2974(T)/14 4407 ...................... NORTH ATLANTIC OCEAN: Sub-surface oceanographic buoys and 82
moorings.............................................................................................................
5962(T)/19 4012, 4013, 4216, NORTH ATLANTIC OCEAN: Buoy ................................................................ 19, 82, 87
4407 ......................
3448(T)/20 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Anchorage area........ 19
4148(P)/20 332, 334, 867, 868, NORTH ATLANTIC OCEAN, Bermuda: Depths; Drying heights ................... 82
1073, 1315 ...........
116(P)/21 2, 87, 305, 306, NORTH ATLANTIC OCEAN: Works............................................................... 1, 2, 6, 18,
307, 311, 312, 595, 20, 34, 35
1000, 1123, 1156,
1381, 1383, 1384,
1385, 1386, 1392,
1663, 1856, 1861,
1862, 2649, 3100,
3101, 3118, 3133,
3134, 3135, 3220,
3286, 3325, 3327,
3328, 3432, 3635,
3859, 4138, 4146,
4151, 4175, 4176,
4177, 4178 ...........
430(T)/22 4012, 4013, 4400, NORTH ATLANTIC OCEAN: Buoy ................................................................ 19, 82, 86
4402 ......................
474(P)/22 20, 1104, 1227, NORTH ATLANTIC OCEAN: Submarine cable .............................................. 16, 17, 78,
2427, 2483, 2492, 80, 81
2664, 2666, 2670,
4746 ......................
999(T)/22 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Platform; Buoyage .. 19
1329(T)/22 1950, 1956 ........... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Fish havens; 19
Buoyage..............................................................................................................
1339(T)/22 1956, 1957 ........... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoyage .................. 19
1341(T)/22 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoy........................ 19
1444(T)/22 1895 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Works; Restricted 19
areas; Piles; Buoyage .........................................................................................
1518(P)/22 306, 311, 595, 658, NORTH ATLANTIC OCEAN: Works; Submarine cables ................................ 18, 20, 34,
1381, 1383, 1384, 35
1385, 1684, 1685,
1831, 3100, 3118,
3432, 3635, 3636,
3859, 4138, 4146,
4148, 4150, 4151,
4152, 4175, 4176
1553(T)/22 1956 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoy........................ 19
2229(T)/22 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoy........................ 19
2587(T)/22 1959 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Works; Buoy............ 19

1A.10
Wk04/23
 IA
7. NORTH ATLANTIC OCEAN - continued
2599(P)/22 2733, 2734, 2897, NORTH ATLANTIC OCEAN: Submarine cable .............................................. 13, 15
4101, 4112............
3783(T)/22 1895 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoy; Dredging area 19
67(T)/23 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Works; Light; Pier; 19
Pole; Buoyage ....................................................................................................
8. MEDITERRANEAN AND BLACK SEAS
938(T)/12 2214, 2233 ........... RUSSIA, Black Sea Coast: Scientific instruments ............................................ 31
2188(T)/13 965 ........................ ITALY, Sicilia: Piers........................................................................................... 24
4017(T)/16 1211....................... ITALY, Sardegna: Wreck; Restricted area.......................................................... 25
4211(T)/16 3318 ...................... RUSSIA, Black Sea Coast: Works; Buoyage..................................................... 31
5194(T)/16 2216 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
5398(T)/16 2233 ...................... RUSSIA, Black Sea Coast: Measuring instruments .......................................... 31
6572(P)/16 2203 ...................... UKRAINE: Legend............................................................................................ 31
3738(P)/17 3402 ...................... LIBYA: Anchorage areas; Submarine pipelines; Buoyage; Restricted area ...... 24
4926(T)/17 2242 ...................... UKRAINE: Buoy ............................................................................................... 31
5712(T)/17 1996 ...................... CROATIA: Buoyage .......................................................................................... 27
2683(T)/18 2166 ...................... FRANCE, South Coast: Buoyage; Restricted areas........................................... 25
3440(T)/18 2242 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
4669(T)/18 2242 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
4852(T)/18 1580 ...................... CROATIA: Buoy................................................................................................ 27
5625(T)/18 140 ........................ ITALY, East Coast: Restricted area .................................................................... 27
6126(T)/18 2203 ...................... UKRAINE: Works ............................................................................................. 31
376(T)/19 2216, 2242 ........... RUSSIA, Black Sea Coast: Light-beacon.......................................................... 31
1195(P)/19 8121 ...................... TURKEY, Marmara Denizi: Pilotage................................................................. 29
1659(T)/19 3318 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
1853(T)/19 2216, 2242 ........... RUSSIA, Black Sea Coast: Anchorage area ...................................................... 31
2203(P)/19 3313, 3317 ........... GEORGIA: Depths ............................................................................................ 31
3088(T)/19 2122 ...................... TUNISIA: Foul .................................................................................................. 24
3604(P)/19 1683 ...................... GREECE, Aegean Sea Coast: Dredging area; Works ........................................ 28
4697(T)/19 1417 ...................... ITALY, South Coast: Measuring instruments..................................................... 27
5467(T)/19 1710 ...................... ALGERIA: Buoy ............................................................................................... 24
6397(P)/19 2214, 2216, 2217, UKRAINE: General information ....................................................................... 31
2232, 2233, 2234,
2242 ......................
6406(T)/19 2284 ...................... ROMANIA: Buoyage ........................................................................................ 31
611(T)/20 1996, 2719 ........... CROATIA: Buoy................................................................................................ 27
679(T)/20 36 .......................... MALTA: Wreck; Buoy....................................................................................... 24
1352(T)/20 964 ........................ ITALY, Sicilia: Obstruction................................................................................ 24
1526(T)/20 966, 973 ............... ITALY, Sicilia: Works ........................................................................................ 24
1635(T)/20 2203 ...................... UKRAINE: Buoyage ......................................................................................... 31
1696(T)/20 1180....................... SPAIN, Mediterranean Sea Coast: Buoyage ...................................................... 25
2248(T)/20 954 ........................ ITALY, West Coast: Port development; Works; Buoyage .................................. 26
3265(T)/20 200, 1443 ............. ITALY, East Coast: Moored storage tanker; Restricted area.............................. 27
4110(T)/20 1417 ...................... ITALY, South Coast: Works ............................................................................... 27
4143(T)/20 3034, 3035 ........... SPAIN, Islas Baleares: Light-beacons; Works; Beacons; Buoyage ................... 25
4196(T)/20 580 ........................ MOROCCO, North Coast: Works; Dolphin; Buoyage ...................................... 24
4805(T)/20 2284 ...................... ROMANIA: Works ............................................................................................ 31
5235(T)/20 2242 ...................... RUSSIA, Black Sea Coast: Works ..................................................................... 31
5237(T)/20 3318 ...................... RUSSIA, Black Sea Coast: Works; Light-beacons ............................................ 31
5326(P)/20 812 ........................ ALGERIA: Depths; Lights; Works .................................................................... 24
5448(P)/20 1636 ...................... GREECE, Aegean Sea Coast: Depths; Obstructions; Buoyage ......................... 29
384(T)/21 3313 ...................... GEORGIA: Marine farm.................................................................................... 31
1059(T)/21 200 ........................ ITALY, East Coast: Buoy ................................................................................... 27
1126(T)/21 3403 ...................... TUNISIA: Wreck ............................................................................................... 24
1305(T)/21 2120, 2170 ........... FRANCE, South Coast: Buoy............................................................................ 25
1856(T)/21 2203 ...................... UKRAINE: Buoy ............................................................................................... 31

1A.11
Wk04/23
 IA
8. MEDITERRANEAN AND BLACK SEAS - continued
2142(T)/21 354 ........................ ITALY, West Coast: Restricted areas; Buoyage; Works..................................... 26
2417(P)/21 2574, 2681 ........... EGYPT, North Coast: Works; Reclamation area ............................................... 24
2670(T)/21 2282, 2284 ........... ROMANIA: Dredged area; Spoil grounds......................................................... 31
3557(P)/21 2429, 5507 ........... TURKEY, Çanakkale Boğazi: Bridge; Works; Buoyage; Vertical clearance..... 29
3577(T)/21 167, 3403 ............. TUNISIA: Wreck ............................................................................................... 24
3886(P)/21 2573, 2574, 2578 EGYPT, North Coast: Breakwater; Works; Dredging area; Reclamation area .. 24
3931(T)/21 3317 ...................... GEORGIA: Buoyage; Scientific instrument; Restricted area ............................ 31
4128(T)/21 2217, 2232 ........... UKRAINE: Buoy ............................................................................................... 31
4219(T)/21 2773 ...................... CROATIA: Foul; Buoy ...................................................................................... 27
4263(T)/21 2216, 2242 ........... RUSSIA, Black Sea Coast: Buoyage ................................................................. 31
4414(T)/21 2216, 2233, 3311. RUSSIA, Black Sea Coast: Buoy; Scientific instruments ................................. 31
4525(T)/21 1212 ...................... ITALY, Sardegna: Buoy ..................................................................................... 25
4529(T)/21 963, 1976 ............. ITALY, Sicilia: Works; Breakwater; Buoyage.................................................... 26
4677(T)/21 2216, 2233, 3311. RUSSIA, Black Sea Coast: Buoy....................................................................... 31
4801(T)/21 848, 850, 851 ...... CYPRUS: Scientific instruments; Buoyage....................................................... 30
5172(T)/21 1159, 1198............ TURKEY, İstanbul Boğazi: Buoy ...................................................................... 29
5361(T)/21 2712 ...................... CROATIA: Buoy................................................................................................ 27
42(P)/22 775, 849, 2074 .... CYPRUS: Submarine cable ............................................................................... 30
520(P)/22 518 ........................ SPAIN, Mediterranean Sea Coast: Depths; Dredged areas................................ 25
783(T)/22 3403 ...................... TUNISIA: Buoy ................................................................................................. 24
1118(T)/22 3312 ...................... RUSSIA, Black Sea Coast: Buoyage ................................................................. 31
1183(T)/22 849 ........................ CYPRUS: Buoy ................................................................................................. 30
1235(T)/22 351 ........................ ITALY, West Coast: Breakwater; Works ............................................................ 26
1260(T)/22 1202, 1204, 1207 ITALY, Sardegna: Buoyage................................................................................ 25
1274(T)/22 855 ........................ ALGERIA: Buoy ............................................................................................... 24
1289(T)/22 1180, 1196............ SPAIN, Mediterranean Sea Coast: Works; Breakwater; Buoyage ..................... 25
1756(P)/22 3403 ...................... TUNISIA: Buoy ................................................................................................. 24
1911(P)/22 151, 153, 355, 356, MEDITERRANEAN SEA: Submarine cable .................................................... 24, 25, 26,
775, 849, 917, 27, 28, 30
1018, 1091, 1092,
1093, 1211, 1425,
1591, 1705, 1911,
1913, 1941, 1976,
1992, 1998, 1999,
2074, 2116, 2124,
2634, 3401, 3403,
3681 ......................
2002(T)/22 1710 ...................... ALGERIA: Buoy ............................................................................................... 24
2065(T)/22 2773 ...................... CROATIA: Beacons; Buoy; Light-beacon......................................................... 27
2123(T)/22 2834 ...................... SPAIN, Islas Baleares: Works; Buoyage............................................................ 25
2154(T)/22 2282, 2284 ........... ROMANIA: Works; Data collection buoys ....................................................... 31
2343(P)/22 1445 ...................... ITALY, East Coast: Dredged area ...................................................................... 27
2344(T)/22 2200, 2205, 2212 UKRAINE: Spoil ground; Virtual aid to navigation.......................................... 31
2645(T)/22 9 ............................ TUNISIA: Wreck; Light; Buoy; Restricted area................................................ 24
3533(T)/22 183, 2634 ............. ISRAEL, Mediterranean Sea Coast: Works ....................................................... 24, 30
3617(P)/22 118......................... ITALY, West Coast: Depths; Fairways; Restricted area ..................................... 26
4219(T)/22 1850, 1851 ........... SPAIN, Mediterranean Sea Coast: Buoy............................................................ 25
4221(P)/22 2200, 2201, 2202, UKRAINE: General information ....................................................................... 31
2203, 2205, 2212,
2213, 2214, 2216,
2217, 2232, 2233,
2234, 2238, 2242,
2243, 2282, 3302,
3303 ......................
4283(T)/22 966, 973, 1941 .... ITALY, Sicilia: Works ........................................................................................ 24, 26
4299(T)/22 2247 ...................... FRANCE, South Coast: Restricted area............................................................. 25
4313(T)/22 2200, 2201, 2203, UKRAINE: Channel .......................................................................................... 31
2205, 2212 ...........

1A.12
Wk04/23
 IA
8. MEDITERRANEAN AND BLACK SEAS - continued
4689(P)/22 2200, 2202, 2205, UKRAINE: General information ....................................................................... 31
2212, 2213, 2214,
2232, 2243 ...........
4761(P)/22 1585 ...................... ISRAEL, Mediterranean Sea Coast: Depths ...................................................... 30
4789(T)/22 142, 144, 1448, GIBRALTAR: Wreck; Buoyage......................................................................... 18
3578 ......................
4792(T)/22 269, 2712 ............. CROATIA: Buoy................................................................................................ 27
5085(T)/22 204, 1461 ............. SLOVENIA: Anchor berths ............................................................................... 27
5183(T)/22 194, 2123, 2124 .. MALTA: Restricted area .................................................................................... 24
223(T)/23 3313, 3317 ........... GEORGIA: Scientific instruments; Buoyage .................................................... 31
291(P)/23 1591, 2634 ........... ISRAEL, Mediterranean Sea Coast: Works ....................................................... 30
9. AFRICA, WEST COAST AND SOUTH ATLANTIC
3064(T)/13 3101 ...................... IVORY COAST: Wreck ..................................................................................... 34
4735(P)/14 607 ........................ SENEGAL: Depths ............................................................................................ 20
1277(T)/18 601, 1147.............. GUINEA: Barge................................................................................................. 20
3504(T)/18 1699 ...................... MAURITANIA: Buoyage .................................................................................. 20
5016(T)/18 306, 307 ............... ANGOLA: Buoy ................................................................................................ 34
231(T)/19 1322 ...................... GABON: Buoyage ............................................................................................. 34
3718(T)/19 1661, 1699 ........... MAURITANIA: Wreck...................................................................................... 20
5265(T)/19 1661, 3134 ........... MAURITANIA: Wreck...................................................................................... 20
5317(T)/19 1661, 1690, 1699, MAURITANIA: Wreck; Restricted area............................................................ 20
3134 ......................
1389(T)/20 4137, 4138 ........... NAMIBIA: Radar beacon .................................................................................. 34
2045(T)/20 1000, 1001 ........... SENEGAL: Depths ............................................................................................ 20
2262(P)/20 1661, 1690, 1699 MAURITANIA: Depths; Wrecks; Obstructions; Dredged area......................... 20
2294(T)/20 1383 ...................... GHANA: Fog signal; Superbuoy ....................................................................... 34
2885(T)/20 1000, 1001 ........... SENEGAL: Works ............................................................................................. 20
5473(P)/20 3103 ...................... IVORY COAST: Works ..................................................................................... 34
173(P)/21 1562 ...................... GUINEA: Depths; Maintained channel ............................................................. 20
877(P)/21 3103 ...................... IVORY COAST: Works; Bridge ........................................................................ 34
1310(T)/21 1387, 3118............ CAMEROON: Buoy .......................................................................................... 34
1324(P)/21 3108 ...................... IVORY COAST: Works; Breakwaters ............................................................... 34
3228(T)/21 3112....................... GHANA: Wreck................................................................................................. 34
4838(T)/21 1392 ...................... TOGO: Buoy ...................................................................................................... 34
124(P)/22 3103 ...................... IVORY COAST: Dredged area .......................................................................... 34
1856(P)/22 1662, 1663 ........... MAURITANIA: Works ...................................................................................... 20
2416(T)/22 1322 ...................... GABON: Obstruction......................................................................................... 34
3743(T)/22 3325 ...................... GABON: Buoyage ............................................................................................. 34
3906(T)/22 863 ........................ MOROCCO, West Coast: Wreck ....................................................................... 20
3925(P)/22 862 ........................ MOROCCO, West Coast: Dredged areas........................................................... 20
4112(P)/22 1699 ...................... MAURITANIA: Works; Channels; Buoyage; Pilot boarding place; Spoil 20
grounds; Light; Depths; Wrecks; Obstructions ..................................................
4258(P)/22 3290 ...................... CONGO: Depths ................................................................................................ 34
4287(T)/22 1000, 1001, 1662, SENEGAL: Works; Offshore installation; Channel; Buoyage; Restricted area; 20
1663 ...................... Submarine pipeline.............................................................................................
4291(T)/22 1456 ...................... CAMEROON: Depths ....................................................................................... 34
4296(P)/22 1000, 1663 ........... SENEGAL: Buoyage ......................................................................................... 20
4318(P)/22 1691, 1771 ........... SOUTH ATLANTIC OCEAN, Ascension Island: Depths; Obstruction............ 35
4352(P)/22 859 ........................ MOROCCO, West Coast: Lights; Automatic Identification Systems; Buoyage 20
4563(P)/22 856, 860, 861, MOROCCO, West Coast: Buoyage; Lights ....................................................... 18, 20
3132, 3133 ...........
4968(P)/22 1664, 3135, 4104, SENEGAL: Development area; Works.............................................................. 20
4215 ......................
10. AFRICA, SOUTH AND EAST COASTS, AND MADAGASCAR
209(T)/18 4153, 4155 ........... SOUTH AFRICA, South Coast: Buoy............................................................... 35
576(T)/18 1236, 4142 ........... SOUTH AFRICA, South Coast: Wreck ............................................................. 35

1A.13
Wk04/23
 IA
10. AFRICA, SOUTH AND EAST COASTS, AND MADAGASCAR - continued
2060(T)/18 643, 4170 ............. SOUTH AFRICA, East Coast: Buoy ................................................................. 35
4924(P)/18 663, 3310, 3361 .. TANZANIA: Depths; Lights; Buoyage; Beacons; Leading line; Submarine 36
pipelines; Jetty; Rocks........................................................................................
210(T)/19 643 ........................ SOUTH AFRICA, East Coast: Depths............................................................... 35
403(T)/19 4142 ...................... SOUTH AFRICA, West Coast: Depth ............................................................... 35
2589(T)/19 1846 ...................... SOUTH AFRICA, West Coast: Depths; Dredged depths .................................. 35
2590(T)/19 4158 ...................... SOUTH AFRICA, South Coast: Depth.............................................................. 35
2591(T)/19 4162 ...................... SOUTH AFRICA, South Coast: Depths ............................................................ 35
2592(T)/19 4174 ...................... SOUTH AFRICA, East Coast: Depths............................................................... 35
6161(P)/19 663 ........................ TANZANIA: Buoyage; Light-beacons; Works.................................................. 36
6566(T)/19 1236, 4142 ........... SOUTH AFRICA, West Coast: Rocks; Depths.................................................. 35
42(P)/20 668 ........................ KENYA: Works; Buoyage; Leading lights; Pilot boarding place ...................... 36
1714(P)/20 3530 ...................... SOMALIA: Platform; Buoyage ......................................................................... 32
3553(T)/20 1236, 1922, 4142, SOUTH AFRICA, West Coast: Obstructions; Buoyage .................................... 35
4145, 4146, 4150,
4151, 4152, 4153,
4154, 4155 ...........
276(T)/21 4150 ...................... SOUTH AFRICA, South Coast: Buoy; Radar beacon....................................... 35
1841(T)/22 2078, 4177 ........... SOUTH AFRICA, West Coast: Current meter................................................... 34
11. RED SEA, ARABIA, IRAQ AND IRAN
3234(T)/13 1229 ...................... IRAQ: Wreck ..................................................................................................... 40
5236(T)/14 2523, 2883, 2886, QATAR: Buoyage .............................................................................................. 40
2887, 3950 ...........
1182(T)/16 333, 2374 ............. EGYPT, Red Sea Coast: Platform; Light ........................................................... 32
4281(P)/16 63 .......................... SAUDI ARABIA, Red Sea Coast: Harbour developments; Depths .................. 32
4492(P)/16 11, 1268, 2882, IRAN: Platforms; Submarine cables; Submarine pipelines ............................... 40
2884, 3774 ...........
5105(P)/16 16 ..........................
SAUDI ARABIA, Red Sea Coast: Depths; Wrecks; Submarine pipeline; 32
Rocks; Coral.......................................................................................................
2363(P)/17 6, 12, 15, 143, 157, RED SEA: Routeing measures........................................................................... 32
158, 159, 164, 452,
453, 1925, 2375,
2658, 2659, 2964
2822(T)/17 2523, 3790 ........... QATAR: Buoy .................................................................................................... 40
3559(P)/17 2837, 2889, 3178, UNITED ARAB EMIRATES: Submarine pipeline; Obstruction ...................... 40
3179 ......................
4031(P)/17 1265, 3842, 3843, IRAQ: Channel; Depths; Wrecks ....................................................................... 40
3844, 3845, 3846
5287(T)/17 1235, 1265 ........... ARABIA: Buoyage ............................................................................................ 40
5518(P)/17 1228 ...................... IRAQ: Jetty; Dolphins; Mooring buoys; Floating dock; Dredged area ............. 40
1453(T)/18 1235, 1265, 3773 ARABIA, Shaţţ al'Arab: Buoyage ..................................................................... 40
2528(T)/18 2133, 2373 ........... EGYPT, Red Sea Coast: Buoy ........................................................................... 32
4030(P)/18 3772, 3781 ........... QATAR: Depths; Buoyage ................................................................................. 40
994(P)/19 1229, 1235, 2847, IRAQ: Works; Buoyage; Channel...................................................................... 40
2884 ......................
1646(P)/19 3737, 3759 ........... BAHRAIN: Works ............................................................................................. 40
1937(T)/19 333, 2374 ............. EGYPT, Red Sea Coast: Buoy ........................................................................... 32
2208(T)/19 2523, 2837, 2847, QATAR: Buoy .................................................................................................... 40
2886, 3772, 3950
3126(P)/19 2837, 2889, 3178, UNITED ARAB EMIRATES: Works; Offshore installations ........................... 40
3179 ......................
3154(P)/19 3176, 3412 ........... UNITED ARAB EMIRATES: Restricted area .................................................. 40
3202(P)/19 3812 ...................... SAUDI ARABIA, East Coast: Depths ............................................................... 40
6699(P)/19 3718 ...................... SAUDI ARABIA, East Coast: Works; Buoyage; Dredged area ........................ 40
1822(T)/20 2854 ...................... OMAN: Wreck ................................................................................................... 40
3127(P)/20 15, 16 ................... SAUDI ARABIA, Red Sea Coast: General information ................................... 32

1A.14
Wk04/23
 IA
11. RED SEA, ARABIA, IRAQ AND IRAN - continued
3623(P)/20 27, 2884 ............... IRAN: Channel; Buoyage; Dredged depths; Light-beacons; Dredged areas; 40
Dolphins; Reclamation area; Coastline; Swinging circle; Anchor berths ..........
4448(P)/20 12 .......................... SAUDI ARABIA, Red Sea Coast: Depths; Obstruction; Dredged areas; 32
Coastline; Beacons .............................................................................................
4645(P)/20 2132, 2133, 2373 EGYPT, Red Sea Coast: Works; Lights; Dredged area; Virtual aids to 32
navigation ...........................................................................................................
5242(T)/20 1214, 3773 ........... KUWAIT: Light-beacon; Lights ........................................................................ 40
6028(P)/20 3175 ...................... UNITED ARAB EMIRATES: Works; Restricted area; Outfall; Buoyage ........ 40
121(T)/21 3777, 3812 ........... SAUDI ARABIA, East Coast: Wreck; Buoyage................................................ 40
361(T)/21 3763, 3785 ........... OMAN: Works ................................................................................................... 32, 40
2031(T)/21 1223, 2882, 2884, KUWAIT: Lights................................................................................................ 40
3773 ......................
3623(P)/21 2577 ...................... SAUDI ARABIA, Red Sea Coast: Depths......................................................... 32
3859(T)/21 2523, 2837, 2847, BAHRAIN: Buoy............................................................................................... 40
2858, 2886, 3738,
3790 ......................
4070(P)/21 8054 ...................... UNITED ARAB EMIRATES: Buoyage; Light-beacons; Restricted areas........ 40
4104(T)/21 2882, 2883, 3719, SAUDI ARABIA, East Coast: Obstruction ....................................................... 40
3775, 3788 ...........
4609(T)/21 8054 ...................... UNITED ARAB EMIRATES: Breakwater ........................................................ 40
4611(P)/21 8054 ...................... UNITED ARAB EMIRATES: Light; Works; Buoyage; Breakwaters; Channel 40
4615(P)/21 8054 ...................... UNITED ARAB EMIRATES: Anchorage area; Maritime limit........................ 40
5210(T)/21 3734, 3736, 3737 BAHRAIN: Works; Submarine pipeline............................................................ 40
271(P)/22 2442, 2837, 2858, UNITED ARAB EMIRATES: Restricted area .................................................. 40
2887, 2888, 2889,
3175, 3176 ...........
272(P)/22 8101 ...................... UNITED ARAB EMIRATES: Light.................................................................. 40
362(P)/22 12, 38, 58, 158, ARABIAN SEA: Submarine cables; Works ...................................................... 32, 40, 41
159, 327, 801,
1268, 2375, 2441,
2442, 2443, 2444,
2523, 2599, 2658,
2659, 2851, 2882,
2883, 2884, 2886,
2887, 2888, 2889,
2895, 3171, 3172,
3174, 3175, 3176,
3520, 3723, 3734,
3736, 3737, 3738,
3759, 3760, 3761,
3774, 3775, 3786,
3788, 3790, 3842,
3950 ......................
597(P)/22 3734, 3736, 3737 BAHRAIN: Dredged area; Reclamation area; Works; Buoyage ....................... 40
716(T)/22 2837, 2847, 2883, BAHRAIN: Buoy............................................................................................... 40
2886, 3788, 3790
749(P)/22 3173, 3599 ........... IRAN: Depths; Jetty; Works............................................................................... 40
1064(P)/22 3179, 3778, 3779, UNITED ARAB EMIRATES: Works; Restricted areas..................................... 40
3780 ......................
1113(T)/22 2837, 2887, 2888, UNITED ARAB EMIRATES: Obstruction ....................................................... 40
2889, 3175, 3176,
3412 ......................
1202(P)/22 8101 ...................... UNITED ARAB EMIRATES: General information.......................................... 40
1270(P)/22 2886 ...................... BAHRAIN: Submarine power cable.................................................................. 40
1452(P)/22 15 .......................... SAUDI ARABIA, Red Sea Coast: Buoy; Single Point Mooring; Deep water 32
route; Precautionary area; Submarine pipeline ..................................................
2061(T)/22 3775 ...................... SAUDI ARABIA, East Coast: Buoy.................................................................. 40
2114(P)/22 1214 ...................... KUWAIT: Reclamation area; Works; Buoyage.................................................. 40
2115(T)/22 2523, 3772, 3950 QATAR: Buoyage .............................................................................................. 40

1A.15
Wk04/23
 IA
11. RED SEA, ARABIA, IRAQ AND IRAN - continued
2174(T)/22 2523 ...................... QATAR: Buoy .................................................................................................... 40
2426(T)/22 2882, 2884, 3773 KUWAIT: Buoy ................................................................................................. 40
3337(T)/22 2523, 2886, 3772, QATAR: Buoy; Obstructions ............................................................................. 40
3950 ......................
3372(P)/22 3176, 3177, 3752 UNITED ARAB EMIRATES: Dredging area; Reclamation area; Works; 40
Buoyage; Restricted area....................................................................................
3406(T)/22 159, 2375, 4704 .. EGYPT, Red Sea Coast: Works ......................................................................... 32
3892(T)/22 2443, 2444, 3178, UNITED ARAB EMIRATES: Buoy.................................................................. 40
3179 ......................
4751(P)/22 2523, 2837, 2847, QATAR: Submarine pipeline; Works; Offshore installation .............................. 40
2883, 2886, 2887,
3772, 3950 ...........
4890(P)/22 2889, 3178 ........... UNITED ARAB EMIRATES: Submarine pipeline; Works............................... 40
4929(P)/22 2443, 2444, 2837, UNITED ARAB EMIRATES: Submarine pipeline; Mooring buoys; 40
2886, 2887, 2889, Anchorage area; Ground tackle; Works .............................................................
3178, 3179 ...........
5192(P)/22 8101 ...................... UNITED ARAB EMIRATES: Buoyage ............................................................ 40
27(T)/23 2888, 3174, 3404 UNITED ARAB EMIRATES: Buoyage ............................................................ 40
161(P)/23 8101 ...................... UNITED ARAB EMIRATES: Restricted areas; Fishery limit .......................... 40
342(P)/23 2523 ...................... QATAR: Restricted areas ................................................................................... 40
344(P)/23 3752 ...................... UNITED ARAB EMIRATES: Buoyage; Works................................................ 40
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA
4002(P)/12 569 ........................ INDIA, East Coast: Port developments ............................................................. 43
2877(T)/17 IN 2036 .................. INDIA, West Coast: Buoyage ............................................................................ 41
5395(T)/17 39, 707, 4705 ...... PAKISTAN: Wreck ............................................................................................ 32, 41
2839(P)/18 IN 3010, IN 3041 ... INDIA, East Coast: Anchorage areas; Submarine pipelines; Restricted area .... 43
2951(T)/18 90 .......................... BANGLADESH: Obstruction............................................................................ 43
3911(P)/18 IN 2016, IN 2076 ... INDIA, West Coast: Works ................................................................................ 41
4921(T)/18 90 .......................... BANGLADESH: Wreck .................................................................................... 43
5442(T)/18 1488, IN 207, INDIA, West Coast: Dredging areas .................................................................. 41
IN 253, IN 254 .......
5548(P)/18 IN 206, IN 253 ....... INDIA, West Coast: Works ................................................................................ 41
5576(P)/18 920 ........................ INDIAN OCEAN, Chagos: Restricted areas; Anchorage areas; Depths ........... 38
105(P)/19 319 ........................ INDIA, East Coast: Channel limit; Buoyage; Dredged depths; Berth; Floating 43
dock; Pilot boarding places ................................................................................
1217(P)/19 IN 292 .................... INDIA, West Coast: Traffic separation scheme ................................................. 41
2078(P)/19 IN 3012 .................. INDIA, East Coast: Works ................................................................................. 43
2106(P)/19 IN 211, IN 255, INDIA, West Coast: Works; Buoyage................................................................ 41
IN 292, IN 293,
IN 2016, IN 2076 ...
2556(T)/19 732 ........................ BANGLADESH: Wreck .................................................................................... 43
2869(P)/19 IN 203, IN 2013, INDIA, West Coast: Works ................................................................................ 41
IN 2031 ..................
2871(P)/19 IN 220, IN 259, INDIA, West Coast: Works ................................................................................ 41
IN 2004, IN 2029,
IN 2045 ..................
3115(P)/19 IN 203, IN 2033, INDIA, West Coast: Works ................................................................................ 41
IN 2083 ..................
3861(T)/19 833 ........................ BURMA: Buoy .................................................................................................. 43
3986(T)/19 722 ........................ INDIAN OCEAN, Seychelles: Beacon.............................................................. 36
4267(T)/19 1885 ...................... BURMA: Buoy .................................................................................................. 43
4326(P)/19 1488, IN 207, INDIA, West Coast: Works ................................................................................ 41
IN 253, IN 254,
IN 292 ....................
5223(T)/19 90 .......................... BANGLADESH: Obstruction............................................................................ 43
5363(T)/19 830 ........................ BURMA: Works................................................................................................. 45

1A.16
Wk04/23
 IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
5373(T)/19 3877, 3895, 4701, INDIAN OCEAN, Comores: Volcanic activity ................................................. 36, 38
4702 ......................
5624(T)/19 90, 732 ................. BANGLADESH: Buoyage ................................................................................ 43
579(P)/20 IN 254, IN 292 ....... INDIA, West Coast: Depths ............................................................................... 41
1004(T)/20 90 .......................... BANGLADESH: Wreck .................................................................................... 43
1168(P)/20 69, IN 262 ............. INDIA, East Coast: Depths; Recommended anchorage; Buoyage .................... 42
1802(P)/20 IN 211, IN 255, INDIA, West Coast: Bridge; Jetty...................................................................... 41
IN 2016, IN 2076 ...
2164(P)/20 725, 727 ............... INDIAN OCEAN, Chagos: Rocks; Obstructions .............................................. 38
2332(T)/20 IN 214, IN 215, INDIA, West Coast: Buoyage ............................................................................ 41
IN 2022 ..................
2821(T)/20 2760, 4070, 4071, INDIAN OCEAN: Buoyage .............................................................................. 35, 42, 46
4073, 4707 ...........
3175(T)/20 823, 826, 833 ...... BURMA: Wreck................................................................................................. 43
3503(T)/20 39, 58 ................... PAKISTAN: Quarantine anchorage ................................................................... 41
4221(T)/20 90, IN 31 ............... BANGLADESH: Dredging area........................................................................ 43
4292(P)/20 1470, IN 203 ......... INDIA, West Coast: Depths; Drying heights ..................................................... 41
4378(P)/20 IN 33 ...................... INDIAN OCEAN, Nicobar Islands: Depths; Obstructions; Lights ................... 42
4980(P)/20 IN 203 .................... INDIA, West Coast: Buoy; Depths .................................................................... 41
5051(T)/20 2741, 2756 ........... INDIAN OCEAN, Comores: Light.................................................................... 36
6303(P)/20 823, 826, 830, 833 BURMA: Submarine cable; Works.................................................................... 43, 45
220(P)/21 709, 813, 1013, SRI LANKA, West Coast: Submarine cable...................................................... 42
3323, 3700, 4703,
4706, 4707, IN 32,
IN 263 ....................
874(P)/21 12, 15, 159, 164, INDIAN OCEAN: Submarine cables ................................................................ 32, 40, 41,
263, 264, 333, 818, 42, 43, 45,
830, 2375, 2441, 46
2442, 2760, 3784,
3943, 4705, 4706,
IN 273, IN 293,
IN 2036 ..................
1276(T)/21 39, 58 ................... PAKISTAN: Wrecks........................................................................................... 41
1431(P)/21 IN 3010 .................. INDIA, East Coast: Depths; Quay; Anchorage areas......................................... 43
2269(P)/21 318, IN 31, IN 32 .. INDIA, East Coast: Buoy................................................................................... 42, 43
2409(P)/21 38 .......................... PAKISTAN: Depths; Lights ............................................................................... 41
2620(T)/21 813, IN 263 ........... SRI LANKA, West Coast: Wreck ...................................................................... 42
2825(P)/21 IN 203, IN 2068, INDIA, West Coast: Berth; Works ..................................................................... 41
IN 2079, IN 2106 ...
3518(P)/21 IN 32, IN 223, IN 262 INDIA, East Coast: Works ................................................................................. 41, 42
4020(P)/21 732 ........................ BANGLADESH: Drying heights; Depths; Wrecks; Buoyage; Lights; 43
Coastline; Ferry route.........................................................................................
4125(T)/21 IN 211, IN 255, INDIA, West Coast: Works ................................................................................ 41
IN 292, IN 293,
IN 2016, IN 2076 ...
4222(T)/21 90 .......................... BANGLADESH: Wrecks; Buoy........................................................................ 43
237(T)/22 90, IN 31 ............... BANGLADESH: Wreck .................................................................................... 43
519(T)/22 709, 4703, 4706, INDIA, East Coast: Buoyage ............................................................................. 42
4707 ......................
606(T)/22 90, 732, IN 351 .... BANGLADESH: Wreck; Buoy ......................................................................... 43
1068(T)/22 317, 318, 319, INDIA, East Coast: Obstructions; Scientific instruments.................................. 42, 43
2069, 4706, IN 31,
IN 32, IN 33, IN 308,
IN 352, IN 353 .......
1487(T)/22 90, IN 31 ............... BANGLADESH: Depths ................................................................................... 43
1539(T)/22 IN 223, IN 260, INDIA, West Coast: Buoyage ............................................................................ 41
IN 261 ....................
1755(T)/22 90, IN 31 ............... BANGLADESH: Wreck; Buoyage.................................................................... 43

1A.17
Wk04/23
 IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
1861(T)/22 90, 1016 ............... BANGLADESH: Wrecks................................................................................... 43
1866(P)/22 IN 3001, IN 3028 ... INDIA, East Coast: Jetty; Dredged area ............................................................ 43
1878(T)/22 4070, 4071, 4073, INDIAN OCEAN: Buoy .................................................................................... 35, 38, 42
4702 ......................
1881(T)/22 529, 716, 721, 724, INDIAN OCEAN: Buoyage .............................................................................. 19, 20, 34,
2760, 2781, 2785, 35, 36, 38,
3877, 4070, 4071, 42, 43, 46,
4072, 4073, 4104, 47, 53, 64,
4115, 4202, 4203, 87, 89, 92,
4209, 4215, 4216, 95
4508, 4510, 4701,
4702, 4703, 4706,
4707, 4708, 4714,
4806, 4810, IN 31
1982(P)/22 IN 3037, IN 3038 ... INDIA, East Coast: Pier; Dredged area; Channel limits; Buoyage; Swinging 43
circle; Restricted area .........................................................................................
2000(T)/22 90, 1016 ............... BANGLADESH: Wreck .................................................................................... 43
2001(T)/22 90, 1016 ............... BANGLADESH: Wrecks; Buoy........................................................................ 43
2056(T)/22 90, 1016 ............... BANGLADESH: Wreck .................................................................................... 43
2159(T)/22 90, 102, 1016 ...... BANGLADESH: Wreck; Buoy ......................................................................... 43
2248(T)/22 102, 1016 ............. BANGLADESH: Wreck; Buoy ......................................................................... 43
2253(T)/22 102, 1016 ............. BANGLADESH: Works .................................................................................... 43
2256(T)/22 90, 102, 1016 ...... BANGLADESH: Wreck .................................................................................... 43
2266(T)/22 102 ........................ BANGLADESH: Wreck; Buoy ......................................................................... 43
2280(T)/22 90, 102, 1016 ...... BANGLADESH: Wreck .................................................................................... 43
2316(T)/22 102, 1016 ............. BANGLADESH: Wreck; Buoy ......................................................................... 43
2373(T)/22 90, 1016 ............... BANGLADESH: Wreck .................................................................................... 43
2509(T)/22 IN 203, IN 2018, INDIA, West Coast: Wreck ................................................................................ 41
IN 2080 ..................
2516(T)/22 90, 1016, IN 31 .... BANGLADESH: Wreck .................................................................................... 43
2600(T)/22 IN 203, IN 2068 ..... INDIA, West Coast: Wreck ................................................................................ 41
2728(T)/22 IN 211, IN 255, INDIA, West Coast: Wreck ................................................................................ 41
IN 2015, IN 2016 ...
3053(P)/22 3048 ...................... INDIAN OCEAN, Mauritius: Depths................................................................ 38
3056(T)/22 90, IN 31 ............... BANGLADESH: Wreck .................................................................................... 43
3205(T)/22 IN 203, IN 2080 ..... INDIA, West Coast: Wreck ................................................................................ 41
3408(T)/22 317, 830, 1398, INDIA, East Coast: Data buoys ......................................................................... 42, 43, 45
2069, 4706, 4707,
IN 31, IN 32, IN 33,
IN 313, IN 472,
IN 473, IN 3001,
IN 3004 ..................
3433(T)/22 707, 709, 4703, INDIA, West Coast: Data buoys ........................................................................ 32, 41, 42
4705, 4706, 4707,
IN 22, IN 273, IN 292
3462(P)/22 IN 254 .................... INDIA, West Coast: Depths; Obstruction .......................................................... 41
3572(T)/22 1488 ...................... INDIA, West Coast: Works ................................................................................ 41
3632(T)/22 IN 2039, IN 2082, INDIA, West Coast: Buoyage ............................................................................ 41
IN 2110 ..................
3713(T)/22 39, 707, 709, IN 22, INDIA, West Coast: Obstructions; Scientific instruments................................. 41, 42
IN 32, IN 214,
IN 221, IN 251,
IN 253, IN 258,
IN 260, IN 261,
IN 263, IN 272,
IN 292, IN 293 .......

1A.18
Wk04/23
 IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
3873(P)/22 39, 707, 1470, INDIA, West Coast: Traffic separation scheme; Precautionary areas................ 41
IN 202, IN 203,
IN 204, IN 251,
IN 292, IN 2031,
IN 2060, IN 2068,
IN 2079, IN 2080 ...
4089(T)/22 90 .......................... BANGLADESH: Obstruction............................................................................ 43
4162(T)/22 IN 2108, IN 2109 ... INDIA, West Coast: Wreck ................................................................................ 41
4226(P)/22 6, 143, 151, 153, INDIAN OCEAN: Works; Submarine cables .................................................... 24, 25, 32,
157, 158, 159, 167, 34, 35, 36,
171, 240, 264, 265, 38
327, 333, 452, 453,
616, 644, 646, 666,
671, 674, 716, 717,
721, 722, 740, 742,
964, 1180, 1196,
1704, 1705, 1925,
1926, 2116, 2122,
2123, 2124, 2133,
2373, 2374, 2375,
2573, 2574, 2578,
2926, 2930, 2949,
2964, 2968, 3310,
3361, 3795, 3797,
3877, 3878, 4146,
4148, 4150, 4151,
4152, 4156, 4157,
4169, 4171, 4177,
4178, 4179, 4180
4276(T)/22 102, 1016 ............. BANGLADESH: Wreck .................................................................................... 43
4716(P)/22 817, IN 31 ............. BURMA: Wells; Submarine pipeline................................................................. 43
4936(T)/22 IN 212, IN 256 ....... INDIA, West Coast: Buoy.................................................................................. 41
4945(T)/22 IN 22, IN 32, IN 220, INDIA, West Coast: Buoy.................................................................................. 41, 42
IN 259, IN 260,
IN 2029 ..................
4949(T)/22 317, 569, 707, INDIAN OCEAN: Buoyage .............................................................................. 41, 42, 43
1470, 2069, IN 22,
IN 31, IN 32, IN 33,
IN 205, IN 206,
IN 211, IN 212,
IN 213, IN 215,
IN 216, IN 219,
IN 221, IN 253,
IN 255, IN 256,
IN 257, IN 258,
IN 259, IN 260,
IN 262, IN 272,
IN 273, IN 292,
IN 293, IN 352,
IN 353, IN 2008,
IN 2120 ..................
5040(T)/22 IN 3001, IN 3004 ... INDIA, East Coast: Works; Jetty ....................................................................... 43
200(T)/23 IN 351 .................... INDIA, East Coast: Wreck ................................................................................. 43
201(T)/23 IN 217 .................... INDIA, West Coast: Wreck ................................................................................ 41
225(T)/23 IN 3010, IN 3041 ... INDIA, East Coast: Buoy................................................................................... 43
240(T)/23 IN 203, IN 2068 ..... INDIA, West Coast: Wreck ................................................................................ 41
13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA
1030(T)/16 1140, 3946............ MALAYSIA, Peninsular Malaysia, West Coast: Obstruction............................ 45
2152(T)/17 3831, 3833, 4041 SINGAPORE STRAIT: Buoy............................................................................ 45

1A.19
Wk04/23
 IA
13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA - continued
1401(P)/18 1312, 2422, 2435, INDONESIA, Sumatera: Submarine cables ...................................................... 45, 46, 47,
2436, 2470, 2868, 48
2870, 3947 ...........
4673(P)/18 2873, 3947 ........... INDONESIA, Sumatera: Submarine cable ........................................................ 45, 46
637(T)/19 3471 ...................... INDONESIA, Sumatera: Buoy .......................................................................... 46
1335(T)/19 3949 ...................... INDONESIA, Sumatera: Wreck ........................................................................ 46
4676(T)/19 2152, 2155 ........... MALAYSIA, Peninsular Malaysia, West Coast: Buoyage ................................ 45
6060(P)/19 1146, 3946, 3947. MALAYSIA, Peninsular Malaysia, West Coast: Depths ................................... 45
2024(P)/20 3940, 3946, 3947 MALACCA STRAIT: Submarine cable ............................................................ 45
2031(P)/20 3833 ...................... SINGAPORE STRAIT: Anchorage areas.......................................................... 45
2218(P)/20 3833 ...................... SINGAPORE: Works ......................................................................................... 45
2221(P)/20 3833 ...................... SINGAPORE: Submarine cables ....................................................................... 45
2529(T)/20 3948 ...................... INDONESIA, Sumatera: Wreck ........................................................................ 46
2741(T)/20 2403, 3833, 3902, INDONESIA, Sumatera: Wreck ........................................................................ 45, 46
3948 ......................
2752(P)/20 8285 ...................... SINGAPORE: Automatic Identification System ............................................... 45
4198(T)/20 3902, 3947 ........... MALAYSIA, Peninsular Malaysia, West Coast: Works .................................... 45
4424(P)/20 1312, 2403, 2869, INDONESIA, Sumatera: Light-beacon ............................................................. 45, 46, 47
3831 ......................
5973(P)/20 8285 ...................... SINGAPORE: Radio reporting points ............................................................... 45
165(T)/21 3831, 3833, 3937, INDONESIA, Sumatera: Wreck ........................................................................ 45
4041 ......................
2267(T)/21 3833, 4039, 4040 SINGAPORE STRAIT: Wreck .......................................................................... 45
3009(P)/21 1312, 2403, 2414, SINGAPORE STRAIT: Works; Submarine cable ............................................. 45, 46, 47
2422, 2436, 2470,
2869, 3482, 3831
4687(P)/21 1312, 2403, 2869, INDONESIA, Sumatera: Light-beacon ............................................................. 45, 46, 47
3831, 5527 ...........
4739(T)/21 4031, 4032, 8176 SINGAPORE: Buoy; Works .............................................................................. 45
5090(T)/21 4038 ...................... SINGAPORE: Buoyage ..................................................................................... 45
142(T)/22 4031, 4032, 4039, SINGAPORE: Light-beacon; Buoy ................................................................... 45
4040, 8176 ...........
566(T)/22 4030, 4033, 4038, SINGAPORE: Depth ......................................................................................... 45
4040 ......................
788(T)/22 2152 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Buoyage ................................ 45
1294(P)/22 1312, 1348, 2414, SINGAPORE STRAIT: Submarine cables ........................................................ 46, 47, 48
2422, 2436, 2470,
2868, 3446 ...........
1494(T)/22 3901, 3945 ........... MALACCA STRAIT: Wreck; Hulk................................................................... 45
2171(T)/22 792 ........................ MALAYSIA, Peninsular Malaysia, West Coast: Buoy...................................... 45
2615(P)/22 8175 ...................... SINGAPORE: Dredged area; Dredged depth; Berth ......................................... 45
2621(P)/22 8285 ...................... SINGAPORE: Dredged depths .......................................................................... 45
2940(P)/22 8285 ...................... SINGAPORE: Pontoon...................................................................................... 45
3171(P)/22 8176 ...................... SINGAPORE: Mooring buoys........................................................................... 45
3973(T)/22 4030, 4031, 4032, SINGAPORE: Dredging area; Works ................................................................ 45
4033, 4038, 4039,
4040, 8175, 8176
4182(P)/22 830, 1140, 1141, MALACCA STRAIT: Submarine cable ............................................................ 45
1146, 2139, 2158,
2403, 3833, 3900,
3901, 3902, 3920,
3921, 3940, 3944,
3945, 3946, 3947
5073(P)/22 8175 ...................... SINGAPORE: Dredged areas; Dredged depths; Berths .................................... 45
5134(T)/22 2158 ...................... MALACCA STRAIT: Buoy .............................................................................. 45
85(T)/23 3831, 4043, 4044 SINGAPORE: Wreck; Buoy .............................................................................. 45
104(T)/23 3471 ...................... INDONESIA, Sumatera: Wreck ........................................................................ 46

1A.20
Wk04/23
 IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA
5218(T)/14 67, 2414, 3965 .... THAILAND, Gulf of Thailand Coast: Platforms............................................... 47
5355(T)/15 1059 ...................... VIETNAM: Dredged area.................................................................................. 47
6200(T)/15 1962, 1968 ........... CHINA, South Coast: Buoy............................................................................... 50
877(P)/16 1254, 1256, 1289, CHINA, Yellow Sea Coast: Precautionary area ................................................. 52
3480 ......................
1407(T)/16 2103, 3879, 3967 GULF OF THAILAND: Platform...................................................................... 47
3206(T)/16 3987 ...................... VIETNAM: Buoyage ......................................................................................... 47
3897(T)/16 1555, 3488, 3892 CHINA, South Coast: Buoy............................................................................... 47
4630(T)/16 2103 ...................... GULF OF THAILAND: Buoy........................................................................... 47
5686(T)/16 3359 ...................... CHINA, South Coast: Buoyage; Light-beacons ................................................ 47
491(T)/17 1046, 3727, 3965, THAILAND, Gulf of Thailand Coast: Restricted areas..................................... 47
3966 ......................
4123(P)/17 2641, 2642 ........... CHINA, Bo Hai: Works ..................................................................................... 52
1180(T)/18 3874 ...................... VIETNAM: Obstruction .................................................................................... 47
2358(P)/18 1036 ...................... VIETNAM: Works; Buoyage............................................................................. 47
3056(T)/18 3875 ...................... VIETNAM: Wreck............................................................................................. 47
5260(T)/18 2422, 3446, 3482 MALAYSIA, Peninsular Malaysia, East Coast: Wreck ..................................... 47
660(P)/19 8219 ...................... CHINA, East Coast: Legend .............................................................................. 50
835(P)/19 3879 ...................... VIETNAM: Buoyage ......................................................................................... 47
2660(T)/19 3875, 3888 ........... VIETNAM: Wreck............................................................................................. 47
3109(T)/19 1199, 2412, 3480. CHINA, East Coast: Buoy ................................................................................. 50, 52, 53
3365(P)/19 8217 ...................... CHINA, East Coast: Note .................................................................................. 50
3987(P)/19 1130....................... CHINA, East Coast: Bridge; Vertical clearance................................................. 50
4141(T)/19 3232 ...................... TAIWAN: Works ................................................................................................ 50
4195(T)/19 3874 ...................... VIETNAM: Wrecks; Buoyage ........................................................................... 47
4212(P)/19 8217 ...................... CHINA, East Coast: Note .................................................................................. 50
4270(T)/19 2376 ...................... TAIWAN: Breakwater........................................................................................ 50
4737(P)/19 1304 ...................... CHINA, East Coast: Submarine pipeline........................................................... 50
5381(T)/19 343 ........................ CHINA, South Coast: Works ............................................................................. 47
5385(T)/19 2657 ...................... CHINA, Bo Hai: Depth...................................................................................... 52
5627(T)/19 1716, 1723, 2401 CHINA, South Coast: Works ............................................................................. 50
6039(P)/19 8219 ...................... CHINA, East Coast: Note .................................................................................. 50
6488(T)/19 1505, 1506 ........... CHINA, Yellow Sea Coast: Works; Channel; Restricted area ........................... 52
361(T)/20 1059, 1100............ VIETNAM: Wreck............................................................................................. 47
629(P)/20 1304 ...................... CHINA, East Coast: Pier.................................................................................... 50
749(P)/20 1289 ...................... CHINA, Yellow Sea Coast: Light ...................................................................... 52
1096(T)/20 1537, 1555, 3892 CHINA, South Coast: Submarine cable............................................................. 47
1188(P)/20 1303, 1304 ........... CHINA, East Coast: Submarine cable ............................................................... 50
1660(T)/20 1046, 3724, 3727 THAILAND, Gulf of Thailand Coast: Buoyage ................................................ 47
1827(T)/20 1199, 2412............ CHINA, East Coast: Buoy ................................................................................. 50, 53
2025(P)/20 3231 ...................... TAIWAN: Depths ............................................................................................... 50
2225(P)/20 1604 ...................... CHINA, East Coast: Vertical clearance.............................................................. 50
2620(T)/20 1505, 1506 ........... CHINA, Yellow Sea Coast: Pier ........................................................................ 52
2676(T)/20 3488, 3989, 3990 CHINA: Works................................................................................................... 47
3073(P)/20 8218 ...................... CHINA, East Coast: Pilot boarding places ........................................................ 50
3766(P)/20 2642 ...................... CHINA, Bo Hai: Depths; Berths; Coastline ...................................................... 52
3867(T)/20 3447 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Anchorage area ...................... 47
3980(P)/20 8218 ...................... CHINA, East Coast: Pilot boarding places ........................................................ 50
4470(P)/20 8218 ...................... CHINA, East Coast: Maritime limit; Pilot boarding place ................................ 50
4482(P)/20 8217, 8218 ........... CHINA, East Coast: Pilot boarding place.......................................................... 50
4506(P)/20 1761, 3231, 3658 TAIWAN: Works; Buoyage................................................................................ 50
4508(T)/20 1968, 3489 ........... TAIWAN STRAIT: Wreck ................................................................................. 48, 50
4813(P)/20 1250, 2645 ........... CHINA, Bo Hai: Depths .................................................................................... 52
5048(P)/20 8218 ...................... CHINA, East Coast: Anchorage areas; Pilot boarding places; Legend ............. 50
5054(P)/20 8218 ...................... CHINA, East Coast: Anchorage areas ............................................................... 50
5109(P)/20 1036 ...................... VIETNAM: Works; Bridge; Buoyage................................................................ 47
5184(T)/20 1536, 1537 ........... CHINA, South Coast: Works ............................................................................. 47

1A.21
Wk04/23
 IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
5204(T)/20 2376, 3230, 3232 TAIWAN: Works ................................................................................................ 50
5637(P)/20 967, 1338, 3483, SOUTH CHINA SEA: Fish havens ................................................................... 47, 48, 57,
3489, 4411, 4414, 59
4464, 4507, 4508,
4509 ......................
6104(T)/20 3989 ...................... VIETNAM: Wreck............................................................................................. 47
6251(P)/20 1252 ...................... CHINA, Bo Hai: Piers........................................................................................ 52
6269(T)/20 3988 ...................... VIETNAM: Wreck............................................................................................. 47
158(T)/21 4123 ...................... CHINA, South Coast: Works; Buoyage ............................................................. 50
170(T)/21 2409, 3232 ........... TAIWAN: Works ................................................................................................ 50
589(P)/21 8127 ...................... CHINA, East Coast: Radio reporting points ...................................................... 50
596(T)/21 2412, 3235, 3236 TAIWAN: Restricted area .................................................................................. 50, 53
751(T)/21 1761, 1968, 3231 TAIWAN: Obstructions...................................................................................... 50
999(P)/21 341, 3026, 4129 .. CHINA, South Coast: Works ............................................................................. 47, 50
1320(T)/21 2645 ...................... CHINA, Bo Hai: Wreck ..................................................................................... 52
1435(T)/21 341, 3026, 4129 .. CHINA, South Coast: Works; Buoyage; Reclamation area; Automatic 47, 50
Identification Systems ........................................................................................
1454(T)/21 1760, 2409 ........... TAIWAN: Obstruction ....................................................................................... 50
1470(T)/21 3488, 3988, 3989 VIETNAM: Works; Offshore installation.......................................................... 47
1471(P)/21 3874 ...................... VIETNAM: Submarine power cable; Buoyage ................................................. 47
1565(T)/21 4117, 4126, 4127. CHINA, South Coast: Works ............................................................................. 47
1664(P)/21 809 ........................ CHINA, Yellow Sea Coast: Berth; Depth .......................................................... 52
1823(P)/21 54 .......................... CHINA, South Coast: Breakwater ..................................................................... 47
1983(P)/21 5527 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Jetty; Anchorage areas ........... 45
2042(T)/21 3999 ...................... CHINA, South Coast: Dredged area .................................................................. 47
2260(T)/21 4117, 4126............ CHINA, South Coast: Works; Buoyage ............................................................. 47
2336(P)/21 1760, 1968, 2409, TAIWAN: Works ................................................................................................ 50
3231 ......................
2471(P)/21 5527 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Restricted area; Legend ......... 45
2769(T)/21 4117, 4126............ CHINA, South Coast: Buoyage; Works ............................................................. 47
3254(T)/21 1760, 1761, 1968, TAIWAN STRAIT: Firing practice areas........................................................... 48, 50, 53
2409, 2412, 3236,
3489, 3658, 4410
3265(T)/21 1968, 3236, 3489, TAIWAN: Firing practice areas.......................................................................... 48, 50
4410 ......................
3282(T)/21 2376, 3230 ........... TAIWAN: Works ................................................................................................ 50
3363(T)/21 2618 ...................... TAIWAN: Works; Buoyage................................................................................ 50
3513(P)/21 2657 ...................... CHINA, Bo Hai: Depths .................................................................................... 52
3775(T)/21 1304 ...................... CHINA, East Coast: Buoyage............................................................................ 50
3954(T)/21 1059, 1100............ VIETNAM: Works ............................................................................................. 47
4157(T)/21 1249, 1256 ........... CHINA, Bo Hai: Obstruction; Area to be avoided ............................................ 52
4313(P)/21 1536, 1537, 1555, CHINA, South Coast: Submarine power cable.................................................. 47
3892 ......................
4399(P)/21 1254, 1256 ........... CHINA, Yellow Sea Coast: Wind farm.............................................................. 52
4493(T)/21 2645 ...................... CHINA, Bo Hai: Works ..................................................................................... 52
4555(T)/21 809 ........................ CHINA, Yellow Sea Coast: Pier; Works ............................................................ 52
4622(P)/21 103, 341, 937, CHINA, South Coast: Submarine cable............................................................. 47, 48, 50
1968, 3026, 3488,
3489, 3890 ...........
4767(T)/21 1537, 1555 ........... CHINA, South Coast: Submarine cable............................................................. 47
4845(P)/21 1285 ...................... CHINA, East Coast: Drying patch ..................................................................... 52
4851(T)/21 1281 ...................... CHINA, East Coast: Buoy; Wreck..................................................................... 52
4862(T)/21 1760, 2409 ........... TAIWAN: Buoyage ............................................................................................ 50
4873(P)/21 1059, 1100............ VIETNAM: Buoyage; Beacons; Depths; Jetty; Channels; Automatic 47
Identification System; Wreck; Anchorage areas; Swinging circle .....................
5069(P)/21 8217 ...................... CHINA, East Coast: Buoy ................................................................................. 50
5104(P)/21 8217 ...................... CHINA, East Coast: Legend .............................................................................. 50
5350(P)/21 1126, 8218............ CHINA, East Coast: Overhead cable; Safe vertical clearance........................... 50

1A.22
Wk04/23
 IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
5499(T)/21 2619 ...................... TAIWAN: Buoy.................................................................................................. 50
382(T)/22 1199, 1305, 1759. CHINA, East Coast: Wrecks; Buoyage; Virtual aids to navigation ................... 50
386(T)/22 1059 ...................... VIETNAM: Buoyage ......................................................................................... 47
389(T)/22 1261, 3482, 3488, VIETNAM: Light............................................................................................... 47
3986, 3987 ...........
515(P)/22 1379 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Breakwater; Lights; Quay; 47
Depths; Maintained channels .............................................................................
536(P)/22 8127 ...................... CHINA, East Coast: Virtual aids to navigation.................................................. 50
578(T)/22 1719, 1760 ........... CHINA, East Coast: Buoyage; Virtual aid to navigation................................... 50
598(T)/22 3884 ...................... VIETNAM: Wreck............................................................................................. 47
1105(P)/22 1126, 1130, 1134, CHINA, East Coast: Recommended routes ....................................................... 50
1144, 1155, 1199,
1303, 1304, 1305,
1306, 1592, 1602,
1721, 1738, 1754,
1759, 1763, 8216,
8217, 8218, 8219
1267(P)/22 8218, 8219 ........... CHINA, East Coast: Spoil ground; Overhead cable .......................................... 50
1288(T)/22 1759 ...................... CHINA, East Coast: Buoyage; Wreck; Virtual aid to navigation ...................... 50
1484(P)/22 4123, 4129 ........... CHINA, South Coast: Works; Buoyage; Automatic Identification Systems ..... 47, 50
1530(P)/22 1250, 2645 ........... CHINA, Bo Hai: Depths; Channel; Buoyage .................................................... 52
1531(T)/22 1249 ...................... CHINA, Bo Hai: Wreck ..................................................................................... 52
1557(T)/22 809 ........................ CHINA, Yellow Sea Coast: Works..................................................................... 52
1558(T)/22 3938 ...................... CHINA, South Coast: Reef; Works.................................................................... 47
1591(P)/22 3892 ...................... CHINA, South Coast: Traffic separation scheme; Precautionary areas............. 47
1636(T)/22 1134....................... CHINA, East Coast: Buoyage; Virtual aid to navigation; Wreck ...................... 50
1795(T)/22 3890, 3892 ........... CHINA, South Coast: Platforms ........................................................................ 47
1873(T)/22 1126, 1130, 8218, CHINA, East Coast: Reef; Works ...................................................................... 50
8219 ......................
2011(P)/22 8126 ...................... CHINA, East Coast: Buoy ................................................................................. 50
2048(P)/22 8218, 8219 ........... CHINA, East Coast: Buoy; Automatic Identification System; Virtual aid to 50
navigation ...........................................................................................................
2052(P)/22 8216 ...................... CHINA, East Coast: Beacon; Radar beacon ...................................................... 50
2081(P)/22 8219 ...................... CHINA, East Coast: Vertical clearance.............................................................. 50
2186(T)/22 4119, 4122............ CHINA, South Coast: Dredging area; Works .................................................... 47
2199(T)/22 1100, 1261............ VIETNAM: Wreck; Buoy; Works...................................................................... 47
2375(T)/22 4043, 4044 ........... MALAYSIA, Peninsular Malaysia, East Coast: Light-beacon; Buoy ............... 45
2414(T)/22 4117....................... CHINA, South Coast: Works ............................................................................. 47
2482(T)/22 4122, 4123 ........... CHINA, South Coast: Reef ................................................................................ 47, 50
2795(T)/22 343, 344, 349 ...... CHINA, South Coast: Buoyage; Virtual aids to navigation............................... 47
2927(P)/22 1100....................... VIETNAM: Works; Development area; Buoyage ............................................. 47
3021(P)/22 8124 ...................... CHINA, East Coast: Depths; Drying patch; Anchorage area ............................ 50
3052(P)/22 1601 ...................... CHINA, East Coast: Depths............................................................................... 50
3380(T)/22 3986 ...................... VIETNAM: Buoy; Works .................................................................................. 47
3439(P)/22 8124 ...................... CHINA, East Coast: Buoy; Radar beacon ......................................................... 50
3546(P)/22 8217 ...................... CHINA, East Coast: Vertical clearance; Horizontal clearance .......................... 50
3568(P)/22 1965, 3990 ........... VIETNAM: Submarine power cables ................................................................ 47
3712(P)/22 8124 ...................... CHINA, East Coast: Note .................................................................................. 50
3807(P)/22 1201, 1206, 1249, CHINA, Yellow Sea Coast: Recommended routes ............................................ 52
1250, 1253, 1254,
1255, 1256, 1263,
1289, 1294, 1295,
1316, 1317, 1501,
1502, 8153 ...........
3882(P)/22 1100, 1261............ VIETNAM: Works; Buoyage; Submarine cable................................................ 47
3924(T)/22 1254, 1289 ........... CHINA, Yellow Sea Coast: Restricted area ....................................................... 52
3934(P)/22 8152 ...................... CHINA, Yellow Sea Coast: Virtual aid to navigation ........................................ 52

1A.23
Wk04/23
 IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
3935(P)/22 1199, 1306, 1602, CHINA, East Coast: Traffic separation scheme; Separation zones; 50, 52, 53
2412, 3480, 8127, Precautionary areas; Restricted areas.................................................................
8216 ......................
4018(P)/22 3449, 3452, 3453 CHINA, East Coast: Alongside depths; Depths; Fairway; Reef ........................ 50
4054(T)/22 3488, 3988 ........... VIETNAM: Wreck............................................................................................. 47
4086(T)/22 2618 ...................... TAIWAN: Works ................................................................................................ 50
4100(T)/22 1592 ...................... CHINA, East Coast: Works................................................................................ 50
4213(T)/22 1965, 3875, 3881 VIETNAM: Wreck; Virtual aid to navigation; Buoy ......................................... 47
4218(T)/22 1965, 3875, 3990 VIETNAM: Wreck; Virtual aid to navigation.................................................... 47
4254(T)/22 937, 1555, 1962, CHINA, South Coast: Works ............................................................................. 47, 50
3026, 4126 ...........
4295(T)/22 344 ........................ CHINA, South Coast: Light-beacons................................................................. 47
4297(T)/22 344 ........................ CHINA, South Coast: Buoyage ......................................................................... 47
4530(T)/22 809, 1501 ............. CHINA, Yellow Sea Coast: Works; Breakwater ................................................ 52
4741(P)/22 3881 ...................... VIETNAM: Wrecks; Anchor berths; Buoyage; Vertical clearance; Radar 47
beacons; Light-beacon .......................................................................................
4745(P)/22 1557 ...................... CHINA, South Coast: Depths ............................................................................ 47
4923(T)/22 1253, 3480 ........... CHINA, Yellow Sea Coast: Wreck .................................................................... 52
4946(T)/22 3875, 3881 ........... VIETNAM: Wreck............................................................................................. 47
5055(P)/22 986, 1046 ............. THAILAND, Gulf of Thailand Coast: Jetty; Works; Buoyage.......................... 47
244(P)/23 1261 ...................... VIETNAM: Works; Wind farm; Wind turbines; Lights; Automatic 47
Identification Systems; Buoyage........................................................................
263(T)/23 1760, 2409, 3231 TAIWAN: Buoyage; Virtual aids to navigation ................................................. 50
15. JAPAN
2962(T)/07 JP 1087................... JAPAN, Honshū: Depths.................................................................................... 53
3852(T)/07 JP 87....................... JAPAN, Honshū: Depths.................................................................................... 53
2050(T)/09 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
2051(T)/09 JP 80....................... JAPAN, Honshū: Depth ..................................................................................... 53
2667(T)/09 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
3043(T)/09 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
3781(T)/09 2024, JP 226.......... JAPAN, Nansei Shotō: Depth; Rock.................................................................. 53
4060(T)/09 JP 107..................... JAPAN, Seto Naikai: Obstruction ...................................................................... 54
4209(T)/09 JP 226..................... JAPAN, Nansei Shotō: Depths........................................................................... 53
4523(T)/09 JP 179, JP 187 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
5182(T)/09 JP 1062, JP 1067 .... JAPAN, Honshū: Depths.................................................................................... 53
5469(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
6128(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
2781(T)/10 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 1228...................
3116(T)/10 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
3611(T)/10 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 1228...................
5507(T)/10 JP 213..................... JAPAN, Kyūshū: Rock....................................................................................... 53
6140(T)/10 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
526(T)/11 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
785(T)/11 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
1866(T)/11 JP 104, JP 132 ........ JAPAN, Seto Naikai: Depth ............................................................................... 54
2285(T)/11 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
3253(T)/11 JP 198, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
4930(T)/11 JP 131..................... JAPAN, Seto Naikai: Wreck .............................................................................. 54
4931(T)/11 JP 106, JP 131 ........ JAPAN, Seto Naikai: Wreck .............................................................................. 54
5883(T)/11 JP 137A.................. JAPAN, Seto Naikai: Depth ............................................................................... 54
538(T)/12 JP 131..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
640(T)/12 JP 106, JP 137A, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 153.....................
2143(T)/12 JP 1106................... JAPAN, Seto Naikai: Drying patch.................................................................... 54
3857(T)/12 JP 132..................... JAPAN, Seto Naikai: Depth ............................................................................... 54

1A.24
Wk04/23
 IA
15. JAPAN - continued
5197(T)/12 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
5697(T)/12 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
58(T)/13 JP 87....................... JAPAN, Honshū: Depths.................................................................................... 53
1029(T)/13 JP 187..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1909(T)/13 JP 137A.................. JAPAN, Seto Naikai: Rock ................................................................................ 54
2368(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2692(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
2831(T)/13 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
2832(T)/13 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
3137(T)/13 JP 106, JP 150A, JAPAN, Seto Naikai: Wreck .............................................................................. 54
JP 150C ..................
3833(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
3834(T)/13 JP 198, JP 1228 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
3835(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
4132(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
4133(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
5219(T)/13 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depth ............................................................................... 54
196(T)/14 996, 1648, JP 77, JAPAN, Seto Naikai: Wreck .............................................................................. 53, 54
JP 150C ..................
2751(T)/14 JP 179..................... JAPAN, Honshū: Depths.................................................................................... 53
2916(T)/14 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depth ............................................................................... 54
3693(T)/14 JP 1169................... JAPAN, Honshū: Depth ..................................................................................... 55
4183(T)/14 JP 1102................... JAPAN, Seto Naikai: Depths ............................................................................. 54
4687(T)/14 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
4805(T)/14 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
4963(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
5209(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depth ..................................................................................... 53
5210(T)/14 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
5470(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
5725(T)/14 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
5727(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
33(T)/15 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
968(T)/15 JP 80....................... JAPAN, Honshū: Depth ..................................................................................... 53
1444(T)/15 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
1698(T)/15 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
2493(T)/15 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
3163(T)/15 JP 108..................... JAPAN, Shikoku: Depth .................................................................................... 53
3298(T)/15 JP 54....................... JAPAN, Honshū: Depth ..................................................................................... 55
3552(T)/15 JP 179, JP 187, JAPAN, Kyūshū: Obstruction ............................................................................ 53
JP 1228...................
3553(T)/15 JP 179, JP 198 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
3684(T)/15 JP 1051................... JAPAN, Honshū: Depth ..................................................................................... 53
3685(T)/15 JP 1053................... JAPAN, Honshū: Depth ..................................................................................... 53
3806(T)/15 JP 93, JP 1051 ........ JAPAN, Honshū: Depth ..................................................................................... 53
3929(T)/15 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
3930(T)/15 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
4168(T)/15 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
4924(T)/15 JP 1112A ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
1638(T)/16 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1773(T)/16 JP 1102................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2485(T)/16 JP 142..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2705(T)/16 JP 93, JP 1051 ........ JAPAN, Honshū: Depths.................................................................................... 53
3085(T)/16 JP 1098................... JAPAN, Honshū: Depths.................................................................................... 55
3157(T)/16 JP 141, JP 142 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
3160(T)/16 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
3282(T)/16 JP 131, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
4045(T)/16 JP 1192................... JAPAN, Honshū: Obstruction ............................................................................ 55

1A.25
Wk04/23
 IA
15. JAPAN - continued
5126(T)/16 JP 187, JP 213 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
5264(T)/16 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
6268(T)/16 JP 179, JP 187 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
431(T)/17 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
435(T)/17 JP 201, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
782(T)/17 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depths ............................................................................. 54
784(T)/17 JP 187..................... JAPAN, Kyūshū: Wreck..................................................................................... 53
899(T)/17 JP 79....................... JAPAN, Honshū: Obstruction ............................................................................ 55
1395(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
1509(T)/17 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1626(T)/17 JP 107..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1627(T)/17 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1907(T)/17 JP 93....................... JAPAN, Honshū: Depths.................................................................................... 53
2047(T)/17 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2048(T)/17 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2162(T)/17 JP 79....................... JAPAN, Honshū: Islets....................................................................................... 55
2444(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
3351(T)/17 JP 137B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
3465(T)/17 JP 201, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
3957(T)/17 JP 1051, JP 1052 .... JAPAN, Honshū: Depths.................................................................................... 53
3958(T)/17 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 213.....................
4214(T)/17 JP 187, JP 213, JAPAN, Kyūshū: Depth ..................................................................................... 53
JP 1222...................
4358(T)/17 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
4482(T)/17 JP 179, JP 187, JAPAN, Kyūshū: Wreck..................................................................................... 53
JP 198, JP 213 ........
4847(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
4953(T)/17 JP 1052................... JAPAN, Honshū: Depths.................................................................................... 53
5216(T)/17 JP 70, JP 1051, JAPAN, Honshū: Depths.................................................................................... 53
JP 1053...................
5218(T)/17 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
5220(T)/17 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
5941(T)/17 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
6023(T)/17 JP 54....................... JAPAN, Honshū: Depths.................................................................................... 55
144(T)/18 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
856(T)/18 JP 1062................... JAPAN, Honshū: Depths.................................................................................... 53
1083(T)/18 JP 79....................... JAPAN, Honshū: Obstructions........................................................................... 55
1507(T)/18 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Obstructions .................................................................... 54
1609(T)/18 JP 1051, JP 1052, JAPAN, Honshū: Depths.................................................................................... 53
JP 1053, JP 1064 ....
1613(T)/18 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1614(T)/18 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1615(T)/18 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1694(T)/18 JP 1103................... JAPAN, Seto Naikai: Depths ............................................................................. 54
3153(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
3420(T)/18 JP 1086................... JAPAN, Honshū: Depths.................................................................................... 53
4747(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
5095(T)/18 JP 70, JP 1051, JAPAN, Honshū: Depths.................................................................................... 53
JP 1052, JP 1053,
JP 1064...................
5368(T)/18 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
5484(T)/18 JP 1112A ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
5485(T)/18 JP 1112A, JP 1112B JAPAN, Seto Naikai: Depths ............................................................................. 54
5486(T)/18 JP 1206................... JAPAN, Nansei Shotō: Depths........................................................................... 53
5699(T)/18 JP 149..................... JAPAN, Honshū: Fish trap ................................................................................. 55
5701(T)/18 JP 153, JP 1108 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54

1A.26
Wk04/23
 IA
15. JAPAN - continued
559(T)/19 JP 104, JP 153, JAPAN, Seto Naikai: Depth ............................................................................... 54
JP 1108...................
859(T)/19 JP 139..................... JAPAN, Honshū: Depth ..................................................................................... 55
1355(T)/19 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
2273(T)/19 JP 1107................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2410(T)/19 JP 1206................... JAPAN, Nansei Shotō: Depths........................................................................... 53
2649(T)/19 JP 112..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2796(T)/19 JP 112..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2891(T)/19 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
3066(T)/19 JP 94....................... JAPAN, Honshū: Depths.................................................................................... 53
3255(T)/19 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
5880(T)/19 JP 226..................... JAPAN, Nansei Shotō: Depths........................................................................... 53
6045(T)/19 JP 150A.................. JAPAN: Depths .................................................................................................. 54
6048(T)/19 JP 150A.................. JAPAN: Depths .................................................................................................. 54
6114(T)/19 JP 1192................... JAPAN, Honshū: Depths.................................................................................... 55
6136(T)/19 JP 31....................... JAPAN, Hokkaidō: Depths ................................................................................ 55
318(T)/20 JP 70, JP 1051, JAPAN, Honshū: Obstruction ............................................................................ 53
JP 1052...................
602(T)/20 JP 66....................... JAPAN, Honshū: Depths.................................................................................... 53
1786(T)/20 JP 190, JP 1227 ...... JAPAN, Kyūshū: Drying heights ....................................................................... 53
2204(T)/20 JP 1030, JP 1034, JAPAN, Hokkaidō: Obstruction......................................................................... 55
JP 1036...................
2699(T)/20 JP 1155B ................ JAPAN, Honshū: Depths.................................................................................... 55
2940(T)/20 JP 1109................... JAPAN, Seto Naikai: Depth ............................................................................... 54
3744(T)/20 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
3947(T)/20 JP 94....................... JAPAN, Honshū: Depths.................................................................................... 53
4077(T)/20 JP 1141................... JAPAN, Seto Naikai: Depths ............................................................................. 54
4436(T)/20 JP 1102, JP 1108 .... JAPAN, Seto Naikai: Depths ............................................................................. 54
4529(T)/20 JP 1195................... JAPAN, Honshū: Buoy ...................................................................................... 55
4718(T)/20 JP 67, JP 1061, JAPAN, Honshū: Depths.................................................................................... 53
JP 1062...................
4823(T)/20 JP 67....................... JAPAN, Honshū: Depth ..................................................................................... 53
4914(T)/20 JP 1112A ................ JAPAN, Seto Naikai: Depth ............................................................................... 54
5074(T)/20 JP 90, JP 1062, JAPAN, Honshū: Obstruction ............................................................................ 53
JP 1081, JP 1085 ....
5263(T)/20 JP 1088................... JAPAN, Honshū: Depth ..................................................................................... 53
5530(T)/20 JP 1162A ................ JAPAN, Honshū: Depths.................................................................................... 55
6003(T)/20 JP 1107................... JAPAN, Seto Naikai: Depths ............................................................................. 54
6121(T)/20 JP 106..................... JAPAN, Seto Naikai: Rock ................................................................................ 54
6122(T)/20 JP 106, JP 137A, JAPAN, Seto Naikai: Rocks............................................................................... 54
JP 153.....................
370(T)/21 JP 1155B ................ JAPAN, Honshū: Obstruction ............................................................................ 55
374(T)/21 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
847(T)/21 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
1069(T)/21 JP 79....................... JAPAN, Honshū: Depth ..................................................................................... 55
1073(T)/21 JP 187, JP 213 ........ JAPAN, Kyūshū: Offshore installation; Obstruction; Submarine power cables 53
1171(T)/21 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1172(T)/21 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
1447(T)/21 JP 1052, JP 1057A, JAPAN, Honshū: Depths.................................................................................... 53
JP 1057B ................
1541(T)/21 JP 1180................... JAPAN, Honshū: Depths.................................................................................... 55
1542(T)/21 JP 1197................... JAPAN, Honshū: Depths.................................................................................... 55
1543(T)/21 JP 123, JP 1103 ...... JAPAN, Seto Naikai: Restricted area ................................................................. 54
1636(T)/21 JP 149..................... JAPAN, Honshū: Works..................................................................................... 55
1740(T)/21 JP 1197................... JAPAN, Honshū: Fish traps ............................................................................... 55
1745(T)/21 JP 1055A................ JAPAN, Honshū: Works..................................................................................... 53
1850(T)/21 JP 1172................... JAPAN, Honshū: Obstruction ............................................................................ 55

1A.27
Wk04/23
 IA
15. JAPAN - continued
1932(T)/21 JP 1067................... JAPAN, Honshū: Depths.................................................................................... 53
2194(T)/21 JP 1109................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2368(T)/21 JP 123..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2440(T)/21 JP 148..................... JAPAN, Honshū: Depths.................................................................................... 55
2447(T)/21 JP 1101................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2610(T)/21 JP 104, JP 132, JAPAN, Seto Naikai: Wreck .............................................................................. 54
JP 141, JP 1108 ......
2645(T)/21 JP 1155B ................ JAPAN, Honshū: Depths.................................................................................... 55
2647(T)/21 JP 134B .................. JAPAN, Seto Naikai: Depths; Drying heights ................................................... 54
2806(T)/21 JP 1162A ................ JAPAN, Honshū: Depths.................................................................................... 55
2807(T)/21 JP 106, JP 150A, JAPAN, Seto Naikai: Obstruction ...................................................................... 54
JP 1103...................
2809(T)/21 JP 134B .................. JAPAN, Seto Naikai: Works............................................................................... 54
2912(T)/21 JP 87, JP 90, JP 1061, JAPAN, Honshū: Works..................................................................................... 53
JP 1086...................
2913(T)/21 JP 1057A................ JAPAN, Honshū: Depths.................................................................................... 53
2917(T)/21 JP 128..................... JAPAN, Seto Naikai: Works............................................................................... 54
3041(T)/21 JP 137A, JP 137B, JAPAN, Seto Naikai: Works............................................................................... 54
JP 153.....................
3042(T)/21 JP 126, JP 1106 ...... JAPAN, Seto Naikai: Dredging area; Works...................................................... 54
3164(T)/21 JP 1055A, JP 1055B JAPAN, Honshū: Obstruction ............................................................................ 53
3207(T)/21 JP 31....................... JAPAN, Hokkaidō: Works.................................................................................. 55
3209(T)/21 JP 1162A ................ JAPAN, Honshū: Depths.................................................................................... 55
3212(T)/21 JP 1049................... JAPAN, Honshū: Depths.................................................................................... 53
3215(T)/21 JP 1137................... JAPAN, Seto Naikai: Buoy ................................................................................ 54
3458(T)/21 JP 137B, JP 153, JAPAN, Seto Naikai: Dredging areas................................................................. 54
JP 1121...................
3549(T)/21 2293, 2347, JP 145 JAPAN, Honshū: Submarine cables; Works ...................................................... 53, 55
3551(T)/21 JP 1127B ................ JAPAN, Seto Naikai: Works............................................................................... 54
3552(T)/21 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Works............................................................................... 54
3554(T)/21 JP 214A, JP 214B... JAPAN, Kyūshū: Works..................................................................................... 53
3663(T)/21 JP 65....................... JAPAN, Honshū: Virtual aid to navigation ........................................................ 55
3760(T)/21 JP 1169................... JAPAN, Honshū: Depth ..................................................................................... 55
3764(T)/21 JP 101A, JP 101B... JAPAN, Seto Naikai: Works............................................................................... 54
3765(T)/21 JP 101B .................. JAPAN, Seto Naikai: Works............................................................................... 54
3767(T)/21 JP 153, JP 1108 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
3872(T)/21 JP 126..................... JAPAN, Seto Naikai: Pier; Works ...................................................................... 54
4215(T)/21 JP 148..................... JAPAN, Honshū: Works..................................................................................... 55
4217(T)/21 JP 126, JP 1106 ...... JAPAN, Seto Naikai: Dredging area; Works...................................................... 54
4363(T)/21 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
4365(T)/21 JP 198, JP 1228 ...... JAPAN, Kyūshū: Works..................................................................................... 53
4366(T)/21 JP 153..................... JAPAN, Seto Naikai: Wreck .............................................................................. 54
4504(T)/21 JP 1120................... JAPAN, Seto Naikai: Drying height .................................................................. 54
4506(T)/21 JP 127, JP 1101 ...... JAPAN, Seto Naikai: Works............................................................................... 54
4507(T)/21 JP 135, JP 1262, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1263...................
4636(T)/21 JP 63....................... JAPAN, Honshū: Breakwater; Works ................................................................ 55
4637(T)/21 JP 95, JP 1051 ........ JAPAN, Honshū: Wreck..................................................................................... 53
4638(T)/21 JP 95, JP 1055B ..... JAPAN, Honshū: Obstruction ............................................................................ 53
4639(T)/21 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
4789(T)/21 JP 64B .................... JAPAN, Honshū: Buoyage ................................................................................. 55
4790(T)/21 JP 1067................... JAPAN, Honshū: Depths.................................................................................... 53
4791(T)/21 JP 127, JP 129 ........ JAPAN, Seto Naikai: Works............................................................................... 54
4904(T)/21 JP 31....................... JAPAN, Hokkaidō: Dredging areas; Works ....................................................... 55
4905(T)/21 JP 11....................... JAPAN, Hokkaidō: Depth .................................................................................. 55
4907(T)/21 JP 123..................... JAPAN, Seto Naikai: Works............................................................................... 54
4908(T)/21 JP 123..................... JAPAN, Seto Naikai: Depth ............................................................................... 54

1A.28
Wk04/23
 IA
15. JAPAN - continued
5013(T)/21 JP 131, JP 150A ..... JAPAN, Seto Naikai: Buoyage........................................................................... 54
5014(T)/21 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5016(T)/21 JP 1120................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5139(T)/21 JP 1061, JP 1065 .... JAPAN, Honshū: Works..................................................................................... 53
5140(T)/21 JP 134B .................. JAPAN, Seto Naikai: Works............................................................................... 54
5141(T)/21 JP 1263................... JAPAN, Seto Naikai: Drying patches ................................................................ 54
5266(T)/21 JP 63....................... JAPAN, Honshū: Works..................................................................................... 55
5267(T)/21 JP 1061................... JAPAN, Honshū: Works; Restricted area ........................................................... 53
5268(T)/21 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
5401(T)/21 JP 1061, JP 1065 .... JAPAN, Honshū: Light-beacons ........................................................................ 53
5403(T)/21 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
5513(T)/21 JP 123..................... JAPAN, Seto Naikai: Works............................................................................... 54
5515(T)/21 JP 127, JP 129 ........ JAPAN, Seto Naikai: Works............................................................................... 54
200(T)/22 JP 1100................... JAPAN, Honshū: Buoyage ................................................................................. 55
202(T)/22 JP 101A, JP 101B... JAPAN, Seto Naikai: Works............................................................................... 54
204(T)/22 JP 101A, JP 101B... JAPAN, Seto Naikai: Works............................................................................... 54
339(T)/22 JP 1033A, JP 1036 . JAPAN, Hokkaidō: Works.................................................................................. 55
340(T)/22 JP 1162A, JP 1162B JAPAN, Honshū: Buoyage ................................................................................. 55
343(T)/22 1648, JP 77, JP 108 JAPAN, Shikoku: Buoy...................................................................................... 53
442(T)/22 JP 153..................... JAPAN, Seto Naikai: Submarine power cables; Works ..................................... 54
443(T)/22 JP 141..................... JAPAN, Seto Naikai: Fish havens; Obstruction................................................. 54
646(T)/22 JP 31....................... JAPAN, Hokkaidō: Works; Dredging areas ....................................................... 55
724(T)/22 JP 65....................... JAPAN, Honshū: Depths; Obstructions ............................................................. 55
725(T)/22 JP 64A.................... JAPAN, Honshū: Buoyage ................................................................................. 55
726(T)/22 JP 137A.................. JAPAN, Seto Naikai: Buoy ................................................................................ 54
833(T)/22 JP 1110 ................... JAPAN, Seto Naikai: Depth ............................................................................... 54
834(T)/22 JP 101A, JP 101B... JAPAN, Seto Naikai: Works............................................................................... 54
835(T)/22 2024, JP 226.......... JAPAN, Nansei Shotō: Depths........................................................................... 53
991(T)/22 JP 63....................... JAPAN, Honshū: Depths; Obstructions ............................................................. 55
1101(T)/22 JP 148..................... JAPAN, Honshū: Dredging area ........................................................................ 55
1322(T)/22 JP 148..................... JAPAN, Honshū: Dredging areas; Works .......................................................... 55
1327(T)/22 JP 123, JP 1107 ...... JAPAN, Seto Naikai: Depths ............................................................................. 54
1328(T)/22 JP 123, JP 1103 ...... JAPAN, Seto Naikai: Restricted area ................................................................. 54
1406(T)/22 JP 1127A ................ JAPAN, Seto Naikai: Obstruction ...................................................................... 54
1506(T)/22 JP 1055A................ JAPAN, Honshū: Works..................................................................................... 53
1508(T)/22 JP 1227................... JAPAN, Kyūshū: Depths.................................................................................... 53
1587(T)/22 JP 10, JP 1195 ........ JAPAN, Hokkaidō: Works.................................................................................. 55
1588(T)/22 JP 67, JP 1061, JAPAN, Honshū: Restricted area; Works ........................................................... 53
JP 1062...................
1589(T)/22 JP 1057A................ JAPAN, Honshū: Works..................................................................................... 53
1590(T)/22 JP 1247B ................ JAPAN, Seto Naikai: Obstruction ...................................................................... 53
1654(T)/22 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
1655(T)/22 JP 1107................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1656(T)/22 JP 1127B ................ JAPAN, Seto Naikai: Works............................................................................... 54
1790(T)/22 JP 5......................... JAPAN, Hokkaidō: Depths ................................................................................ 55
1792(T)/22 JP 1055A................ JAPAN, Honshū: Works..................................................................................... 53
1934(T)/22 JP 28....................... JAPAN, Hokkaidō: Works.................................................................................. 55
1935(T)/22 JP 1100................... JAPAN, Honshū: Breakwater............................................................................. 55
1936(T)/22 JP 94....................... JAPAN, Honshū: Works..................................................................................... 53
1938(T)/22 JP 1206................... JAPAN, Nansei Shotō: Depths........................................................................... 53
2293(T)/22 1800, 1801, JP 28. JAPAN, Hokkaidō: Marine farms ...................................................................... 55, 56
2295(T)/22 JP 1062, JP 1067 .... JAPAN, Honshū: Works..................................................................................... 53
2296(T)/22 JP 1086................... JAPAN, Honshū: Works..................................................................................... 53
2297(T)/22 JP 1056................... JAPAN, Honshū: Works..................................................................................... 53
2298(T)/22 JP 134B .................. JAPAN, Seto Naikai: Works............................................................................... 54
2299(T)/22 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
2300(T)/22 JP 1112A, JP 1112B JAPAN, Seto Naikai: Depths; Obstruction ........................................................ 54

1A.29
Wk04/23
 IA
15. JAPAN - continued
2461(T)/22 JP 28....................... JAPAN, Hokkaidō: Works.................................................................................. 55
2462(T)/22 JP 28....................... JAPAN, Hokkaidō: Works; Piles; Buoyage; Wave recorder .............................. 55
2463(T)/22 JP 1155B ................ JAPAN, Honshū: Depths.................................................................................... 55
2464(T)/22 JP 148, JP 1192 ...... JAPAN, Honshū: Works; Restricted area; Breakwater ...................................... 55
2465(T)/22 JP 1098................... JAPAN, Honshū: Buoy ...................................................................................... 55
2466(T)/22 JP 150A, JP 1103, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1141...................
2467(T)/22 JP 150A, JP 1103, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1141...................
2468(T)/22 JP 135, JP 1262, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1263...................
2558(T)/22 JP 1150................... JAPAN, Seto Naikai: Depths; Drying patch ...................................................... 54
2560(T)/22 JP 106, JP 137A, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 153.....................
2561(T)/22 JP 142, JP 1112A.... JAPAN, Seto Naikai: Works; Submarine cables ................................................ 54
2562(T)/22 JP 135, JP 1262, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1263...................
2563(T)/22 JP 135, JP 1262, JAPAN, Seto Naikai: Buoy ................................................................................ 54
JP 1263...................
2675(T)/22 JP 1033A................ JAPAN, Hokkaidō: Depths ................................................................................ 55
2676(T)/22 JP 1155A ................ JAPAN, Honshū: Works..................................................................................... 55
2677(T)/22 JP 1088................... JAPAN, Honshū: Works..................................................................................... 53
2776(T)/22 JP 148..................... JAPAN, Honshū: Dredging areas; Works .......................................................... 55
2777(T)/22 JP 1055A................ JAPAN, Honshū: Works..................................................................................... 53
2904(T)/22 JP 179, JP 187, JAPAN, Kyūshū: Works..................................................................................... 53
JP 198, JP 213 ........
2978(T)/22 JP 1061, JP 1086 .... JAPAN, Honshū: Works..................................................................................... 53
2980(T)/22 JP 101A.................. JAPAN, Seto Naikai: Works............................................................................... 54
3042(T)/22 JP 148..................... JAPAN, Honshū: Works; Dredging areas .......................................................... 55
3119(T)/22 JP 1162B ................ JAPAN, Honshū: Depths.................................................................................... 55
3120(T)/22 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Works............................................................................... 54
3177(T)/22 JP 148, JP 1192 ...... JAPAN, Honshū: Works; Wind turbines ............................................................ 55
3178(T)/22 JP 1137................... JAPAN, Seto Naikai: Works............................................................................... 54
3237(T)/22 JP 31....................... JAPAN, Hokkaidō: Works.................................................................................. 55
3238(T)/22 JP 148..................... JAPAN, Honshū: Works..................................................................................... 55
3239(T)/22 JP 64A.................... JAPAN, Honshū: Works..................................................................................... 55
3240(T)/22 JP 1097................... JAPAN, Honshū: Works..................................................................................... 55
3242(T)/22 JP 1127B ................ JAPAN, Seto Naikai: Works............................................................................... 54
3317(T)/22 JP 31....................... JAPAN, Hokkaidō: Scientific instruments; Buoyage ........................................ 55
3318(T)/22 JP 1049................... JAPAN, Honshū: Buoy ...................................................................................... 53
3319(T)/22 JP 106, JP 131, JAPAN, Seto Naikai: Obstruction ...................................................................... 54
JP 150A..................
3388(T)/22 JP 28....................... JAPAN, Hokkaidō: Works.................................................................................. 55
3391(T)/22 JP 123..................... JAPAN, Seto Naikai: Works............................................................................... 54
3392(T)/22 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
3393(T)/22 JP 127, JP 128 ........ JAPAN, Seto Naikai: Works............................................................................... 54
3394(T)/22 JP 135, JP 1262, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1263...................
3507(T)/22 JP 1155B ................ JAPAN, Honshū: Depths.................................................................................... 55
3508(T)/22 JP 65....................... JAPAN, Honshū: Obstruction ............................................................................ 55
3509(T)/22 JP 128..................... JAPAN, Seto Naikai: Works............................................................................... 54
3510(T)/22 JP 135, JP 1262, JAPAN, Seto Naikai: Depth ............................................................................... 54
JP 1263...................
3511(T)/22 JP 135, JP 1263 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
3512(T)/22 JP 1227................... JAPAN, Kyūshū: Obstruction ............................................................................ 53
3641(T)/22 JP 63....................... JAPAN, Honshū: Works..................................................................................... 55
3642(T)/22 JP 63....................... JAPAN, Honshū: Buoyage ................................................................................. 55

1A.30
Wk04/23
 IA
15. JAPAN - continued
3643(T)/22 JP 90, JP 1061, JAPAN, Honshū: Obstruction ............................................................................ 53
JP 1062, JP 1087 ....
3700(T)/22 JP 28....................... JAPAN, Hokkaidō: Piles; Buoy ......................................................................... 55
3790(T)/22 JP 127, JP 129 ........ JAPAN, Seto Naikai: Works............................................................................... 54
3871(T)/22 JP 135, JP 1263 ...... JAPAN, Seto Naikai: Depths ............................................................................. 54
3977(T)/22 JP 80....................... JAPAN, Honshū: Virtual aid to navigation; Lights............................................ 53
3978(T)/22 JP 1112A, JP 1112B JAPAN, Seto Naikai: Depths; Drying heights ................................................... 54
4063(T)/22 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
4159(T)/22 JP 1067................... JAPAN, Honshū: Wreck..................................................................................... 53
4160(T)/22 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
4305(T)/22 JP 28....................... JAPAN, Hokkaidō: Buoy ................................................................................... 55
4306(T)/22 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
4307(T)/22 JP 1061, JP 1065 .... JAPAN, Honshū: Works..................................................................................... 53
4308(T)/22 JP 101A.................. JAPAN, Seto Naikai: Depths ............................................................................. 54
4309(T)/22 JP 1127B ................ JAPAN, Seto Naikai: Depth ............................................................................... 54
4471(T)/22 JP 5......................... JAPAN, Hokkaidō: Works.................................................................................. 55
4472(T)/22 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
4473(T)/22 JP 137A, JP 137B... JAPAN, Seto Naikai: Buoyage........................................................................... 54
4559(T)/22 JP 89....................... JAPAN, Honshū: Works; Dredging area ............................................................ 53
4560(T)/22 JP 77, JP 108 .......... JAPAN, Shikoku: Buoy...................................................................................... 53
4721(T)/22 JP 1049................... JAPAN, Honshū: Depths.................................................................................... 53
4722(T)/22 JP 1083................... JAPAN, Honshū: Depths; Obstruction............................................................... 53
4724(T)/22 JP 1103, JP 1141 .... JAPAN, Seto Naikai: Works............................................................................... 54
4825(T)/22 JP 63....................... JAPAN, Honshū: Works..................................................................................... 55
4826(T)/22 JP 131, JP 150A ..... JAPAN, Seto Naikai: Buoyage........................................................................... 54
4827(T)/22 JP 123..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
4829(T)/22 JP 127, JP 1101 ...... JAPAN, Seto Naikai: Virtual aid to navigation; Obstruction............................. 54
4917(T)/22 JP 65....................... JAPAN, Honshū: Works; Obstruction................................................................ 55
4918(T)/22 JP 63....................... JAPAN, Honshū: Obstructions; Works .............................................................. 55
4919(T)/22 JP 89....................... JAPAN, Honshū: Depths.................................................................................... 53
5025(T)/22 JP 64A.................... JAPAN, Honshū: Depths.................................................................................... 55
5026(T)/22 JP 64B, JP 79 ......... JAPAN, Honshū: Restricted area ....................................................................... 55
5027(T)/22 JP 1065................... JAPAN, Honshū: Buoyage ................................................................................. 53
5028(T)/22 JP 1055A................ JAPAN, Honshū: Depths.................................................................................... 53
5029(T)/22 JP 94, JP 95 ............ JAPAN, Honshū: Depths.................................................................................... 53
5030(T)/22 JP 106, JP 131, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 150A..................
5031(T)/22 JP 127, JP 128 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
5032(T)/22 JP 127, JP 135 ........ JAPAN, Seto Naikai: Buoyage........................................................................... 54
5117(T)/22 JP 127, JP 135 ........ JAPAN, Seto Naikai: Buoy ................................................................................ 54
5202(T)/22 JP 148..................... JAPAN, Honshū: Buoy ...................................................................................... 55
5203(T)/22 JP 1057A................ JAPAN, Honshū: Depths.................................................................................... 53
76(T)/23 JP 1155A ................ JAPAN, Honshū: Works; Dredging area; Submarine pipeline........................... 55
77(T)/23 JP 1267................... JAPAN, Kyūshū: Buoy ...................................................................................... 54
78(T)/23 JP 1227................... JAPAN, Kyūshū: Depths.................................................................................... 53
187(T)/23 JP 31....................... JAPAN, Hokkaidō: Obstructions ....................................................................... 55
188(T)/23 JP 65....................... JAPAN, Honshū: Depths; Obstruction............................................................... 55
189(T)/23 JP 65....................... JAPAN, Honshū: Dredging area; Works; Submarine pipeline........................... 55
190(T)/23 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
329(T)/23 1800, JP 1030, JAPAN, Hokkaidō: Wreck ................................................................................. 55
JP 1034...................
330(T)/23 1800, 1803, JP 1032 JAPAN, Hokkaidō: Wreck ................................................................................. 55
331(T)/23 JP 65....................... JAPAN, Honshū: Obstructions; Works .............................................................. 55
332(T)/23 JP 1100................... JAPAN, Honshū: Works..................................................................................... 55
333(T)/23 JP 131..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
334(T)/23 JP 135, JP 1262, JAPAN, Seto Naikai: Depth ............................................................................... 54
JP 1263...................

1A.31
Wk04/23
 IA
16. KOREA AND THE PACIFIC COASTS OF RUSSIA
2427(T)/13 1802, 1803 ........... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 55
1933(T)/14 1230 ...................... RUSSIA, Pacific Ocean Coast: Wreck............................................................... 56
2746(T)/14 3340 ...................... RUSSIA, Pacific Ocean Coast: Restricted area ................................................. 56
3546(T)/16 2432 ...................... RUSSIA, Pacific Ocean Coast: Mooring buoy .................................................. 56
955(T)/17 4512 ...................... RUSSIA, Pacific Ocean Coast: Obstructions; Area to be avoided .................... 56
1076(T)/18 3041 ...................... RUSSIA, Pacific Ocean Coast: Works............................................................... 56
3252(T)/18 3041 ...................... RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
4188(T)/18 3044 ...................... RUSSIA, Pacific Ocean Coast: Restricted areas................................................ 56
4192(T)/18 3044 ...................... RUSSIA, Pacific Ocean Coast: Wrecks ............................................................. 56
4193(T)/18 3044 ...................... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
212(T)/19 2128 ...................... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
867(T)/19 3039 ...................... RUSSIA, Pacific Ocean Coast: Floating dock................................................... 56
2345(T)/19 3044 ...................... RUSSIA, Pacific Ocean Coast: Works............................................................... 56
5767(T)/19 1065 ...................... KOREA, South Coast: Buoy.............................................................................. 52
6063(T)/19 3044 ...................... RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
1278(T)/21 3480 ...................... KOREA, West Coast: Buoy ............................................................................... 52
1336(T)/21 127, 1065 ............. KOREA, South Coast: Buoyage ........................................................................ 52, 53
1896(T)/21 3666 ...................... KOREA, East Coast: Buoy ................................................................................ 52
1897(T)/21 1258 ...................... KOREA, West Coast: Buoy ............................................................................... 52
1989(T)/21 3365, 3480 ........... KOREA, South Coast: Buoyage ........................................................................ 52
3047(T)/21 913 ........................ KOREA, West Coast: Buoy ............................................................................... 52
3051(T)/21 127, 1065, 1163, KOREA, South Coast: Current meters............................................................... 52, 53
1259, 2347, 3391,
3480, 3666 ...........
3134(T)/21 898 ........................ KOREA, East Coast: Buoyage........................................................................... 52
5520(T)/21 127, 3480, 3666 .. KOREA, East Coast: Buoyage........................................................................... 52, 53
517(T)/22 3041 ...................... RUSSIA, Pacific Ocean Coast: Anchorage area ................................................ 56
1556(T)/22 2293 ...................... RUSSIA, Pacific Ocean Coast: Light ................................................................ 55
1774(T)/22 1270 ...................... KOREA, West Coast: Buoy ............................................................................... 52
3419(T)/22 127, 3666 ............. KOREA, East Coast: Buoy ................................................................................ 52, 53
3426(T)/22 3928 ...................... KOREA, West Coast: Buoyage.......................................................................... 52
3427(T)/22 3928 ...................... KOREA, West Coast: Radar beacon .................................................................. 52
3438(T)/22 1258 ...................... KOREA, West Coast: Buoyage.......................................................................... 52
3440(T)/22 127, 3391 ............. KOREA, South Coast: Buoyage ........................................................................ 52, 53
3461(T)/22 127, 3391, 3480 .. KOREA, South Coast: Buoy.............................................................................. 52, 53
3529(T)/22 896, 898 ............... KOREA, East Coast: Buoy ................................................................................ 52
3922(T)/22 1065, 1259 ........... KOREA, South Coast: Radar beacon................................................................. 52
3933(T)/22 1008 ...................... KOREA, West Coast: Buoyage.......................................................................... 52
4070(T)/22 3365, 3480 ........... KOREA, South Coast: Buoyage ........................................................................ 52
4087(T)/22 913, 3365, 3480 .. KOREA, West Coast: Light-floats ..................................................................... 52
4099(T)/22 3365, 3480 ........... KOREA, South Coast: Buoy.............................................................................. 52
4139(T)/22 3365, 3480 ........... KOREA, South Coast: Buoy.............................................................................. 52
4273(T)/22 1256, 1258, 3480 KOREA, West Coast: Buoy ............................................................................... 52
4834(T)/22 127, 1065 ............. KOREA, South Coast: Buoy.............................................................................. 52, 53
4838(T)/22 1065 ...................... KOREA, South Coast: Buoy.............................................................................. 52
4921(T)/22 2432, 3045, 3046 RUSSIA, Pacific Ocean Coast: Buoy; Fog signal ............................................. 56
4928(T)/22 3044, 3045 ........... RUSSIA, Pacific Ocean Coast: Mooring buoy .................................................. 56
238(T)/23 882 ........................ KOREA, East Coast: Buoy ................................................................................ 56
251(T)/23 127, 3365, 3929 .. KOREA, South Coast: Buoyage; Automatic Identification Systems................. 52, 53
252(T)/23 896, 898 ............... KOREA, East Coast: Works............................................................................... 52
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA
2773(T)/15 1748 ...................... MALAYSIA, Sarawak: Works........................................................................... 48
1103(T)/16 2134 ...................... BRUNEI: Beacon; Buoy .................................................................................... 48
4195(P)/16 1420, 2786 ........... INDONESIA, Molucca Sea: Submarine cables................................................. 58
1256(T)/17 2109 ...................... BRUNEI: Buoy .................................................................................................. 48
3651(P)/17 1293 ...................... INDONESIA, Molucca Sea: Submarine cables................................................. 59

1A.32
Wk04/23
 IA
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA - continued
4085(T)/17 2056, 2797, 2862, INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
3729 ......................
711(T)/18 921 ........................ INDONESIA, Jawa: Light-beacon..................................................................... 60
4195(T)/18 945, 2796, 2876 .. INDONESIA, Java Sea: Buoy ........................................................................... 60
5227(T)/18 2638, 2893, 2894 INDONESIA, Sulawesi: General information................................................... 58, 59
5672(T)/18 975, 977, 978 ...... INDONESIA, Jawa: Buoy ................................................................................. 60
1489(T)/19 2470, 2797, 2862 INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
1567(T)/19 1338, 2111, 2112. MALAYSIA, Sabah: Buoy ................................................................................ 48
2217(P)/19 1844, 2134 ........... BRUNEI: Works; Lights; Channel; Piles; Restricted areas ............................... 48
2861(T)/19 1338, 2109, 3483, BRUNEI: Scientific instruments........................................................................ 48
3838 ......................
6173(T)/19 1844, 2134 ........... BRUNEI: Buoy; Light-beacons ......................................................................... 48
6398(T)/19 1822 ...................... MALAYSIA, Sarawak: Buoy ............................................................................ 48
1276(T)/20 1338, 2109 ........... BRUNEI: Jetty; Works....................................................................................... 48
1543(T)/20 2099 ...................... INDONESIA, Kalimantan: Obstruction ............................................................ 59
2779(T)/20 1338, 2109 ........... BRUNEI: Extraction area; Buoyage .................................................................. 48
3590(P)/20 3484, 3809, 3811, PHILIPPINE ISLANDS, Bohol: Submarine cables .......................................... 48, 58
4416, 4417, 4473
3997(P)/20 3809, 3811............ PHILIPPINE ISLANDS, Sulu Sea: Reef........................................................... 48, 58
4576(T)/20 2134 ...................... BRUNEI: Barge; Lights ..................................................................................... 48
5111(P)/20 2797, 2862 ........... INDONESIA, Jawa: Submarine pipeline; Works; Platform .............................. 46, 60
5550(P)/20 3484, 3489, 4413, PHILIPPINE ISLANDS, Luzon: Submarine cables .......................................... 48, 58
4414, 4416, 4484,
4485, 4487, 4488,
4489 ......................
6035(T)/20 3558 ...................... PHILIPPINE ISLANDS, Luzon: Wreck............................................................ 48
6064(P)/20 3426, 3484, 3809, PHILIPPINE ISLANDS, Sulu Sea: Submarine cable........................................ 48, 58
3811, 4416, 4471,
4473 ......................
6142(T)/20 1338, 2109 ........... BRUNEI: Scientific instruments........................................................................ 48
6158(P)/20 3484, 3489, 3809, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
4413, 4414, 4416,
4417, 4477, 4478,
4484, 4489 ...........
833(P)/21 3484, 3489, 4413, PHILIPPINE ISLANDS, Luzon: Submarine cables .......................................... 48, 58
4416, 4417, 4485,
4486, 4487 ...........
1852(P)/21 2797, 2862, 3729 INDONESIA, Jawa: Works; Buoyage ............................................................... 46, 60
2009(P)/21 2134 ...................... BRUNEI: Depths; Dredged areas; Alongside depths......................................... 48
2220(P)/21 3809, 3811, 4471. PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
2239(P)/21 2471, 2639, 2893 INDONESIA, Kalimantan: Works; Platforms; Submarine pipelines ................ 59
2897(P)/21 3558 ...................... PHILIPPINE ISLANDS, Luzon: Development area; Jetty ............................... 48
3146(P)/21 2795, 2892, 3015, INDONESIA, Kalimantan: Buoyage ................................................................. 59, 60
3017 ......................
3528(P)/21 3484, 3489, 4413, PHILIPPINE ISLANDS: Submarine cable........................................................ 48, 58
4414, 4416, 4484,
4485 ......................
3677(P)/21 1949, 3838 ........... MALAYSIA, Sarawak: Platform; Submarine pipeline...................................... 48
4404(P)/21 1844, 2134 ........... BRUNEI: Works; Buoyage ................................................................................
48
4413(T)/21 2134 ...................... BRUNEI: Light-beacon; Buoy...........................................................................
48
4497(P)/21 3484, 3489, 4412, PHILIPPINE ISLANDS, Luzon: Submarine cable ........................................... 48, 57, 58,
4413, 4507, 4509 59
4649(T)/21 1312, 2870, 3720, INDONESIA, Kalimantan: Wreck..................................................................... 46, 48
3721 ......................

1A.33
Wk04/23
 IA
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA - continued
4827(P)/21 1312, 1336, 2403, MALAYSIA, Sarawak: Submarine cable .......................................................... 45, 46, 47,
2414, 2422, 2436, 48
2470, 2868, 2869,
2870, 3482, 3720,
3831, 3834, 3835,
4042 ......................
4848(P)/21 967, 3483, 3484, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
3489, 3809, 3811,
4413, 4414, 4416,
4417, 4472, 4473,
4474, 4482, 4483,
4484, 4485, 4489,
4490 ......................
5077(T)/21 2892 ...................... INDONESIA, Makasar Strait: Buoy.................................................................. 59
390(T)/22 13, 14, 4473, 4477 PHILIPPINE ISLANDS, Cebu: Wrecks ............................................................ 58
800(T)/22 2134 ...................... BRUNEI: Anchorage areas; Buoyage ................................................................ 48
1090(P)/22 2471, 2639, 2893 INDONESIA, Kalimantan: Platforms; Submarine pipelines; Works ................ 59
1478(T)/22 3489 ...................... PHILIPPINE ISLANDS, Luzon: Buoy.............................................................. 48
1493(P)/22 2797, 3730 ........... INDONESIA, Jawa: Submarine pipeline; Works .............................................. 60
1834(P)/22 3483, 3484, 3489, PHILIPPINE ISLANDS, Luzon: Submarine cable ........................................... 48, 58
3558, 4411, 4413,
4414, 4416, 4417,
4486, 4487, 4488,
4489, 4490, 4491
2073(P)/22 3296 ...................... EAST TIMOR: Depths....................................................................................... 60
2082(P)/22 2954 ...................... INDONESIA, Sulawesi: Drying height ............................................................. 60
2173(T)/22 921, 979 ............... INDONESIA, Jawa: Buoy ................................................................................. 60
2439(T)/22 13, 14, 4473, 4477 PHILIPPINE ISLANDS, Cebu: Buoyage.......................................................... 58
2496(P)/22 933, 1066, 1312, INDONESIA, Java Sea: Submarine cables........................................................ 46, 48, 58,
2056, 2137, 2470, 59, 60
2471, 2638, 2794,
2796, 2797, 2862,
2872, 2873, 2877,
2892, 2893, 2894,
2948, 2951, 2957,
3017, 3483, 3484,
3729, 3757, 3758,
4418, 4419, 4420,
4469 ......................
2592(P)/22 967, 3483, 3484, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
3489, 3809, 4413,
4414, 4416, 4417,
4473, 4477, 4478,
4482, 4483, 4484
2632(T)/22 3931, 4491 ........... PHILIPPINE ISLANDS, Luzon: Measuring instruments; Buoyage ................. 48
2634(P)/22 933, 2056, 3729 .. INDONESIA, Jawa: Works; Submarine pipeline; Single Point Mooring.......... 46
2964(T)/22 1338, 2109 ........... BRUNEI: Wreck ................................................................................................ 48
3071(P)/22 967, 3483, 3489 .. PHILIPPINE ISLANDS, Palawan: Fish havens ................................................ 48
3384(P)/22 1066, 2470, 2471, INDONESIA, Java Sea: Submarine cable ......................................................... 46, 59, 60
2794, 2795, 2796,
3029, 3731 ...........
3395(T)/22 1844, 2134 ........... BRUNEI: Beacon; Pile ...................................................................................... 48
3463(P)/22 13, 3484, 3809, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
3811, 4416, 4417,
4420, 4473, 4474,
4475, 4477, 4478,
4479, 4480, 4497
3614(T)/22 3931, 4411, 4413, PHILIPPINE ISLANDS, Luzon: Dredging area; Works; Buoyage................... 48
4414, 4491 ...........

1A.34
Wk04/23
 IA
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA - continued
3626(P)/22 2134 ...................... BRUNEI: Works; Intake; Lights ........................................................................ 48
3759(T)/22 1949, 2109, 3838 MALAYSIA, Sarawak: Buoyage ....................................................................... 48
4083(P)/22 1420 ...................... INDONESIA, Papua: Depths; Rock; Leading lines; Leading lights; 58
Recommended track; Light ................................................................................
4294(P)/22 1822 ...................... MALAYSIA, Sarawak: Works; Buoyage........................................................... 48
4325(P)/22 763, 1066, 1293, INDONESIA, Sulawesi: Submarine cable......................................................... 57, 58, 59,
2471, 2472, 2473, 60
2795, 2877, 2892,
2910, 2911, 2936,
2953, 2954, 3017,
3749, 3922 ...........
4538(P)/22 3729 ...................... INDONESIA, Jawa: Buoyage............................................................................ 46
4798(P)/22 3747, 3749 ........... INDONESIA, Papua: Works; Dredging area ..................................................... 58
4836(T)/22 1748, 2100, 3837 MALAYSIA, Sarawak: Buoyage; Jetty ............................................................. 48
4962(T)/22 2470, 2797, 2862, INDONESIA, Java Sea: Wreck.......................................................................... 46, 47, 60
3729, 4508 ...........
4993(T)/22 2877, 2892 ........... INDONESIA, Sulawesi: Wreck ......................................................................... 59, 60
5105(P)/22 3484, 3489, 4413, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
4414, 4490 ...........
5207(P)/22 3484, 3809, 4416, PHILIPPINE ISLANDS: Submarine cables; Works.......................................... 48, 58
4473 ......................
46(P)/23 3484, 3489, 3558, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
4413, 4414, 4416,
4484, 4485, 4487,
4489, 4490 ...........
52(P)/23 13, 3426, 3484, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
3489, 3809, 3811,
4413, 4416, 4417,
4471, 4472, 4473,
4474, 4477, 4478,
4479, 4485 ...........
98(P)/23 2875, 2876, 2915, INDONESIA, Nusa Tengarra: Submarine cable................................................ 60
3706 ......................
101(P)/23 3484, 3809, 4416, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
4417, 4473, 4474,
4477 ......................
106(P)/23 2391, 3484, 3809, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
4416, 4417, 4420,
4475, 4479, 4480,
4497 ......................
178(P)/23 1822 ...................... MALAYSIA, Sarawak: Depths; Submarine pipelines ....................................... 48
18. AUSTRALIA AND PAPUA NEW GUINEA
3938(T)/16 Aus 813 .................. AUSTRALIA, New South Wales: Obstructions ................................................ 66
3946(T)/16 Aus 327 .................. AUSTRALIA, Western Australia: Scientific instruments.................................. 63
3534(P)/17 Aus 821, Aus 824, AUSTRALIA, Queensland: Depths................................................................... 66
Aus 825 ..................
5441(P)/17 Aus 833, Aus 834... AUSTRALIA, Queensland: Depths................................................................... 66
5635(T)/17 Aus 808 .................. AUSTRALIA, New South Wales: Scientific instruments.................................. 66
5857(P)/17 Aus 377 .................. AUSTRALIA, Queensland: Reefs ..................................................................... 66
4723(T)/18 4622 ...................... PAPUA NEW GUINEA: Fish traps ................................................................... 67
1191(P)/19 Aus 822 .................. AUSTRALIA, Queensland: Depths................................................................... 66
2363(P)/19 PNG 646 ................ PAPUA NEW GUINEA: Depths ....................................................................... 67
2626(T)/19 PNG 643 ................ PAPUA NEW GUINEA: Buoy .......................................................................... 67
3258(P)/19 Aus 821, Aus 824... AUSTRALIA, Queensland: Depths................................................................... 66
4075(T)/19 Aus 831 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
5893(T)/19 Aus 59 .................... AUSTRALIA, Western Australia: Buoy ............................................................ 63
59(T)/20 Aus 55 .................... AUSTRALIA, Western Australia: Measuring instrument ................................. 63
1733(T)/20 4723 ...................... AUSTRALIA, Western Australia: Works .......................................................... 63

1A.35
Wk04/23
 IA
18. AUSTRALIA AND PAPUA NEW GUINEA - continued
1988(T)/20 Aus 839 .................. AUSTRALIA, Queensland: Scientific instruments ........................................... 66
2224(P)/20 PNG 554, PNG 680 PAPUA NEW GUINEA: Depths ....................................................................... 67
2227(P)/20 PNG 512 ................ PAPUA NEW GUINEA: Depths ....................................................................... 67
2711(T)/20 Aus 327 .................. AUSTRALIA, Western Australia: Buoy ............................................................ 63
3387(T)/20 Aus 143 .................. AUSTRALIA, Victoria: Buoy............................................................................ 65
3428(T)/20 Aus 826, Aus 827... AUSTRALIA, Queensland: Obstruction ........................................................... 66
3575(P)/20 PNG 621 ................ PAPUA NEW GUINEA: Depths ....................................................................... 66
3609(T)/20 4601, 4602, 4643, AUSTRALIA, New South Wales: Obstructions ................................................ 65, 66, 71
Aus 806, Aus 807,
Aus 808, Aus 809,
Aus 810 ..................
4013(T)/20 Aus 195 .................. AUSTRALIA, New South Wales: Restricted area............................................. 65
4016(T)/20 Aus 814 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
4271(T)/20 Aus 808, Aus 809... AUSTRALIA, New South Wales: Scientific instruments.................................. 66
5545(T)/20 4620, 4621, 4622, PAPUA NEW GUINEA: Fish traps ................................................................... 66, 67
PNG 386, PNG 521,
PNG 522, PNG 523
6232(T)/20 Aus 806, Aus 807... AUSTRALIA, New South Wales: Scientific instruments.................................. 65
1919(P)/21 Aus 841 .................. AUSTRALIA, Queensland: Depths................................................................... 66
1942(T)/21 Aus 839, Aus 841... AUSTRALIA, Queensland: Wreck.................................................................... 66
2704(T)/21 Aus 743 .................. AUSTRALIA, Western Australia: Buoy ............................................................ 63
3137(T)/21 Aus 195 .................. AUSTRALIA, New South Wales: Works; Buoyage .......................................... 65
3306(T)/21 4644 ...................... AUSTRALIA, Tasmania: Scientific instruments............................................... 65
3310(T)/21 Aus 743 .................. AUSTRALIA, Western Australia: Scientific instrument ................................... 63
3438(T)/21 Aus 827 .................. AUSTRALIA, Queensland: Works; Buoyage.................................................... 66
3646(T)/21 Aus 827 .................. AUSTRALIA, Queensland: Buoyage ................................................................ 66
3833(T)/21 Aus 377, Aus 840, PAPUA NEW GUINEA: Scientific instruments................................................ 66
Aus 841 ..................
4619(T)/21 Aus 813 .................. AUSTRALIA, New South Wales: Buoy............................................................ 66
5113(T)/21 Aus 53, Aus 326..... AUSTRALIA, Western Australia: Obstruction.................................................. 63
5114(T)/21 Aus 840, Aus 841... PAPUA NEW GUINEA: Depths ....................................................................... 66
5120(T)/21 Aus 823 .................. AUSTRALIA, Queensland: Restricted area ...................................................... 66
5378(T)/21 Aus 839 .................. AUSTRALIA, Queensland: Scientific instrument............................................. 66
135(T)/22 Aus 743 .................. AUSTRALIA, Western Australia: Scientific instrument ................................... 63
425(P)/22 Aus 293, Aus 700, AUSTRALIA, Queensland: Depths................................................................... 66
Aus 839, Aus 841...
460(P)/22 Aus 841 .................. PAPUA NEW GUINEA: Depths ....................................................................... 66
664(T)/22 Aus 826 .................. AUSTRALIA, Queensland: Buoyage ................................................................ 66
1368(T)/22 Aus 832 .................. AUSTRALIA, Queensland: Scientific instrument; Buoy.................................. 66
1602(T)/22 Aus 143 .................. AUSTRALIA, Victoria: Area to be avoided; Buoyage...................................... 65
2035(T)/22 Aus 57, Aus 327..... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
2037(T)/22 Aus 830 .................. AUSTRALIA, Queensland: Wreck.................................................................... 66
2043(P)/22 Aus 357 .................. AUSTRALIA, Victoria: Wells; Traffic separation scheme ................................ 65
2071(T)/22 Aus 57, Aus 59, AUSTRALIA, Western Australia: Buoyage ...................................................... 63
Aus 327 ..................
2849(T)/22 4635, 4643, Aus 814 AUSTRALIA, Queensland: Wreck.................................................................... 65, 66
2862(T)/22 Aus 53 .................... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
3009(T)/22 Aus 814 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
3285(T)/22 Aus 293 .................. AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
3307(T)/22 Aus 823 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
3727(P)/22 PNG 519 ................ PAPUA NEW GUINEA: Depths ....................................................................... 67
4391(T)/22 Aus 816 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
4395(T)/22 Aus 801 .................. AUSTRALIA, Victoria: Buoy............................................................................ 65
4405(T)/22 Aus 143, Aus 788... AUSTRALIA, Victoria: Depths; Virtual aids to navigation .............................. 65
4688(T)/22 Aus 143 .................. AUSTRALIA, Victoria: Light-beacon; Buoy .................................................... 65
4889(T)/22 Aus 821 .................. AUSTRALIA, Queensland: Scientific instrument............................................. 66
31(T)/23 Aus 826 .................. AUSTRALIA, Queensland: Obstructions.......................................................... 66

1A.36
Wk04/23
 IA
18. AUSTRALIA AND PAPUA NEW GUINEA - continued
356(T)/23 Aus 839 .................. AUSTRALIA, Queensland: Beacon .................................................................. 66
357(T)/23 Aus 812 .................. AUSTRALIA, New South Wales: Buoy............................................................ 66
19. NEW ZEALAND
4281(T)/21 NZ 661 ................... NEW ZEALAND, South Island: Scientific instruments; Buoyage ................... 72
2601(P)/22 NZ 6142 ................. NEW ZEALAND, South Island: Dredged depths; Dredged areas .................... 71
3261(T)/22 NZ 5612 ................. NEW ZEALAND, North Island: Buoy .............................................................. 71
3959(P)/22 NZ 6321 ................. NEW ZEALAND, South Island: Rocks............................................................. 72
4480(T)/22 NZ 6612 ................. NEW ZEALAND, South Island: Restricted area; Piles..................................... 72
87(P)/23 NZ 5215 ................. NEW ZEALAND, North Island: Depths; Drying height; Piers; Beacons; 71
Buoyage..............................................................................................................
20. PACIFIC OCEAN
3021(T)/12 4621, 4623, 4634 SOUTH PACIFIC OCEAN: Fish havens........................................................... 66, 68
679(T)/14 1494, 1570, 1576 SOUTH PACIFIC OCEAN, Vanuatu: Buoyage ................................................ 68
249(T)/17 1436 ...................... SOUTH PACIFIC OCEAN, Polynésie Française: Marine farms; Buoyage...... 73
4785(T)/17 1494 ...................... SOUTH PACIFIC OCEAN, Vanuatu: Buoy...................................................... 68
935(P)/18 SLB 301, SLB 302. SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
2427(T)/18 2462, 2463 ........... SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Wreck................................. 68
4792(T)/18 378 ........................ SOUTH PACIFIC OCEAN, Fiji Islands: Beacons ............................................ 70
5448(T)/18 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Wreck ................................. 73
5029(P)/19 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Outfall; Restricted areas..... 73
6384(T)/19 761, 4051, 4052, NORTH PACIFIC OCEAN: Data buoys ........................................................... 57, 63, 68,
4060, 4061, 4062, 70, 73, 74,
4506, 4604, 4605, 88, 89
4606, 4607, 4615,
4617, 4618, 4619,
4623, 4624, 4625,
4626, 4629, 4632,
4653, 4802, 4808,
4811.......................
1534(P)/20 SLB 102 ................. SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
2356(T)/20 763, 4506, 4507, NORTH PACIFIC OCEAN: Buoyage ............................................................... 57, 59, 67,
4604, 4622 ........... 68
5433(P)/20 2983 ...................... SOUTH PACIFIC OCEAN, Tuvalu: Depths; Drying heights ........................... 70
2221(T)/21 378 ........................ SOUTH PACIFIC OCEAN, Fiji Islands: Wreck ............................................... 70
2347(T)/21 4601 ...................... SOUTH PACIFIC OCEAN: Buoy..................................................................... 71
2501(P)/21 378 ........................ SOUTH PACIFIC OCEAN, Fiji Islands: Coastline; Marina; Quarantine 70
anchorage ...........................................................................................................
3588(P)/21 4634, 4635 ........... SOUTH PACIFIC OCEAN: Marine Reserve; Depths; Wreck .......................... 66, 68
4695(T)/21 3551, 3552, 4509, NORTH PACIFIC OCEAN: Volcanic activity................................................... 53, 57
4510 ......................
1603(P)/22 378, 440, 441, 744, SOUTH PACIFIC OCEAN, Fiji Islands: Submarine cables ............................. 70
745, 750, 751,
1674, 2691, 4631,
4632, 4638 ...........
2144(T)/22 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Light-beacon; Buoy............ 73
3674(T)/22 WS 312 .................. SOUTH PACIFIC OCEAN, Samoa Islands: Buoy............................................ 70
3702(T)/22 1648, 3237, 4507, NORTH PACIFIC OCEAN: General information............................................. 53, 57, 59
4509, JP 1221........
4077(P)/22 377, 384 ............... SOUTH PACIFIC OCEAN, Fiji Islands: Submarine power cables .................. 70
4123(T)/22 4604, 4634 ........... CORAL SEA: Buoy ........................................................................................... 68
4129(P)/22 NZ 82 ..................... SOUTH PACIFIC OCEAN, Tonga Islands: Volcanic activity........................... 70
4178(P)/22 2462, 2463, 2464, SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Recommended route .......... 68
2465 ......................
4839(P)/22 2464, 2465 ........... SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Submarine cables ............... 68
79(T)/23 2347, 2412, 3237, NORTH PACIFIC OCEAN: General information............................................. 53, 57, 59
4507, 4509, 4510,
JP 1221...................

1A.37
Wk04/23
 IA
21. ALEUTIAN ISLANDS, ALASKA AND WEST COAST OF NORTH AMERICA INCLUDING MEXICO
706(T)/21 588, 591 ............... UNITED STATES OF AMERICA, West Coast: Disused submarine cable; Foul 89
1375(P)/21 1029, 1049, 2530, UNITED STATES OF AMERICA, West Coast: Works; Submarine cables...... 89
4912 ......................
5181(T)/21 3754, 4801, 4810, CANADA, British Columbia: Restricted area ................................................... 89, 90, 91,
4920, 4975 ........... 92
4674(T)/22 3754, 4923, 4928, CANADA, British Columbia: General information .......................................... 91
4939 ......................
22. WEST COASTS OF CENTRAL AND SOUTH AMERICA
3467(T)/15 3084 ...................... PERU: Precautionary area.................................................................................. 98
6453(T)/15 656 ........................ MEXICO, Pacific Ocean Coast: Light; Buoy .................................................... 89
720(P)/17 1938 ...................... MEXICO, Pacific Ocean Coast: Works ............................................................. 89
2263(T)/18 1938 ...................... MEXICO, Pacific Ocean Coast: Buoy; Radar beacon....................................... 89
2630(P)/19 1938 ...................... MEXICO, Pacific Ocean Coast: Wreck ............................................................. 89
4504(T)/19 3089 ...................... PERU: Buoyage ................................................................................................. 98
1303(T)/20 3087 ...................... PERU: Buoy....................................................................................................... 98
1792(T)/20 3090 ...................... PERU: Buoy....................................................................................................... 98
6272(T)/20 2319 ...................... COLOMBIA, Pacific Ocean Coast: Wreck ....................................................... 98
2104(P)/21 1020, 1929, 2496, PANAMA, Pacific Ocean Coast: Submarine cable............................................ 88, 89
4811, CP 5.............
3404(T)/21 4237 ...................... CHILE, Northern Coasts: Wreck ....................................................................... 98
4593(P)/21 3090, 4218, 4220 CHILE, Northern Coasts: Submarine cable ....................................................... 98
364(P)/22 8007 ...................... PANAMA, Pacific Ocean Coast: Buoyage ........................................................ 88
940(T)/22 376, 662, 1017, MEXICO, Pacific Ocean Coast: Firing practice areas....................................... 83, 85, 89
1023, 1024, 1026,
1049, 1307, 2626,
2833, 3768 ...........
2324(T)/22 1853 ...................... PERU: Buoy....................................................................................................... 98
2325(T)/22 1853 ...................... PERU: Works ..................................................................................................... 98
3852(T)/22 2319 ...................... COLOMBIA, Pacific Ocean Coast: Buoy ......................................................... 98
4097(T)/22 1853 ...................... PERU: Buoy....................................................................................................... 98
4224(T)/22 1105....................... MEXICO, Pacific Ocean Coast: Buoy............................................................... 89
4288(T)/22 512 ........................ ECUADOR: Bridge ........................................................................................... 98
4292(T)/22 1026, 1979 ........... MEXICO, Pacific Ocean Coast: Buoy; Radar beacon....................................... 89
4327(T)/22 1853 ...................... PERU: Area to be avoided ................................................................................. 98
4654(T)/22 1105....................... MEXICO, Pacific Ocean Coast: Buoy............................................................... 89
4944(T)/22 4051, 4062, 4608 PERU: Buoyage ................................................................................................. 88
5012(T)/22 4237 ...................... CHILE, Northern Coasts: Works........................................................................ 98
23. ANTARCTICA
4399(P)/14 1776 ...................... ANTARCTICA: Coastline; Rocks; Depths........................................................ 97
239(P)/22 1775, 1779 ........... ANTARCTICA: Depths ..................................................................................... 97
24. EAST COAST OF SOUTH AMERICA AND THE FALKLAND ISLANDS
884(T)/16 2506 ...................... SOUTH ATLANTIC OCEAN, Falkland Islands: Light-beacon; Leading line . 96
1015(T)/17 545 ........................ BRAZIL, East Coast: Works; Buoyage.............................................................. 95
606(P)/18 3703 ...................... URUGUAY: Restricted areas ............................................................................. 95
1244(T)/18 579, 589 ............... BRAZIL, South Coast: Buoyage........................................................................ 95
1268(T)/18 3561 ...................... URUGUAY: Depths ........................................................................................... 95
2509(T)/18 566 ........................ BRAZIL, South Coast: Obstruction................................................................... 95
3655(P)/18 329, 330, 331, 520, BRAZIL, North Coast: Lights; Radar beacon; Automatic Identification 95
2204, 3959 ........... Systems; Buoyage; Virtual aids to navigation....................................................
4956(P)/18 566 ........................ BRAZIL, South Coast: Obstructions ................................................................. 95
961(T)/19 545 ........................ BRAZIL, East Coast: Buoy................................................................................ 95
2025(T)/19 2189 ...................... BRAZIL, East Coast: Wreck.............................................................................. 95
2578(P)/19 566 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
2582(P)/19 495 ........................ BRAZIL, East Coast: Obstructions.................................................................... 95
4952(T)/19 2012, 3984 ........... BRAZIL, South Coast: Buoy ............................................................................. 95

1A.38
Wk04/23
 IA
24. EAST COAST OF SOUTH AMERICA AND THE FALKLAND ISLANDS - continued
72(P)/20 2189 ...................... BRAZIL, East Coast: Depths ............................................................................. 95
1232(P)/20 540, 545 ............... BRAZIL, East Coast: Virtual aids to navigation................................................ 95
3079(T)/20 540, 545 ............... BRAZIL, East Coast: Buoy................................................................................ 95
360(P)/21 541 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
1995(P)/21 2189 ...................... BRAZIL, East Coast: Drying heights; Depths................................................... 95
3186(P)/21 331 ........................ BRAZIL, North Coast: Wreck ........................................................................... 95
3563(P)/21 3982 ...................... BRAZIL, South Coast: Spoil ground ................................................................. 95
4308(P)/21 566 ........................ BRAZIL, South Coast: Depth ............................................................................ 95
4668(P)/21 331 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
4697(P)/21 589 ........................ BRAZIL, South Coast: Depth ............................................................................ 95
4847(T)/21 3974 ...................... BRAZIL, East Coast: Wreck.............................................................................. 95
489(P)/22 599 ........................ BRAZIL, East Coast: Depth .............................................................................. 95
930(P)/22 566 ........................ BRAZIL, South Coast: Depths .......................................................................... 95
934(P)/22 555 ........................ BRAZIL, South Coast: Automatic Identification Systems; Virtual aids to 95
navigation ...........................................................................................................
1051(T)/22 2001 ...................... URUGUAY: Buoyage; Works............................................................................ 95
1116(P)/22 529, 530, 3971, BRAZIL, South Coast: Buoyage; Superbuoy .................................................... 95
3972 ......................
1200(P)/22 582 ........................ BRAZIL, South Coast: Dredged areas; Buoyage; Lights; Depths; Fouls; 95
Obstructions; Rocks; Submarine cable ..............................................................
1217(P)/22 960 ........................ BRAZIL, East Coast: Depths ............................................................................. 95
1246(T)/22 534 ........................ ARGENTINA: Buoy.......................................................................................... 96
1699(P)/22 541 ........................ BRAZIL, North Coast: Depth ............................................................................ 95
1700(P)/22 2189 ...................... BRAZIL, East Coast: Depth .............................................................................. 95
1751(T)/22 2001 ...................... URUGUAY: Mooring buoys.............................................................................. 95
2219(T)/22 2002, 2012 ........... BRAZIL, South Coast: Buoy ............................................................................. 95
2322(T)/22 3962 ...................... BRAZIL, North Coast: Buoy ............................................................................. 95
3744(P)/22 526 ........................ BRAZIL, North Coast: Buoy ............................................................................. 95
4315(T)/22 529, 961, 969, BRAZIL, East Coast: Buoyage .......................................................................... 95
3972, 3973 ...........
4328(P)/22 541 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
4899(P)/22 1327 ...................... ARGENTINA: Dredging areas; Dredged depths; Buoy.................................... 95
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO
2586(T)/16 376, 1307 ............. MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
4258(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4292(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4293(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4666(T)/16 2866, 3910 ........... WEST INDIES, Bahamas: Lights...................................................................... 83
6211(P)/16 465, 466, 3907, HAITI: Depths; Coastline; Lights; Wrecks; Obstructions ................................. 86
3935 ......................
1497(T)/17 1629 ...................... CARIBBEAN SEA: Buoy ................................................................................. 87
3276(T)/17 2766 ...................... SURINAME: Obstruction; Light ....................................................................... 87
1763(T)/18 794 ........................ WEST INDIES, Windward Islands: Buoy ......................................................... 87
2080(T)/18 2006, 2019, 2020 WEST INDIES, Virgin Islands: Buoyage; Wrecks; Obstructions ..................... 86
4628(T)/18 3768 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
4917(T)/18 474 ........................ WEST INDIES, Trinidad and Tobago: Wreck ................................................... 87
5341(P)/18 3768 ...................... MEXICO, Gulf of Mexico: Wreck; Restricted area........................................... 83
5983(T)/18 1307, 2626 ........... MEXICO, Gulf of Campeche: Platform ............................................................ 83
659(P)/19 230, 2191 ............. VENEZUELA: Superbuoy; Submarine pipeline ............................................... 87
949(T)/19 501, 517, 1044, WEST INDIES, Trinidad and Tobago: Platform; Light..................................... 87
1045 ......................
972(T)/19 475 ........................ WEST INDIES, Trinidad and Tobago: Platforms .............................................. 87
1399(T)/19 257, 258, 454, 458, WEST INDIES, Jamaica: Anchorage areas; Anchor berths; Berths; Moorings; 86
459, 464 ............... Piers; Reported anchorages ................................................................................
1895(T)/19 1044, 1045 ........... WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
2745(T)/19 364, 365, 376, 3768 MEXICO, Gulf of Mexico: Obstructions........................................................... 83
3392(T)/19 2753 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83

1A.39
Wk04/23
 IA
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO - continued
3634(P)/19 2019, 2020 ........... WEST INDIES, Virgin Islands: Depths ............................................................. 86
3977(T)/19 662 ........................ MEXICO, Caribbean Sea Coast: Fish havens.................................................... 85
4086(T)/19 1629 ...................... VENEZUELA: Buoy ......................................................................................... 87
4250(T)/19 3190 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Vertical clearance; Works 83
4909(T)/19 1966, 2191 ........... VENEZUELA: Buoy ......................................................................................... 87
5444(P)/19 359, 1307, 2626 .. MEXICO, Gulf of Campeche: Works; Depths................................................... 83
6185(P)/19 1400 ...................... PANAMA, Caribbean Sea Coast: Pier; Buoyage; Dolphin ............................... 88
156(P)/20 1450 ...................... WEST INDIES, Turks and Caicos Islands: Depths; Drying heights; Coral ...... 86
203(T)/20 359 ........................ MEXICO, Gulf of Mexico: Buoyage................................................................. 83
207(T)/20 2751 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
411(T)/20 474 ........................ WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
630(P)/20 487, 489, 583, WEST INDIES, Leeward Islands: Lights .......................................................... 86
1025, 2016 ...........
969(P)/20 2005, 2006, 2016, WEST INDIES, Virgin Islands: Depths ............................................................. 86
2019, 2020 ...........
1055(T)/20 2988 ...................... HONDURAS: Buoy........................................................................................... 85
1079(P)/20 2005, 2019 ........... WEST INDIES, Virgin Islands: Wrecks; Marine Reserves ............................... 86
1111(T)/20 2079 ...................... WEST INDIES, Leeward Islands: Works .......................................................... 86
1178(T)/20 2751 ...................... MEXICO, Gulf of Mexico: Platform ................................................................. 83
1186(T)/20 474 ........................ WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
1818(T)/20 2626 ...................... MEXICO, Gulf of Campeche: Buoy.................................................................. 83
2058(P)/20 487, 489, 583 ...... WEST INDIES, Leeward Islands: Marine Reserves; Restricted area ............... 86
2211(T)/20 502 ........................ WEST INDIES, Windward Islands: Buoy ......................................................... 87
3074(T)/20 2190 ...................... VENEZUELA: Buoy ......................................................................................... 87
3238(T)/20 1628 ...................... VENEZUELA: Buoy ......................................................................................... 87
3403(P)/20 365 ........................ MEXICO, Gulf of Mexico: Works..................................................................... 83
4268(P)/20 583, 1025, 2016, WEST INDIES, Leeward Islands: Depth........................................................... 86
2600 ......................
4952(T)/20 618 ........................ WEST INDIES, Leeward Islands: Buoyage; Dredging area ............................. 87
4958(T)/20 2626 ...................... MEXICO, Gulf of Campeche: Buoy.................................................................. 83
5429(P)/20 8007 ...................... PANAMA, Panama Canal: Maritime limit; Works............................................ 88
5440(P)/20 517, 572 ............... GUYANA: Submarine pipeline.......................................................................... 87
5770(T)/20 481 ........................ WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
6275(T)/20 2626 ...................... MEXICO, Gulf of Campeche: Wreck................................................................ 83
172(T)/21 2267 ...................... COLOMBIA, Caribbean Sea Coast: Leading lights .......................................... 88
219(T)/21 2751 ...................... MEXICO, Gulf of Mexico: Obstruction ............................................................ 83
234(P)/21 477 ........................ WEST INDIES, Trinidad and Tobago: Works; Submarine pipeline .................. 87
612(T)/21 2434 ...................... COLOMBIA, Caribbean Sea Coast: Anchorage area; Depths........................... 88
794(P)/21 8006 ...................... PANAMA, Panama Canal: Light; Leading lights; Leading line........................ 88
1077(T)/21 474 ........................ WEST INDIES, Trinidad and Tobago: Works; Wrecks ..................................... 87
1087(T)/21 475 ........................ WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
1222(T)/21 368 ........................ WEST INDIES, Windward Islands: Wreck ....................................................... 87
1474(T)/21 375 ........................ MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
1646(P)/21 467 ........................ DOMINICAN REPUBLIC: Port development; Depths .................................... 86
1783(T)/21 596, 597, 791 ...... WEST INDIES, Windward Islands: Restricted area.......................................... 87
1873(P)/21 376, 1307 ............. MEXICO, Caribbean Sea Coast: Buoyage ........................................................ 83
2387(T)/21 1798 ...................... COSTA RICA, Caribbean Sea Coast: Wreck; Buoy .......................................... 85
3250(T)/21 517, 2764 ............. SURINAME: Scientific instruments; Buoy ....................................................... 87
3430(P)/21 2079 ...................... WEST INDIES, Leeward Islands: Wrecks; Obstructions; Depths .................... 86
3562(T)/21 2988 ...................... HONDURAS: Buoy........................................................................................... 85
3579(T)/21 583, 1025, 2016, WEST INDIES, Leeward Islands: Wreck .......................................................... 86
2600 ......................
3926(T)/21 461 ........................ WEST INDIES, Bahamas: Light-beacon........................................................... 83
3976(P)/21 697 ........................ WEST INDIES, Windward Islands: Depths ...................................................... 87
4037(T)/21 527, 572 ............... GUYANA: Buoyage........................................................................................... 87
4062(P)/21 500, 1044 ............. WEST INDIES, Trinidad and Tobago: Submarine cable................................... 87
4145(P)/21 517, 572 ............... GUYANA: Submarine cable; Works.................................................................. 87

1A.40
Wk04/23
 IA
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO - continued
4253(T)/21 376, 2753 ............. MEXICO, Gulf of Mexico: Buoy; Radar beacon .............................................. 83
4897(T)/21 2626 ...................... MEXICO, Gulf of Campeche: Buoyage ............................................................ 83
4899(T)/21 2753 ...................... MEXICO, Gulf of Mexico: Buoyage................................................................. 83
5025(P)/21 CP 2........................ PANAMA, Panama Canal: Depth; Anchorage areas; Buoyage; Wrecks........... 88
5164(T)/21 1307, 2626 ........... MEXICO, Gulf of Campeche: Anchorage area ................................................. 83
377(T)/22 2434 ...................... COLOMBIA, Caribbean Sea Coast: Buoy ........................................................ 88
379(P)/22 2194 ...................... COLOMBIA, Caribbean Sea Coast: Restricted area ......................................... 87
596(T)/22 375 ........................ MEXICO, Gulf of Mexico: Buoyage................................................................. 83
1061(P)/22 463 ........................ DOMINICAN REPUBLIC: Works; Port developments; Dredging area; Pier .. 86
1226(T)/22 1629 ...................... VENEZUELA: Buoy ......................................................................................... 87
1237(T)/22 517, 2764 ............. GUYANA: Platform; Restricted area................................................................. 87
1258(T)/22 390, 398, 3910 .... WEST INDIES, Bahamas: Buoy ....................................................................... 83
1534(T)/22 2261 ...................... COLOMBIA, Caribbean Sea Coast: Virtual aid to navigation .......................... 88
1890(T)/22 376, 1307 ............. MEXICO, Gulf of Mexico: Light ...................................................................... 83
1897(P)/22 8006 ...................... PANAMA, Panama Canal: Dredged depths....................................................... 88
2005(P)/22 2765 ...................... SURINAME: Depths ......................................................................................... 87
2153(T)/22 375 ........................ MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
2220(T)/22 2751 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
2224(T)/22 363, 364, 376, 3768 MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
2531(T)/22 477, 500, 1044 .... WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
2737(T)/22 477, 500, 1044 .... WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
2877(T)/22 369 ........................ WEST INDIES, Windward Islands: Restricted area.......................................... 87
3251(P)/22 462 ........................ WEST INDIES, Cayman Islands: Depths; Drying height ................................. 83
3437(T)/22 369, 494 ............... WEST INDIES, Windward Islands: Buoy ......................................................... 87
3456(T)/22 414 ........................ CUBA, North Coast: Buoy; Automatic Identification System .......................... 83
3631(T)/22 2764, 2765 ........... SURINAME: Buoy; Wreck................................................................................ 87
3656(T)/22 2753 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
3662(P)/22 804 ........................ WEST INDIES, Leeward Islands: Restricted area............................................. 87
3877(T)/22 517, 4216 ............. GUYANA: Platform; Restricted area................................................................. 87
4073(T)/22 477, 500, 1044 .... WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
4217(T)/22 481, 483 ............... WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
4316(T)/22 230, 2191 ............. VENEZUELA: Buoy ......................................................................................... 87
4744(T)/22 572, 2764, 2766 .. SURINAME: Buoy ............................................................................................ 87
4767(T)/22 474, 483 ............... WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
4882(T)/22 2626 ...................... MEXICO, Gulf of Campeche: Buoy; Wreck ..................................................... 83
4942(P)/22 363, 364, 376, 3768 MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
5014(T)/22 2261 ...................... COLOMBIA, Caribbean Sea Coast: Virtual aids to navigation......................... 88
116(P)/23 3188 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Depths; Obstructions; 83
Dredged depths; Wreck ......................................................................................
26. EAST COAST OF NORTH AMERICA AND GREENLAND
2681(P)/16 2490, 4746 ........... UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 80, 81
2682(P)/16 2865, 3691 ........... UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 81
1397(T)/17 2483 ...................... UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
1417(T)/17 2732 ...................... UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
444(P)/20 2755, 2860 ........... UNITED STATES OF AMERICA, East Coast: Submarine cable..................... 81
3883(P)/20 2919 ...................... UNITED STATES OF AMERICA, East Coast: Submarine cable..................... 81
2206(T)/21 4777 ...................... CANADA, Saint Lawrence River: Scientific instruments................................. 79
2683(T)/22 4777, 4779, 4782 CANADA, Saint Lawrence River: Restricted areas; Area to be avoided .......... 79
2819(T)/22 4779, 4782 ........... CANADA, Saint Lawrence River: Restricted areas .......................................... 79
2869(T)/22 2666, 4011, 4013, CANADA, Gulf of Saint Lawrence: Restricted areas; General information..... 19, 78, 79,
4404, 4763, 4764, 82
4765, 4766, 4767,
4768, 4774 ...........
3800(T)/22 4786 ...................... CANADA, Saint Lawrence River: Lights ......................................................... 79
4760(P)/22 1516, 1528 ........... UNITED STATES OF AMERICA, East Coast: Channel limits; Legends; 81
Dredged depths; Anchorage areas; Alongside depth; General information .......

Source: UKHO

1A.41
Wk04/23
 II

GEOGRAPHICAL INDEX

(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7

(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.8 – 2.14
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.14
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.14 – 2.16
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.16 – 2.19
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19 – 2.21
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21 – 2.22
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.23
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.25
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.26 – 2.32
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.32 – 2.33
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34 – 2.36
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.37
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.37
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.39 – 2.40
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.40 – 2.41
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.41
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.42 – 2.44
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.45 – 2.53

2.1
Wk04/23
 II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
233 2.34 52 290 2.43 81
234 2.40 95 291(P)/23 2.47 30
235 2.16 9 292 2.43 81
236 2.21 19 293* 2.11 2, 8
237 2.19 18 294 2.14 10
238(T)/23 2.52 56 295 2.7 15
239* 2.8 1, 2 296 2.22 31
240(T)/23 2.49 41 297 2.29 52
241(T)/23 2.45 11 298 2.34 52
242 2.42 81 299 2.29 48, 50
243 2.20 18 300 2.23 40
244(P)/23 2.49 47 301 2.22 29
245 2.42 81 302(T)/23 2.45 10
246 2.39 89 303 2.30 52
247* 2.9 2, 6 304* 2.12 2, 4
248* 2.9 2, 8 305 2.40 89
249 2.26 50 306 2.23 24
250 2.26 50 307* 2.12 2
251(T)/23 2.52 52, 53 308 2.43 81
252(T)/23 2.52 52 309 2.15 10, 11
253 2.42 81 310* 2.37 66, 68, 70
254 2.20 18 311 2.15 10
255 2.41 87 312 2.30 48
256(P)/23 2.45 6, 7, 13, 15 313 2.41 83
257 2.42 81 314 2.16 10
258 2.39 98 315 2.37 71
259* 2.17 9 316 2.14 14
260 2.20 18, 20 317* 2.13 2, 7
261 2.21 26 318* 2.14 8
262 2.34 48, 58 319 2.30 47
263(T)/23 2.50 50 320* 2.19 6, 7
264* 2.26 47 321* 2.14 6
265 2.27 52 322 2.41 83
266 2.27 50 323 2.44 81
267 2.24 43 324 2.32 55
268 2.42 81 325 2.33 55
269 2.22 27 326 2.33 55
270 2.28 50 327 2.33 53
271 2.25 43 328 2.33 53
272* 2.10 8 329(T)/23 2.50 55
273 2.17 7, 9 330(T)/23 2.50 55
274 2.41 95 331(T)/23 2.51 55
275 2.21 18 332(T)/23 2.51 55
276 2.40 98 333(T)/23 2.51 54
277* 2.17 6, 7 334(T)/23 2.51 54
278 2.28 47 335 2.33 52, 53
279* 2.10 3 336 2.31 52
280* 2.18 7, 9 337 2.36 60
281 2.28 50 338* 2.23 40
282 2.42 81 339 2.34 52
283 2.28 50 340 2.7 10
284 2.43 81 341 2.31 50
285 2.22 26 342(P)/23 2.48 40
286 2.29 47 343 2.44 81
287 2.29 50 344(P)/23 2.48 40
288* 2.11 7 345 2.32 50
289* 2.18 7 346(P)/23 2.46 10

2.2
Wk04/23
 II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
347 2.16 11
348 2.22 28
349(T)/23 2.46 10
350* 2.32 47
351 2.32 50
352* 2.19 2, 7
353(T)/23 2.47 9
354(T)/23 2.46 12
355(T)/23 2.47 9
356(T)/23 2.52 66
357(T)/23 2.53 66
358 2.16 10

2.3
Wk04/23
 II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices

Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

2 256P 1422 280

87 260 1481 247
90 271 1503 273
114 355T 1576 310
120 235 1591 291P
127 251T, 335 1606 318
130 353T 1607 293
219 256P 1609 248
240 306 1632 273
245 256P 1666 351
259 309 1667 351
266 289, 352 1674 310
267 280 1719 287
269 269 1738 283, 341
278 277, 320 1754 250
291 277, 320 1759 283, 341
317 267 1760 263T
431 234 1800 329T, 330T
527 255 1803 330T
572 255 1826 279
579 274 1853 258
586 276 1957 236
589 274 1968 299
744 310 2055 302T
745 310 2059 302T
798 302T 2069 267
800 346P 2082 309
802 311, 346P 2117 340
803 311, 346P 2151 272
810 311, 346P 2182A 352
811 314 2182B 280, 352
820 314, 349T 2182C 256P
870 354T 2182D 256P
882 238T 2211 347
896 252T 2215 294
898 252T 2252 309
911 358 2255 239
913 298 2347 335
936 310 2352 316
954 261 2376 281
963 285 2409 263T, 345
1022 305 2423 304
1023 305 2424 304
1028 246 2429 301
1036 278, 350 2456 323
1059 264 2462 310
1085 348 2463 310
1164 307 2495 304
1178 307 2523 342P
1179 307 2597 340
1185 248 2610 239
1233 256P 2615 239
1239 256P 2634 291P
1249 303 2732 290
1250 303 2753 322
1253 297 2791 337
1255 303 2801 284
1256 303 2807 284
1258 339 2809 253
1261 244P 2818 292
1263 336 2829 343
1264 336 2850 257, 268
1270 233 2888 300
1275 296 2890 323
1281 265 2919 343
1283 265 2920 242
1294 336 2921 282
1408 273 2942 340
1411 279 2956 295

2.4
Wk04/23
 II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices

Notices Australian
Admiralty Chart No. Notices
Chart No.
3132 260 Aus 812 357T
3171 300 Aus 839 356T
3176 338
3177 338
3220 254 German
3221 254 Notices
Chart No.
3230 299
3231 249, 263T DE 47 259
3232 299 DE 50 280
3235 249
3258 243
3259 237 Indian
Notices
3282 256P Chart No.
3284 321
3365 251T IN 31 271
3449 266 IN 203 240T
3451 245 IN 313 267
3453 266 IN 2068 240T
3458 308 IN 3001 267
3480 297, 335
3483 262, 312 Japanese
3497 288 Notices
Chart No.
3520 300
3634 275 JP 10 326
3635 254 JP 65 331T
3636 260 JP 131 333T
3658 249, 270, 345 JP 135 334T
3713 338 JP 148 324
3715 338 JP 198 327
3723 300 JP 213 327, 328
3750 317 JP 1030 329T
3752 338, 344P JP 1032 330T
3819 347 JP 1034 329T
3828 241T JP 1100 332T
3851 313 JP 1192 325
3875 319 JP 1195 326
3929 251T JP 1262 334T
3963 286 JP 1263 334T
4103 260
4104 260
4140 256P, 280 New Zealand
Notices
4410 299 Chart No.
4411 262
4416 262 NZ 5612 315
4417 262
4484 262 International
4486 262 Notices
4487 262 Chart No.
4488 262
4489 262 INT 103 260
4491 262 INT 104 260
4636 310 INT 120 309
4637 310 INT 140 256P, 280
5601_4 239 INT 160 256P
5606_2 293 INT 551 262, 312
5606_5 293 INT 636 310
5606_6 317 INT 637 310
5606_7 248 INT 756 271
5606_9 248 INT 1040 256P
5607_12 317 INT 1041 256P
5607_3 317 INT 1042 280, 352
5615_23 352 INT 1043 352
5617_14 247 INT 1044 280
5620_3 307 INT 1045 280
5623_2 304 INT 1060 256P
INT 1110 295
INT 1192 241T
INT 1204 302T
INT 1206 309

2.5
Wk04/23
 II

INDEX OF CHARTS AFFECTED

International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 1216 302T
INT 1220 302T
INT 1238 314, 349T
INT 1239 314
INT 1251 347
INT 1310 354T
INT 1322 358
INT 1353 340
INT 1368 340
INT 1420 273
INT 1423 353T
INT 1425 272
INT 1454 259
INT 1476 355T
INT 1479 235
INT 1500 256P
INT 1509 273
INT 1543 247
INT 1554 288
INT 1562 293
INT 1572 248
INT 1607 279
INT 1608 279
INT 1610 307
INT 1611 307
INT 1613 304
INT 1725 239
INT 1771 311, 346P
INT 1772 311, 346P
INT 1773 346P
INT 1871 243
INT 1875 254
INT 1876 254
INT 1880 237
INT 3549 306
INT 3681 291P
INT 5252 251T
INT 5254 298
INT 5355 252T
INT 5363 233
INT 6883 310
INT 6899 310
INT 7199 300
INT 7200 300
INT 7216 338
INT 7222 338
INT 7223 338
INT 7224 338
INT 7250 342P
INT 7319 240T
INT 7400 267
INT 7402 267
INT 8088 305
INT 9316 316
INT 12511 347

2.6
Wk04/23
 II
295 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

2956 4728/22 Effective immediately

INT 1110 Insert magenta limit and chart number, IS 530, as follows:

North: 65° 43´·30N. East: 18° 02´·30W.

South: 65° 40´·00N. West: 18° 07´·80W.

340 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

2117 5119/22 Effective from 26/01/23

Insert magenta limit and chart number, DE31, as follows:

North: 54° 40´·60N. East: 11° 34´·00E.

South: 54° 11´·50N. West: 11° 00´·00E.
Insert magenta limit and chart number, DE43, as follows:

North: 54° 37´·50N. East: 11° 06´·80E.

South: 54° 17´·60N. West: -

2597 5119/22 Effective from 26/01/23

INT 1368 Insert magenta limit and chart number, DE31, as follows:

North: 54° 40´·60N. East: -

South:- West: 11° 00´·00E.

2942 5119/22 Effective from 26/01/23

INT 1353 Insert magenta limit and chart number, DE31, as follows:

North: 54° 40´·60N. East: -

South: 54° 11´·50N. West: 11° 00´·00E.
Delete former magenta limit and chart number, DE31, in the following positions:

54° 12´·14N., 10° 56´·11E.

54° 39´·88N., 11° 25´·56E.
Insert magenta limit and chart number, DE43, as follows:

North: 54° 37´·50N. East: 11° 06´·80E.

South: 54° 17´·60N. West: 10° 16´·50E.
Delete former magenta limit and chart number, DE43, in the following positions:

54° 16´·63N., 11° 02´·80E.

54° 35´·82N., 10° 16´·95E.

2.7
Wk04/23
 II

239* ENGLAND - South Coast - Depths. Obstructions. Wrecks.

Source: UKHO

Chart 2255 (INT 1725) [ previous update 3962/22 ] ETRS89 DATUM

Insert depth, 195, enclosed by 20m contour 50° 32´·99N., 2° 19´·47W.
Replace
27%,Obstn with 21%,Obstn 50° 34´·02N., 2° 19´·54W.

27,Obstn with 22,Obstn 50° 34´·11N., 2° 19´·41W.

27,Obstn with 26,Obstn 50° 34´·00N., 2° 19´·33W.

Chart 2610 [ previous update 4076/21 ] ETRS89 DATUM

Insert
21%,Wk (a) 50° 32´·49N., 2° 16´·15W.
Delete
22%,Wk, close S of: (a) above
Insert depth, 195, enclosed by 20m contour (b) 50° 32´·99N., 2° 19´·47W.
Delete depth, 21, close SW of: (b) above
Replace
27%,Obstn with 21%,Obstn 50° 34´·02N., 2° 19´·54W.

27,Obstn with 22,Obstn 50° 34´·11N., 2° 19´·41W.

depth, 27, with depth, 26 50° 34´·00N., 2° 19´·33W.

Chart 2615 [ previous update 4388/22 ] ETRS89 DATUM

Insert
21%,Wk (a) 50° 32´·49N., 2° 16´·15W.
Delete
22%,Wk, close S of: (a) above
Insert depth, 195, enclosed by 20m contour (b) 50° 32´·99N., 2° 19´·47W.
Delete depth, 21, close SW of: (b) above
Insert depth, 215 (c) 50° 34´·02N., 2° 19´·54W.
Delete depth, 27, close NE of: (c) above

Chart 5601_4 [ previous update New Chart 02/12/2021 ] ETRS89 DATUM

Insert
21%,Wk (a) 50° 32´·49N., 2° 16´·15W.
Delete
22%,Wk, close S of: (a) above
Insert depth, 195, enclosed by 20m contour (b) 50° 32´·99N., 2° 19´·47W.
Delete depth, 21, close SW of: (b) above
Insert depth, 215 (c) 50° 34´·02N., 2° 19´·54W.
Delete depth, 27, close NE of: (c) above

2.8
Wk04/23
 II

247* SCOTLAND - East Coast - Buoyage. Beacons.

Source: Forth Ports Ltd

Chart 1481 (INT 1543) (Panel, Dundee Docks) [ previous update 4877/22 ] ETRS89 DATUM
Insert
GWVQ(3)5s
r (a) 56° 27´·603N., 2° 57´·163W.
Delete
BdFowler Rk, close W of: (a) above

K§j 56° 27´·533N., 2° 57´·328W.

K 56° 27´·568N., 2° 57´·365W.

Chart 1481 (INT 1543) [ previous update 4877/22 ] ETRS89 DATUM

Insert
GWVQ(3)5s
r (a) 56° 27´·60N., 2° 57´·16W.
Delete
Bd, close W of: (a) above

K§j 56° 27´·53N., 2° 57´·33W.

K 56° 27´·57N., 2° 57´·36W.

Chart 5617_14 [ previous update 3891/22 ] ETRS89 DATUM

Insert
GWVr Q(3)5s (a) 56° 27´·60N., 2° 57´·16W.
Delete
Bd, close W of: (a) above

K§j 56° 27´·53N., 2° 57´·33W.

K 56° 27´·57N., 2° 57´·36W.

248* ENGLAND - East Coast - Depths.

Source: Port of London Authority

Chart 1185 (INT 1572) [ previous update 4794/22 ] ETRS89 DATUM

Insert depth, 127 51° 29´·45N., 0° 48´·22E.
depth, 137 51° 29´·35N., 0° 48´·50E.
depth, 138 (a) 51° 29´·41N., 0° 50´·49E.
Delete depth, 14, close SW of: (a) above

Chart 1609 [ previous update 4772/22 ] ETRS89 DATUM

Insert depth, 138 (a) 51° 29´·41N., 0° 50´·49E.
Delete depth, 139 , close SW of: (a) above

2.9
Wk04/23
 II
248* ENGLAND - East Coast - Depths. (continued)

Chart 5606_7 [ previous update New Edition 03/11/2022 ] ETRS89 DATUM

Insert depth, 127 51° 29´·45N., 0° 48´·22E.
depth, 137 51° 29´·35N., 0° 48´·50E.
depth, 138 (a) 51° 29´·41N., 0° 50´·49E.
Delete depth, 14, close SW of: (a) above

Chart 5606_9 [ previous update New Edition 03/11/2022 ] ETRS89 DATUM

Insert depth, 127 51° 29´·45N., 0° 48´·22E.
depth, 137 51° 29´·35N., 0° 48´·50E.
depth, 138 (a) 51° 29´·41N., 0° 50´·49E.
Delete depth, 14, close SW of: (a) above

272* ENGLAND - East Coast - Depths.

Source: Port of London Authority

Chart 2151 (INT 1425) [ previous update 3903/22 ] ETRS89 DATUM

Insert depth, 82 (a) 51° 28´·192N., 0° 19´·051E.
Delete depth, 64 , close NE of: (a) above
Replace depth, 63 , with depth, 62 51° 28´·235N., 0° 18´·993E.

279* IRISH SEA - Depths.

Source: British Government Survey

Chart 1411 (INT 1608) [ previous update 96/23 ] ETRS89 DATUM

Insert depth, 47, enclosed by 50m contour (a) 53° 43´·62N., 4° 30´·52W.
Delete depth, 53, close SW of: (a) above

Chart 1826 (INT 1607) [ previous update 96/23 ] ETRS89 DATUM

Insert depth, 47, enclosed by 50m contour (a) 53° 43´·62N., 4° 30´·52W.
Delete depth, 53, close SW of: (a) above

2.10
Wk04/23
 II

288* ENGLAND - East Coast - Drying heights. Depths.

Source: ABP Humber

Chart 3497 (INT 1554) [ previous update 122/23 ] ETRS89 DATUM

Insert depth, 18, and extend 2m contour NE to enclose 53° 43´·66N., 0° 18´·42W.
drying height, 2 53° 43´·24N., 0° 20´·45W.
drying height, 04, and extend 0m low water line S to enclose 53° 43´·07N., 0° 21´·07W.
depth, 08, and extend 2m contour E to enclose (a) 53° 43´·64N., 0° 18´·64W.
Delete depth, 23, close N of: (a) above
Insert drying height, 21 (b) 53° 43´·37N., 0° 20´·16W.
Delete drying height, 16, close E of: (b) above
drying height, 15, close W of: (b) above
Insert drying height, 13 (c) 53° 43´·28N., 0° 18´·40W.
Delete drying height, 1, close E of: (c) above
drying height, 06, close W of: (c) above
Insert drying height, 17 (d) 53° 43´·24N., 0° 20´·77W.
Delete drying height, 1, close NE of: (d) above
drying height, 07, close SW of: (d) above
Replace depth, 06, with drying height, 09, and extend 0m low water line
S to enclose (e) 53° 43´·21N., 0° 20´·32W.
Delete drying height, 03, close NE of: (e) above

293* ENGLAND - East Coast - Buoy.

Source: Coastal Science Ltd
Note: This update is included in New Edition 1183, published 9 February 2023.

Chart 1607 (INT 1562) [ previous update 4772/22 ] ETRS89 DATUM

Move
BfFl(5)Y.20s, from: 51° 23´·20N., 1° 03´·24E.
to: 51° 22´·89N., 1° 02´·62E.

Chart 5606_5 [ previous update 3400/22 ] ETRS89 DATUM

Move
BfFl(5)Y.20s, from: 51° 23´·20N., 1° 03´·24E.
to: 51° 22´·89N., 1° 02´·62E.

Chart 5606_2 [ previous update 4614/22 ] ETRS89 DATUM

Move
BfFl(5)Y.20s, from: 51° 23´·20N., 1° 03´·24E.
to: 51° 22´·89N., 1° 02´·62E.

2.11
Wk04/23
 II

304* IRELAND - South West Coast - Depths.

Source: Geological Survey Ireland

Chart 2423 [ previous update 4146/22 ] ETRS89 DATUM

Insert depth, 185, enclosed by 20m contour 51° 34´·34N., 10° 14´·61W.
depth, 92, enclosed by 100m contour 51° 17´·08N., 10° 05´·18W.
depth, 90, enclosed by 100m contour (a) 51° 17´·29N., 9° 56´·88W.
Delete depth, 105, close SW of: (a) above

Chart 2424 (INT 1613) [ previous update 140/23 ] ETRS89 DATUM

Insert depth, 185, enclosed by 20m contour 51° 34´·34N., 10° 14´·61W.
depth, 92, enclosed by 100m contour 51° 17´·05N., 10° 05´·02W.
depth, 90, enclosed by 100m contour (a) 51° 17´·29N., 9° 56´·88W.
Delete depth, 105, close SW of: (a) above

Chart 2495 [ previous update 3950/22 ] ETRS89 DATUM

Insert depth, 126, enclosed by 20m contour 51° 34´·10N., 10° 15´·17W.
Insert depth, 185, enclosed by 20m contour (a) 51° 34´·34N., 10° 14´·61W.
Delete depth, 52, close NE of: (a) above

Chart 5623_2 [ previous update 4146/22 ] ETRS89 DATUM

Insert depth, 185, enclosed by 20m contour 51° 34´·34N., 10° 14´·61W.
depth, 92, enclosed by 100m contour 51° 17´·05N., 10° 05´·02W.
depth, 90, enclosed by 100m contour (a) 51° 17´·29N., 9° 56´·88W.
Delete depth, 105, close SW of: (a) above

307* ENGLAND - West Coast - Depth.

Source: Clinton Marine Survey

Chart 1164 [ previous update 119/23 ] ETRS89 DATUM

Insert depth, 52 51° 19´·13N., 4° 45´·67W.

Chart 1178 (INT 1611) [ previous update 57/23 ] ETRS89 DATUM

Insert depth, 52 51° 19´·13N., 4° 45´·67W.

Chart 1179 (INT 1610) [ previous update 119/23 ] ETRS89 DATUM

Insert depth, 52 51° 19´·13N., 4° 45´·67W.

Chart 5620_3 [ previous update 3917/22 ] ETRS89 DATUM

Insert depth, 52 51° 19´·13N., 4° 45´·67W.

2.12
Wk04/23
 II

317* ENGLAND - East Coast - NM Block. Depths. Obstruction.

Source: Crouch Harbour Authority
Note: This update is included in New Edition 1975, published 19 January 2023.

Chart 3750 [ previous update 228/23 ] ETRS89 DATUM

Insert the accompanying block, centred on: 51° 39´·8N., 1° 01´·6E.
depth, 37 (a) 51° 37´·65N., 0° 56´·51E.
Delete depth, 41, close NE of: (a) above

Chart 5606_6 [ previous update 228/23 ] ETRS89 DATUM

Insert obstruction out of position, 2$+Obstn 51° 39´·06N., 1° 00´·23E.
depth, 36, and extend 5m contour N to enclose 51° 39´·11N., 1° 00´·68E.
depth, 37, and extend 5m contour N to enclose (a) 51° 39´·12N., 1° 01´·11E.
Delete depth, 53, close NW of: (a) above
Insert depth, 36, and extend 5m contour SE to enclose 51° 39´·30N., 1° 01´·34E.
depth, 39, and extend 5m contourSE to enclose (b) 51° 39´·91N., 1° 02´·35E.
Delete depth, 72, close SE of: (b) above
Insert depth, 31 (c) 51° 39´·99N., 1° 02´·68E.
Delete depth, 37, close NE of: (c) above
Insert depth, 28 (d) 51° 40´·33N., 1° 03´·22E.
Delete depth, 36, close NE of: (d) above

Chart 5607_3 [ previous update 228/23 ] ETRS89 DATUM

Insert obstruction out of position, 2$+Obstn 51° 39´·06N., 1° 00´·23E.
depth, 36, and extend 5m contour N to enclose 51° 39´·11N., 1° 00´·68E.
depth, 37, and extend 5m contour N to enclose (a) 51° 39´·12N., 1° 01´·11E.
Delete depth, 53, close NW of: (a) above
Insert depth, 36, and extend 5m contour SE to enclose 51° 39´·30N., 1° 01´·34E.
depth, 39, and extend 5m contourSE to enclose (b) 51° 39´·91N., 1° 02´·35E.
Delete depth, 72, close SE of: (b) above
Insert depth, 31 (c) 51° 39´·99N., 1° 02´·68E.
Delete depth, 37, close NE of: (c) above
Insert depth, 28 (d) 51° 40´·33N., 1° 03´·22E.
Delete depth, 36, close NE of: (d) above

Chart 5607_12 [ previous update New Chart 18/11/2021 ] ETRS89 DATUM

Insert depth, 37 (a) 51° 37´·65N., 0° 56´·51E.
Delete depth, 41, close NE of: (a) above

2.13
Wk04/23
 II

318* ENGLAND - East Coast - Depths.

Source: Port of London Authority

Chart 1606 [ previous update 4433/22 ] ETRS89 DATUM

Insert depth, 81 (a) 51° 36´·23N., 1° 20´·58E.
Delete depth, 85, close SE of: (a) above
Insert depth, 77 , and extend 8m approximate contour NE to enclose (b) 51° 36´·06N., 1° 20´·21E.
Delete depth, 81, close SW of: (b) above

321* SCOTLAND - Shetland Islands - Buoyage.

Source: Shetland Islands Council

Chart 3284 (Panel B, Out Skerries Harbour) [ previous update 66/23 ] ETRS89 DATUM
Insert
Jd 60° 25´·199N., 0° 45´·117W.
60° 25´·156N., 0° 45´·138W.

316 NORWAY - North Coast - Light.

Source: Norwegian Notice 15/68474/22

Chart 2352 (INT 9316) [ previous update 4615/22 ] WGS84 DATUM

Amend light to, Iso 4s 71° 05´·3N., 24° 03´·3E.

294 LATVIA - Wreck. Foul. Obstruction. Depths.

Source: Latvian Chart 1012

Chart 2215 [ previous update New Edition 29/09/2022 ] WGS84 DATUM

Insert
28%,Wk 57° 05´·64N., 23° 51´·90E.

« 57° 05´·35N., 23° 53´·81E.

19", Obstn 57° 06´·53N., 23° 56´·99E.

depth, 136 (a) 57° 06´·93N., 24° 01´·90E.
Delete depth, 169 , close SW of: (a) above

2.14
Wk04/23
 II

309 SWEDEN - East Coast - Depths.

Source: Swedish Chart 53

Chart 259 (INT 120) [ previous update 5118/22 ] WGS84 DATUM

Insert depth, 39, enclosed by 50m contour 61° 39´·1N., 17° 53´·1E.

Chart 2082 (INT 1206) [ previous update 2395/22 ] WGS84 DATUM

Insert depth, 39, enclosed by 50m contour (a) 61° 39´·06N., 17° 53´·13E.
Delete depth, 68, close SE of: (a) above

Chart 2252 [ previous update 5118/22 ] WGS84 DATUM

Insert depth, 39, enclosed by 50m contour 61° 39´·1N., 17° 53´·1E.

311 SWEDEN - East Coast - Lights.

Source: Swedish Notices 942/17200/22, 942/17211/22, 942/17213/22, 942/17253/22, 942/17255/22, 942/17257-17258/22 and
942/17260-17261/22

Chart 802 (INT 1772) (Panel B, Flaten) [ previous update 5043/22 ] WGS84 DATUM
Amend light to, Fl(2) WRG 3s 59° 30´·252N., 16° 34´·698E.

Chart 802 (INT 1772) [ previous update 5043/22 ] WGS84 DATUM

Amend light to, Fl(2) WRG 3s 59° 30´·25N., 16° 34´·70E.
light to, Iso WRG 3s 59° 31´·70N., 16° 40´·62E.
59° 30´·74N., 16° 42´·34E.
59° 30´·85N., 16° 43´·88E.
59° 29´·44N., 16° 51´·93E.
light to, Iso 59° 31´·73N., 16° 59´·24E.
59° 31´·20N., 16° 59´·35E.
light to, Iso WRG 3s 59° 31´·68N., 17° 01´·95E.
light to, Fl(2) WRG 3s 59° 31´·71N., 17° 03´·00E.

Chart 803 (Panel A, Hjulstafjärden) [ previous update 4682/22 ] WGS84 DATUM

Amend light to, Iso WRG 3s 59° 31´·201N., 16° 59´·350E.
59° 31´·732N., 16° 59´·242E.
59° 31´·682N., 17° 01´·952E.
light to, Fl(2) WRG 3s 59° 31´·712N., 17° 03´·000E.

Chart 803 (Panel B, Aggarösundet) [ previous update 4682/22 ] WGS84 DATUM

Amend light to Iso WRG 3s 59° 30´·734N., 16° 42´·338E.
59° 30´·849N., 16° 43´·877E.

Chart 810 (INT 1771) [ previous update 5043/22 ] WGS84 DATUM

Amend light to, Fl(2) WRG 3s 59° 31´·71N., 17° 03´·00E.

2.15
Wk04/23
 II

314 SWEDEN - East Coast - NM Blocks.

Source: Swedish Notice 942/17304/22
Note: Former Notice 3740(T)/19 is cancelled.

Chart 811 (INT 1239) [ previous update 202/23 ] WGS84 DATUM

Insert the accompanying block, centred on: 59° 21´·7N., 18° 06´·6E.

Chart 820 (INT 1238) [ previous update 202/23 ] WGS84 DATUM

Insert the accompanying block, centred on: 59° 21´·7N., 18° 06´·6E.

347 FINLAND - South Coast - Buoy.

Source: Finnish Notice 22/183/22

Chart 2211 (INT 12511) [ previous update 4850/22 ] WGS84 DATUM

Delete
J\ 60° 04´·70N., 24° 21´·64E.

Chart 3819 (INT 1251) [ previous update 4850/22 ] WGS84 DATUM

Delete
J\ 60° 04´·70N., 24° 21´·64E.

358 SWEDEN - West Coast - Restricted area.

Source: Swedish Notice 944/17307/23

Chart 911 (INT 1322) [ previous update New Edition 08/12/2022 ] WGS84 DATUM
Insert limit of restricted area, entry prohibited, pecked line, joining: 55° 36´·763N., 12° 59´·644E.
55° 36´·769N., 12° 59´·615E.
symbol, entry prohibited, centred on: 55° 36´·629N., 12° 59´·523E.

235 NETHERLANDS - NM Block.

Source: Netherlands Notice 51-52/389/22

Chart 120 (INT 1479) [ previous update 44/23 ] WGS84 DATUM

Insert the accompanying block, centred on: 51° 21´·9N., 3° 51´·1E.

2.16
Wk04/23
 II

259* GERMANY - North Sea Coast - Restricted area.

Source: WSA Elbe-Nordsee, 329(T)/22

Chart DE 47 (INT 1454) (Panel, Bützfleth and Stadersand) [ previous update 5000/22 ] WGS84 DATUM
Insert limit of restricted area, entry prohibited, pecked line, joining: 53° 38´·561N., 9° 31´·063E.
53° 37´·976N., 9° 31´·546E.
53° 37´·892N., 9° 31´·468E.
53° 38´·568N., 9° 30´·915E.

Chart DE 47 (INT 1454) [ previous update 5000/22 ] WGS84 DATUM

Insert limit of restricted area, entry prohibited, pecked line, joining: 53° 38´·56N., 9° 31´·06E.
53° 37´·98N., 9° 31´·55E.
53° 37´·89N., 9° 31´·47E.
53° 38´·57N., 9° 30´·92E.

273 NORTH SEA - Netherlands Sector - Buoy.

Source: Netherlands Notice 51-52/386/22

Chart 1408 [ previous update 212/23 ] WGS84 DATUM

Delete
E;Ff l(5)Y.20s NW B1 ODAS 53° 22´·7N., 3° 07´·0E.

Chart 1503 (INT 1509) [ previous update 48/23 ] ETRS89 DATUM

Delete
E;Ff l(5)Y.20s NW B1 ODAS 53° 22´·74N., 3° 06´·95E.

Chart 1632 (INT 1420) [ previous update 48/23 ] WGS84 DATUM

Delete
E;Fl(5)Y.20s
f NW B1 ODAS
53° 22´·74N., 3° 06´·95E.

277* NORTH SEA - United Kingdom Sector - Obstruction.

Source: Moreld Ross Offshore

Chart 278 [ previous update 117/23 ] WGS84 DATUM

Insert
143-Obstn 57° 58´·68N., 0° 31´·68E.

Chart 291 [ previous update 4186/22 ] WGS84 DATUM

Insert
143-Obstn 57° 58´·68N., 0° 31´·68E.

2.17
Wk04/23
 II

280* NORTH SEA - Danish Sector - Platforms. Legends. Radar beacon.

Source: DK 50/1058/22
Note: AIS remains unchanged.

Chart DE 50 (INT 1045) [ previous update 5185/22 ] WGS84 DATUM

Replace
¼ Tyra West A,B,C,D,E buoyed (ru) with ¼{ Tyra West
A,B,C,D,E buoyed (ru) (a) 55° 42´·9N., 4° 44´·9E.
Insert radar beacon, Racon(U), at platform (a) above
Replace
¼ Tyra East A,B,C,D,E,F,G,H buoyed (ru) with ¼{ Tyra
East A,B,C,D,E,F,G,H buoyed (ru) (b) 55° 43´·3N., 4° 48´·0E.
Insert legend, Racon(U), at platform (b) above

Chart 267 [ previous update 5185/22 ] WGS84 DATUM

Replace
¼ DUC-TW-A,B,C,D,E with ¼{ DUC-TW-A,B,C,D,E (a) 55° 42´·94N., 4° 44´·96E.
Insert legend, Racon(U), at platform (a) above
Replace
¼ DUC-TE-A,B,C,D,E,F with ¼{ DUC-TE-
A,B,C,D,E,F,G,H (b) 55° 43´·23N., 4° 48´·01E.
Insert legend, Racon(U), at platform (b) above

Chart 1422 (INT 1044) [ previous update 5185/22 ] WGS84 DATUM

Replace
¼ with ¼{ (a) 55° 42´·9N., 4° 45´·0E.
Insert radar beacon, Racon(U), at platform (a) above
Replace
¼ with ¼{ (b) 55° 43´·3N., 4° 48´·0E.
Insert legend, Racon(U), at platform (b) above

Chart 2182B (INT 1042) [ previous update 117/23 ] WGS84 DATUM

Replace
¼ with ¼{ (a) 55° 42´·9N., 4° 44´·9E.
Insert radar beacon, Racon(U), at platform (a) above
Replace
¼ with ¼{ (b) 55° 43´·2N., 4° 48´·2E.
Insert legend, Racon(U), at platform (b) above

Chart 4140 (INT 140) [ previous update 5070/22 ] WGS84 DATUM

Insert
¼{ 55° 42´·9N., 4° 44´·9E.
Replace
¼ with ¼{ 55° 43´·0N., 4° 48´·6E.

289* NORTH SEA - United Kingdom Sector - Depths.

Source: British Government Survey

Chart 266 [ previous update 5084/22 ] WGS84 DATUM

Insert depth, 285 , and extend 30m contour S to enclose 54° 18´·94N., 2° 20´·35E.
depth, 28, and extend 30m contour N to enclose (a) 54° 23´·03N., 2° 21´·56E.
Delete depth, 31, close N of: (a) above

2.18
Wk04/23
 II

320* NORTH SEA - United Kingdom Sector - Buoyage. Automatic Identification Systems.
Source: MarramWind Ltd

Chart 278 [ previous update 277/23 ] WGS84 DATUM

Insert
EfFl(5)Y.20s (a) 58° 03´·90N., 0° 38´·05W.
Automatic Identification System, AIS, at light-buoy (a) above

Chart 291 [ previous update 277/23 ] WGS84 DATUM

Insert
EfFl(5)Y.20s (a) 58° 03´·90N., 0° 38´·05W.

EfFl(5)Y.20s (2 buoys) (b) 58° 14´·79N., 0° 35´·95W.

Automatic Identification System, AIS, at light-buoy (a) above
(b) above

352* NORTH SEA - United Kingdom Sector - Wreck.

Source: British Government Survey

Chart 266 [ previous update 289/23 ] WGS84 DATUM

Insert
17#,Wk 54° 40´·79N., 2° 47´·52E.

Chart 2182A (INT 1043) [ previous update 212/23 ] WGS84 DATUM

Insert
17#,Wk 54° 40´·8N., 2° 47´·5E.

Chart 2182B (INT 1042) [ previous update 280/23 ] WGS84 DATUM

Insert
17#,Wk 54° 40´·8N., 2° 47´·5E.

Chart 5615_23 [ previous update 4703/22 ] WGS84 DATUM

Insert
17#,Wk 54° 40´·8N., 2° 47´·5E.

237 PORTUGAL - West Coast - Depths.

Source: Portuguese Notice 7/241/22

Chart 3259 (INT 1880) [ previous update New Edition 31/03/2022 ] WGS84 DATUM
Insert depth, 03 , enclosed by 2m contour and extend 5m contour SE
to enclose 38° 27´·493N., 8° 57´·990W.
Delete depth, 115 38° 28´·309N., 8° 56´·957W.

2.19
Wk04/23
 II

243 PORTUGAL - West Coast - Buoyage.

Source: Portuguese Notice 7/247/22

Chart 3258 (INT 1871) (Panel A, Porto De Leixòes and Barra Do Rio Douro) [ previous update 4431/22 ] WGS84
DATUM
Delete
EfFl(5)Y.20s2M ODAS APDL 1 41° 10´·439N., 8° 43´·861W.

Chart 3258 (INT 1871) [ previous update 4431/22 ] WGS84 DATUM

Move
EfFl(5)Y.20s2M ODAS APDL 1, from: 41° 10´·45N., 8° 43´·86W.
to: 41° 10´·46N., 8° 44´·50W.

254 PORTUGAL - West Coast - Drying contour. Depths.

Source: Portuguese Notice 7/240/22

Chart 3220 (INT 1875) [ previous update New Edition 05/05/2022 ] WGS84 DATUM
Insert circular limit of 0m low water line, radius 40m, centred on: 38° 40´·005N., 9° 17´·823W.
depth, 177, and extend 20m contour NW to enclose (a) 38° 40´·522N., 9° 17´·943W.
Delete depth, 21, close E of: (a) above

Chart 3221 (INT 1876) [ previous update New Edition 05/05/2022 ] WGS84 DATUM
Insert circular limit of 0m low water line, radius 40m, centred on: 38° 40´·005N., 9° 17´·823W.
depth, 177, and extend 20m contour NW to enclose (a) 38° 40´·522N., 9° 17´·943W.
Delete depth, 21, close E of: (a) above

Chart 3635 [ previous update 958/20 ] WGS84 DATUM

Insert depth, 177, and extend 20m contour NW to enclose (a) 38° 40´·52N., 9° 17´·94W.
Delete depth, 22, close S of: (a) above

260 PORTUGAL - West Coast - Buoyage.

Source: Portuguese Notice 7/248/22

Chart 87 [ previous update 3341/22 ] WGS84 DATUM

Insert
EfFl(5)Y.20s ODAS CSA 83 37° 53´·7N., 9° 27´·2W.
Delete former EfFl(5)Y.20s ODAS CSA 83
37° 41´·4N., 9° 43´·6W.

2.20
Wk04/23
 II
260 PORTUGAL - West Coast - Buoyage. (continued)

Chart 3132 [ previous update 4272/22 ] WGS84 DATUM

Move
EfFl(5)Y.20s ODAS CSA 83, from: 37° 41´·4N., 9° 43´·6W.
to: 37° 53´·7N., 9° 27´·2W.

Chart 3636 [ previous update 4429/22 ] WGS84 DATUM

Insert
EfFl(5)Y.20s ODAS CSA 83 37° 53´·66N., 9° 27´·20W.
Delete former EfFl(5)Y.20s ODAS CSA 83
37° 41´·42N., 9° 43´·58W.

Chart 4103 (INT 103) [ previous update 57/23 ] WGS84 DATUM

Move
EODAS, from: 37° 41´·0N., 9° 43´·0W.
to: 37° 54´·0N., 9° 29´·6W.

Chart 4104 (INT 104) [ previous update 3341/22 ] WGS84 DATUM

Move
EODAS, from: 37° 41´·0N., 9° 43´·0W.
to: 37° 53´·7N., 9° 27´·2W.

275 PORTUGAL - West Coast - Buoy.

Source: Portuguese Notice 7/246/22

Chart 3634 [ previous update 4431/22 ] WGS84 DATUM

Insert
GfF; l.Y.2·5s 41° 27´·62N., 8° 49´·99W.

236 NORTH ATLANTIC OCEAN - Arquipélago dos Açores - Light.

Source: Portuguese Notice 7/249/22

Chart 1957 (Panel B, Horta ) [ previous update 2589/22 ] WGS84 DATUM

Amend range of light to, 9M 38° 32´·258N., 28° 37´·326W.

Chart 1957 (Panel A, Canal Do Faial) [ previous update 2589/22 ] WGS84 DATUM
Amend range of light to, 9M 38° 32´·26N., 28° 37´·32W.

261 ITALY - West Coast - NM Block.

Source: Italian Notice 15.8/22

Chart 954 (Panel, Salerno) [ previous update 4994/21 ] WGS84 DATUM

Insert the accompanying block, centred on: 40° 40´·4N., 14° 45´·6E.

2.21
Wk04/23
 II

269 CROATIA - Outfall.

Source: Croatian Notice 7/9/22

Chart 269 (Panel B, Ploče) [ previous update 132/23 ] WGS84 DATUM

Insert outfall, È, joining: 43° 01´·99N., 17° 25´·26E.
43° 01´·74N., 17° 24´·58E.
43° 01´·60N., 17° 24´·23E.

285 ITALY - Sicilia - NM Block. Obstruction. Depth.

Source: Italian Notice 15.10/22

Chart 963 (Panel B, Porto di Palermo) [ previous update 4599/22 ] WGS84 DATUM
Insert the accompanying block, centred on: 38° 07´·7N., 13° 22´·1E.
obstruction out of position, 9#+Obstn 38° 07´·989N., 13° 22´·630E.
depth, 43, enclosed by 5m contour 38° 07´·592N., 13° 22´·490E.

296 TURKEY - Black Sea Coast - Buoy. Wreck.

Source: Turkish Notice 34/131/22
Note: Former Notice 2012(T)/21 is cancelled.

Chart 1275 [ previous update 3557/22 ] WGS84 DATUM

Insert symbol, blue and yellow emergency wreck marking buoy,
Al.Oc.Bu.Y.3s 41° 39´·76N., 32° 11´·30E.

´ 41° 39´·67N., 32° 11´·45E.

301 TURKEY - Çanakkale Boğazi - Buoy. Signal station. Legend.

Source: Turkish Notices 34/132/22 and 52/179/20

Chart 2429 [ previous update 4638/22 ] WGS84 DATUM

Delete
è SS, centred on: 40° 25´·23N., 26° 41´·94E.

D;Fl.Y.6s
f 40° 18´·58N., 26° 34´·48E.
Amend legend to, See 3557(P)/21, centred on: 40° 19´·24N., 26° 39´·58E.

348 GREECE - Aegean Sea Coast - Light.

Source: Greek Notice 7/97/22

Chart 1085 [ previous update 2995/22 ] WGS84 DATUM

Amend light to, Fl.R.3s10m3M & Fl.G.3s9m3M 39° 25´·1N., 23° 09´·7E.

2.22
Wk04/23
 II

300 UNITED ARAB EMIRATES - NM Blocks.

Source: Port of Fujairah Notice 450/22

Chart 2888 (INT 7199) [ previous update 5006/22 ] WGS84 DATUM

Insert the accompanying block, centred on: 25° 30´·9N., 56° 22´·1E.

Chart 3171 [ previous update 2703/22 ] WGS84 DATUM

Insert the accompanying block, centred on: 25° 33´·7N., 56° 22´·8E.

Chart 3520 (INT 7200) [ previous update 2703/22 ] WGS84 DATUM

Insert the accompanying block, centred on: 25° 30´·9N., 56° 22´·8E.

Chart 3723 [ previous update 131/23 ] WGS84 DATUM

Insert the accompanying block, centred on: 25° 25´·0N., 56° 23´·2E.

306 EGYPT - Suez Canal - Depth.

Source: ENC EG5EGM22

Chart 240 (INT 3549) (Panel A, Suez Canal Container Terminal) [ previous update New Edition 04/03/2021 ] WGS84
DATUM
Insert depth, 136 31° 13´·156N., 32° 21´·448E.

338* UNITED ARAB EMIRATES - Pilot boarding places. Radar beacons. Buoyage.
Source: Abu Dhabi Ports

Chart 3176 (INT 7216) [ previous update 5181/22 ] WGS84 DATUM

Move
HZLFl.10s
p KP-FW and associated radar beacon, Racon(Q),
from: 24° 56´·79N., 54° 34´·20E.
to: 24° 56´·29N., 54° 34´·66E.

Chart 3177 (INT 7222) [ previous update 54/23 ] WGS84 DATUM

Insert
 24° 33´·80N., 54° 20´·10E.
24° 26´·80N., 54° 14´·00E.
Delete former  24° 30´·14N., 54° 17´·89E.
24° 29´·00N., 54° 14´·20E.
Move
 from 24° 39´·50N., 54° 13´·80E.
to: 24° 39´·08N., 54° 14´·42E.

2.23
Wk04/23
 II
338* UNITED ARAB EMIRATES - Pilot boarding places. Radar beacons. Buoyage. (continued)

Chart 3713 (INT 7223) [ previous update 54/23 ] WGS84 DATUM

Insert
 24° 39´·10N., 54° 14´·30E.
24° 33´·80N., 54° 20´·10E.

ÂVessels less than 5·0m draught 24° 26´·80N., 54° 14´·00E.

Delete former Â
24° 39´·53N., 54° 13´·80E.

 24° 30´·10N., 54° 17´·90E.

former ÂVessels less than 5·0m draught
24° 29´·00N., 54° 14´·20E.

Chart 3715 (INT 7224) [ previous update 54/23 ] WGS84 DATUM

Insert
 24° 33´·80N., 54° 20´·10E.
Delete
 24° 30´·10N., 54° 17´·90E.

Chart 3752 (Panel B, Khalifa Port) [ previous update 2654/22 ] WGS84 DATUM
Insert
HZLp Fl.10s KP-FW (a) 24° 56´·29N., 54° 34´·66E.
radar beacon, Racon(Q), at light-buoy (a) above
Delete former HZLFl.10s
p KP-FW and associated radar beacon,
Racon(Q) 24° 56´·79N., 54° 34´·20E.

Chart 3752 (Panel A, Approaches to Khalifa Port) [ previous update 2654/22 ] WGS84 DATUM
Move
HZLp Fl.10s KP-FW and associated radar beacon, Racon(Q),
from: 24° 56´·79N., 54° 34´·21E.
to: 24° 56´·29N., 54° 34´·66E.

267 INDIA - East Coast - Submarine cables.

Source: Indian Notice 13/137/22

Chart IN 313 [ previous update 4832/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 13° 01´·20N., 80° 16´·79E.
12° 50´·34N., 80° 36´·50E.
12° 49´·53N., 80° 40´·05E.
submarine cable, É, joining: 12° 59´·57N., 80° 23´·95E.
12° 58´·98N., 80° 27´·19E.
12° 59´·18N., 80° 28´·84E.
12° 58´·68N., 80° 30´·66E.
12° 57´·85N., 80° 37´·87E.

2.24
Wk04/23
 II
267 INDIA - East Coast - Submarine cables. (continued)

Chart 317 (INT 7400) [ previous update 2893/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 13° 01´·2N., 80° 16´·8E.
12° 50´·3N., 80° 36´·5E.
12° 49´·5N., 80° 40´·1E.
submarine cable, É, joining: 12° 59´·6N., 80° 24´·0E.
12° 59´·0N., 80° 27´·2E.
12° 59´·2N., 80° 28´·8E.
12° 58´·7N., 80° 30´·7E.
12° 57´·9N., 80° 37´·9E.

Chart 2069 [ previous update 4832/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 13° 01´·2N., 80° 16´·8E.
12° 50´·3N., 80° 36´·5E.
12° 49´·5N., 80° 40´·1E.
submarine cable, É, joining: 12° 59´·6N., 80° 24´·0E.
12° 59´·0N., 80° 27´·2E.
12° 59´·2N., 80° 28´·8E.
12° 58´·7N., 80° 30´·7E.
12° 57´·9N., 80° 37´·9E.

Chart IN 3001 (INT 7402) [ previous update 2377/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 13° 01´·25N., 80° 16´·70E.
12° 59´·40N., 80° 20´·06E.

271 BANGLADESH - Wreck.

Source: BNHOC Notice 28/22
Note: Former Notice 5332(T)/19 is cancelled.

Chart IN 31 (INT 756) [ previous update 4167/22 ] WGS84 DATUM

Insert
1!+¾ Wk 21° 28´·0N., 90° 05´·8E.

Chart 90 [ previous update 4777/22 ] WGS84 DATUM

Insert
1!+¾ Wk 21° 28´·0N., 90° 05´·8E.

2.25
Wk04/23
 II

249 TAIWAN - Buoyage.

Source: Taiwanese Notice 105/22

Chart 3231 [ previous update 82/23 ] WGS84 DATUM

Insert
DcFl.R.4s ODAS 24° 14´·23N., 120° 24´·57E.
Delete
DcFl.R.4s 24° 13´·43N., 120° 25´·18E.

Chart 3235 [ previous update 4804/22 ] WGS84 DATUM

Insert
DcFl.R.4s ODAS 25° 05´·80N., 121° 55´·37E.

Chart 3658 [ previous update 82/23 ] WGS84 DATUM

Insert
DcFl.R.4s ODAS 25° 05´·80N., 121° 55´·37E.

250 TAIWAN STRAIT - Light-beacon.

Source: Chinese Notice 44/1479/22

Chart 1754 [ previous update 218/23 ] WGS84 DATUM

Delete
TÜ2Ül Mo(C)Y.12s14m7M 27° 13´·6N., 120° 55´·9E.

264* VIETNAM - Depths.

Source: VMS-South Notices 210/22 and 226/22

Chart 1059 (Panel A, Vung Tau) [ previous update 50/23 ] WGS84 DATUM
Insert depth, 45, enclosed by 5m contour 10° 23´·38N., 107° 05´·41E.
depth, 39, and extend 5m contour N to enclose (a) 10° 23´·32N., 107° 05´·53E.
Delete depth, 46, close SE of: (a) above

2.26
Wk04/23
 II

265 CHINA - Yellow Sea Coast - Wind farm. Legend. Light-beacons. NM Block.
Source: Chinese Notice 43/1451-1452/22

Chart 1281 [ previous update 4633/22 ] CGCS 2000 DATUM

Insert limit of wind farm, pecked line, joining: (a) 33° 36´·55N., 120° 56´·42E.
(b) 33° 35´·56N., 120° 54´·70E.
(c) 33° 34´·93N., 120° 55´·31E.
(d) 33° 34´·93N., 121° 10´·54E.
(e) 33° 36´·55N., 121° 10´·54E.
symbol, Wind Farm, within: (a)-(e) above
legend, Under construction (2022), within: (a)-(e) above

TlMo(C)Y.12s11m5M
Ü No 1
(a) above

TÜMo(C)Y.12s13m5M
l No 17
(b) above

TÜMo(C)Y.12s13m5M
l No 16
(c) above

TlMo(C)Y.12s13m5M
Ü No 9
(d) above

TlMo(C)Y.12s11m5M
Ü No 8
(e) above

TÜMo(C)Y.12s14m5M
l No 4
33° 36´·39N., 121° 02´·53E.
the accompanying block, centred on: 33° 17´·0N., 121° 12´·0E.

Chart 1283 [ previous update 3667/22 ] CGCS 2000 DATUM

Insert limit of wind farm, pecked line, joining: (a) 33° 35´·90N., 120° 55´·30E.
(b) 33° 35´·56N., 120° 54´·70E.
(c) 33° 34´·93N., 120° 55´·31E.
(d) 33° 34´·93N., 120° 59´·99E.
symbol, Wind Farm, within: (a)-(d) above
legend, Under construction (2022), within: (a)-(d) above

TÜMo(C)Y.12s13m5M
l No 17
(b) above

TÜMl o(C)Y.12s13m5M No 16 (c) above

266 CHINA - East Coast - Virtual aid to navigation. Buoyage.

Source: Chinese Notice 44/1486/22

Chart 3449 [ previous update 4298/21 ] CGCS 2000 DATUM

Insert symbol, Virtual aid to navigation, port lateral topmark, V-AIS 24° 24´·98N., 118° 02´·99E.
Move
G\d Fl.R.4s No 404, from:
24° 24´·82N., 118° 04´·04E.
to: 24° 24´·80N., 118° 04´·03E.

GmVU Q No 402. from: 24° 24´·71N., 118° 04´·72E.

to: 24° 24´·70N., 118° 04´·60E.

Chart 3453 [ previous update 2752/21 ] CGCS 2000 DATUM

Insert symbol, Virtual aid to navigation, port lateral topmark, V-AIS 24° 24´·98N., 118° 02´·99E.
Move
G\d Fl.R.4s No 404, from:
24° 24´·82N., 118° 04´·04E.
to: 24° 24´·80N., 118° 04´·03E.

2.27
Wk04/23
 II

270 TAIWAN - Obstruction.

Source: UKHO

Chart 3658 (Panel, Taipei Port) [ previous update 249/23 ] WGS84 DATUM
Insert
åObstn 25° 09´·25N., 121° 21´·93E.

278 VIETNAM - Depth.

Source: VMS-South Notice 250/22

Chart 1036 [ previous update 118/23 ] WGS84 DATUM

Insert depth, 57 10° 40´·20N., 106° 44´·73E.

281 TAIWAN - Buoyage.

Source: UKHO

Chart 2376 [ previous update 3929/22 ] WGS84 DATUM

Insert
J;Fl.Y.4s
f 22° 32´·64N., 120° 17´·37E.
22° 32´·61N., 120° 17´·45E.
22° 32´·59N., 120° 17´·49E.

JbFl.G.4s
[ 22° 32´·69N., 120° 17´·97E.

283 CHINA - East Coast - Buoy. Virtual aid to navigation.

Source: Chinese Notice 42/1416/22

Chart 1738 [ previous update 4255/22 ] CGCS 2000 DATUM

Insert symbol, blue and yellow emergency wreck marking buoy, St
Georges cross topmark, Al.Oc.BuY.3s (2 buoys) 28° 56´·27N., 121° 56´·18E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position 28° 56´·44N., 121° 56´·23E.

Chart 1759 [ previous update 84/23 ] CGCS 2000 DATUM

Insert symbol, blue and yellow emergency wreck marking buoy, St
Georges cross topmark, Al.Oc.BuY.3s (2 buoys) 28° 56´·3N., 121° 56´·2E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position 28° 56´·4N., 121° 56´·2E.

2.28
Wk04/23
 II

286 THAILAND - Gulf of Thailand Coast - Buoyage. Tidal streams.

Source: ENC TH400227

Chart 3963 [ previous update 2755/22 ] WGS84 DATUM

Insert
BZMo(A)6s
p 9° 22´·91N., 99° 19´·65E.
9° 16´·24N., 99° 28´·43E.
symbol, ebb tide stream arrow, direction 036°, 1·1kn, centred
on: (a) 9° 23´·96N., 99° 26´·79E.
symbol, flood tide stream arrow, direction 246°, 0·7kn, close
NE of: (a) above

287 CHINA - East Coast - Buoy.

Source: Chinese Notice 44/1485/22

Chart 1719 [ previous update 217/23 ] CGCS 2000 DATUM

Insert
GUVQ
m 24° 33´·32N., 118° 08´·99E.

297 CHINA - Yellow Sea Coast - Explosives dumping ground.

Source: Chinese Notice 40/1381/22

Chart 1253 [ previous update 4966/22 ] CGCS2000 DATUM

Insert symbol, explosives dumping ground, centred on: 35° 20´·7N., 120° 23´·9E.
35° 20´·5N., 120° 24´·9E.

Chart 3480 [ previous update 230/23 ] WGS84 DATUM

Insert symbol, explosives dumping ground, centred on: 35° 20´·5N., 120° 24´·9E.

299 TAIWAN - Wreck.

Source: UKHO

Chart 1968 [ previous update 80/23 ] WGS84 DATUM

Insert
´ 22° 27´·3N., 120° 21´·0E.

Chart 3230 [ previous update 3929/22 ] WGS84 DATUM

Insert
´ 22° 27´·25N., 120° 20´·99E.

Chart 3232 [ previous update 4506/22 ] WGS84 DATUM

Insert
´ 22° 27´·25N., 120° 20´·99E.

Chart 4410 [ previous update 3929/22 ] WGS84 DATUM

Insert
´ 22° 27´·3N., 120° 21´·0E.

2.29
Wk04/23
 II

303 CHINA - Bo Hai - Wreck.

Source: Chinese Notice 46/1529/22

Chart 1249 [ previous update 4236/22 ] CGCS 2000 DATUM

Insert
´Rep (2022) PA 38° 49´·0N., 119° 59´·0E.

Chart 1250 [ previous update 70/23 ] CGCS 2000 DATUM

Insert
´Rep (2022) PA 38° 49´·0N., 119° 59´·0E.

Chart 1255 [ previous update 219/23 ] CGCS 2000 DATUM

Insert
´Rep (2022) PA 38° 49´·0N., 119° 59´·0E.

Chart 1256 [ previous update 70/23 ] WGS84 DATUM

Insert
´Rep (2022) PA 38° 49´·0N., 119° 59´·0E.

312 SOUTH CHINA SEA - Wreck.

Source: UKHO

Chart 3483 (INT 551) [ previous update 262/23 ] WGS84 DATUM

Insert wreck out of position, ® 6° 20´·1N., 113° 14´·3E.

319 VIETNAM - Light.

Source: ENC V14N0006

Chart 3875 [ previous update 5150/22 ] WGS84 DATUM

Amend range of light to, 3M 20° 59´·94N., 107° 22´·09E.

2.30
Wk04/23
 II

336 CHINA - Bo Hai - Depths. Obstructions. Wreck.

Source: Chinese Notices 50/1639-1640/22

Chart 1263 [ previous update 2515/22 ] CGCS 2000 DATUM

Insert
9+Obstn 37° 39´·95N., 120° 12´·02E.

5%+Obstn (a) 37° 38´·46N., 120° 17´·06E.

Delete depth, 122, close W of: (a) above
depth, 159, close NE of: (a) above

6Ó+Obstn 37° 38´·61N., 120° 14´·75E.

2"+Wk 37° 38´·37N., 120° 17´·73E.

depth, 32, and associated 5m contour 37° 37´·59N., 120° 16´·65E.

Chart 1264 [ previous update 3135/21 ] CGCS 2000 DATUM

Insert
5%+Obstn 37° 38´·455N., 120° 17´·059E.
Delete depth, 51 37° 39´·542N., 120° 15´·701E.

6Ó+Obstn 37° 38´·611N., 120° 14´·754E.

2"+Wk 37° 38´·370N., 120° 17´·755E.

Chart 1294 [ previous update 70/23 ] CGCS 2000 DATUM

Insert
9+Obstn (a) 37° 39´·95N., 120° 12´·02E.
Delete depth, 132, close NW of: (a) above

341 CHINA - East Coast - Virtual aids to navigation.

Source: Chinese Notice 43/1455/22

Chart 1738 [ previous update 283/23 ] CGCS 2000 DATUM

Insert symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 28° 52´·41N., 122° 14´·61E.

Chart 1759 [ previous update 283/23 ] CGCS 2000 DATUM

Insert symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 28° 56´·5N., 122° 33´·4E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position 28° 52´·4N., 122° 14´·6E.

2.31
Wk04/23
 II

345 TAIWAN - Buoyage.

Source: Taiwanese Notice 159/22

Chart 2409 [ previous update 4970/22 ] WGS84 DATUM

Insert
DcAl.GY.8s ODAS 23° 31´·90N., 119° 41´·33E.

Chart 3658 (Panel, Taipei Port) [ previous update 270/23 ] WGS84 DATUM
Insert
DcAl.GY.8s ODAS 25° 10´·00N., 121° 20´·93E.
Delete
DcAl.RY.8s ODAS 25° 09´·95N., 121° 21´·02E.

350* VIETNAM - Depths.

Source: VMS-South Notice 285/22

Chart 1036 [ previous update 278/23 ] WGS84 DATUM

Insert depth, 46 , and extend 5m contour NW to enclose 10° 43´·48N., 106° 45´·65E.
depth, 66 (a) 10° 43´·49N., 106° 45´·60E.
Delete depth, 8, close W of: (a) above

351 CHINA - East Coast - NM Blocks. Anchorage area.

Source: Chinese Chart 13331

Chart 1666 [ previous update 1419/21 ] CGCS 2000 DATUM

Insert the accompanying block A, centred on: 30° 44´·6N., 121° 25´·5E.
the accompanying block B, centred on: 30° 41´·9N., 121° 25´·5E.
limit of anchorage area, pecked line, joining: 30° 43´·04N., 121° 24´·78E.
30° 43´·60N., 121° 25´·10E.
(a) 30° 43´·56N., 121° 25´·40E.
Delete former limit of anchorage area, pecked line, joining: 30° 43´·04N., 121° 24´·83E.
30° 43´·60N., 121° 25´·13E.
(a) above

Chart 1667 [ previous update 3332/22 ] CGCS 2000 DATUM

Insert the accompanying block A, centred on: 30° 44´·6N., 121° 25´·1E.
the accompanying block B, centred on: 30° 42´·2N., 121° 25´·4E.

324 JAPAN - Honshū - Breakwater. Light.

Source: Japanese Notice 2/14/23

Chart JP 148 [ previous update 5113/22 ] WGS84 DATUM

Insert breakwater, double firm line, width 25m, joining: 39° 47´ 04·5"N., 140° 00´ 09·0"E.
39° 47´ 03·7"N., 140° 00´ 09·8"E.
Move
¶ Fl(2) R 5s 7m 5M (temp), from: 39° 47´ 03·6"N., 140° 00´ 09·9"E.
to: 39° 47´ 04·4"N., 140° 00´ 09·1"E.

2.32
Wk04/23
 II

325 JAPAN - Honshū - Buoy. Mooring buoy.

Source: Japanese Notice 2/15/23

Chart JP 1192 [ previous update 5113/22 ] WGS84 DATUM

Replace
R(Lt) with Jf(Lt) 39° 48´·38N., 139° 59´·71E.

326 JAPAN - Honshū - Light.

Source: Japanese Notice 2/17/23

Chart JP 10 [ previous update 5021/22 ] WGS84 DATUM

Amend light to, Fl(2) R 6s 5M 40° 53´·52N., 140° 40´·79E.

Chart JP 1195 [ previous update 5020/22 ] WGS84 DATUM

Amend light to, Fl(2) R 6s 5M 40° 53´·50N., 140° 40´·77E.

327 JAPAN - Kyūshū - Fish haven.

Source: Japanese Notice 2/24/23

Chart JP 198 [ previous update 2902/22 ] WGS84 DATUM

Insert
Á 32° 46´·93N., 129° 46´·75E.

Chart JP 213 [ previous update 2903/22 ] WGS84 DATUM

Insert
Á 32° 46´·93N., 129° 46´·75E.

328 JAPAN - Kyūshū - Fish havens.

Source: Japanese Notice 2/25/23

Chart JP 213 [ previous update 327/23 ] WGS84 DATUM

Insert
Á 32° 44´·18N., 130° 10´·33E.
32° 43´·85N., 130° 11´·33E.

335 JAPAN - Kyūshū - Light.

Source: Japanese Notice 2/22/23

Chart 127 [ previous update 4991/22 ] WGS84 DATUM

Amend light to, Fl.3s135m12M 34° 34´·0N., 129° 17´·3E.

Chart 2347 [ previous update 4784/22 ] WGS84 DATUM

Amend light to, Fl.12M 34° 34´·0N., 129° 17´·1E.

Chart 3480 [ previous update 297/23 ] WGS84 DATUM

Amend light to, Fl.12M 34° 33´·7N., 129° 17´·4E.

2.33
Wk04/23
 II

233 KOREA - West Coast - Depths.

Source: Korean Notice 39/819/22

Chart 1270 (INT 5363) [ previous update 5141/22 ] WGS84 DATUM

Insert depth, 95, and extend 10m contour SE to enclose (a) 37° 22´·49N., 126° 31´·85E.
Delete depth, 121, close SW of: (a) above

298 KOREA - West Coast - Light.

Source: Korean Notice 45/985/22

Chart 913 (INT 5254) [ previous update 5087/22 ] WGS84 DATUM

Amend light to, Fl.R.5s12m8M 36° 21´·93N., 126° 21´·65E.

339 KOREA - West Coast - Light-beacon.

Source: Korean Notice 46/1007/22

Chart 1258 [ previous update 5141/22 ] WGS84 DATUM

Insert
T>Qy (3)10s16m6M 37° 04´·78N., 125° 57´·82E.

262 PHILIPPINE ISLANDS - NM Blocks. Submarine cables.

Source: NAMRIA NAVPHIL 146/22

Chart 3483 (INT 551) [ previous update 4933/22 ] WGS84 DATUM

Insert submarine cable, É, joining: (a) 13° 43´·4N., 120° 15´·2E.
13° 42´·3N., 120° 24´·6E.
and
(a) above
13° 43´·7N., 120° 18´·2E.
13° 47´·9N., 120° 24´·2E.

Chart 4411 [ previous update 4630/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 14° 02´·5N., 120° 37´·4E.
14° 02´·3N., 120° 36´·6E.
13° 56´·0N., 120° 33´·2E.
13° 55´·4N., 120° 31´·7E.

Chart 4416 [ previous update 4847/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 11° 54´·1N., 121° 54´·5E.
11° 55´·8N., 121° 52´·3E.
and
12° 17´·9N., 124° 20´·9E.
12° 18´·4N., 124° 02´·2E.
12° 20´·7N., 123° 58´·9E.
12° 33´·0N., 123° 52´·0E.

2.34
Wk04/23
 II
262 PHILIPPINE ISLANDS - NM Blocks. Submarine cables. (continued)

Chart 4417 [ previous update 1892/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 13° 10´·1N., 123° 50´·0E.
13° 10´·4N., 123° 53´·6E.
13° 09´·7N., 123° 56´·6E.
and
13° 04´·4N., 124° 03´·3E.
13° 02´·5N., 124° 02´·5E.
and
12° 40´·4N., 123° 52´·3E.
12° 38´·4N., 123° 50´·1E.
12° 36´·2N., 123° 50´·2E.
12° 20´·7N., 123° 58´·9E.
12° 18´·4N., 124° 02´·2E.
12° 17´·9N., 124° 20´·9E.

Chart 4484 [ previous update 3452/22 ] WGS84 DATUM

Insert the accompanying block, centred on: 12° 12´·2N., 121° 23´·6E.
submarine cable, É, joining: 12° 00´·44N., 121° 24´·81E.
11° 59´·91N., 121° 25´·74E.
and
12° 00´·21N., 121° 24´·70E.
11° 59´·22N., 121° 25´·49E.
and
11° 54´·10N., 121° 54´·55E.
11° 55´·00N., 121° 54´·15E.
11° 55´·85N., 121° 52´·28E.

Chart 4486 [ previous update 5056/22 ] WGS84 DATUM

Insert the accompanying block A, centred on: 13° 09´·3N., 123° 52´·2E.
submarine cable, É, joining: 13° 02´·49N., 124° 02´·43E.
13° 04´·33N., 124° 03´·24E.
and
12° 40´·40N., 123° 52´·29E.
12° 39´·62N., 123° 50´·86E.
12° 38´·07N., 123° 49´·92E.
12° 36´·16N., 123° 50´·24E.
12° 20´·66N., 123° 58´·93E.
12° 19´·16N., 124° 00´·51E.
the accompanying block B, centred on: 12° 17´·9N., 124° 14´·1E.

Chart 4487 [ previous update 2812/22 ] WGS84 DATUM

Insert submarine cable, É, joining: (a) 13° 08´·19N., 123° 01´·24E.
13° 11´·00N., 123° 00´·82E.
and
(a) above
13° 10´·56N., 123° 02´·11E.
13° 11´·00N., 123° 04´·39E.

2.35
Wk04/23
 II
262 PHILIPPINE ISLANDS - NM Blocks. Submarine cables. (continued)

Chart 4488 [ previous update 1736/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 13° 36´·09N., 122° 13´·70E.
13° 35´·04N., 122° 12´·87E.
13° 35´·02N., 122° 10´·79E.
13° 38´·80N., 121° 53´·41E.
and
13° 37´·45N., 122° 31´·25E.
13° 37´·73N., 122° 32´·14E.
13° 38´·12N., 122° 39´·91E.
and
13° 30´·95N., 123° 00´·85E.
13° 30´·29N., 122° 59´·59E.
and
13° 30´·89N., 123° 00´·97E.
13° 29´·66N., 123° 00´·66E.
the accompanying block, centred on: 13° 15´·0N., 123° 09´·7E.

Chart 4489 [ previous update 2812/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 13° 54´·13N., 121° 37´·01E.
13° 52´·68N., 121° 37´·75E.
13° 52´·12N., 121° 38´·84E.
13° 48´·26N., 121° 40´·57E.
and
13° 36´·10N., 122° 13´·71E.
13° 35´·04N., 122° 12´·87E.
13° 35´·02N., 122° 10´·79E.
13° 38´·80N., 121° 53´·41E.

Chart 4491 [ previous update 4885/22 ] WGS84 DATUM

Insert submarine cable, É, joining: 14° 02´·45N., 120° 37´·36E.
14° 02´·31N., 120° 36´·60E.
13° 56´·00N., 120° 33´·20E.

337 INDONESIA - Banda Sea - Depths.

Source: ENCs ID5527R2 and ID5527R3

Chart 2791 (Panel B, Pelabuhan Wayame) [ previous update 4757/22 ] WGS84 DATUM
Insert depth, 87 (a) 3° 39´·973S., 128° 10´·147E.
Delete depth, 93, close SW of: (a) above

Chart 2791 (Panel A, Ambon) [ previous update 4757/22 ] WGS84 DATUM

Insert depth, 04, and extend 5m contour NW to enclose 3° 42´·05S., 128° 10´·28E.
depth, 07, and extend 5m contour NW to enclose 3° 42´·10S., 128° 10´·24E.
depth, 28 (a) 3° 42´·03S., 128° 10´·09E.
Delete depth, 29, close NE of: (a) above

2.36
Wk04/23
 II

315 NEW ZEALAND - North Island - Depth. Rock.

Source: New Zealand Notice 1/20/23

Chart NZ 5612 (Panel, Napier Harbour) [ previous update New Edition 01/09/2022 ] WGS84 DATUM
Replace depth, 111, with seabed type, R, with depth, 107, with seabed
type, R 39° 28´·025S., 176° 55´·575E.

310* SOUTH PACIFIC OCEAN - Fiji Islands - Submarine cables. NM Blocks.

Source: Alcatel Submarine Networks

Chart 744 [ previous update 2695/22 ] WGS84 DATUM

Insert submarine cable, É , joining: 18° 10´·85S., 178° 28´·11E.
18° 11´·80S., 178° 28´·18E.

Chart 745 [ previous update 2695/22 ] FIJI 1986 DATUM

Insert submarine cable, É , joining: 18° 10´·85S., 178° 28´·10E.
18° 11´·80S., 178° 28´·17E.

Chart 936 [ previous update 4927/22 ] IGN 1972 DATUM

Insert submarine cable, É , joining: 20° 53´·3S., 167° 25´·5E.
20° 51´·9S., 167° 22´·1E.
20° 53´·9S., 167° 19´·1E.
20° 54´·9S., 167° 15´·4E.
the accompanying block, centred on: 22° 26´·8S., 166° 54´·6E.

Chart 1576 [ previous update 4964/21 ] IGN 1957 SOUTH DATUM

Insert submarine cable, É , joining: 20° 53´·4S., 167° 25´·1E.
20° 51´·9S., 167° 21´·7E.
20° 54´·0S., 167° 18´·7E.
20° 54´·8S., 167° 15´·3E.

Chart 1674 [ previous update 2695/22 ] WGS84 DATUM

Insert submarine cable, É , joining: 18° 11´·83S., 178° 28´·18E.
18° 11´·45S., 178° 28´·08E.
18° 11´·26S., 178° 28´·12E.
18° 11´·02S., 178° 28´·10E.
18° 10´·85S., 178° 28´·19E.
18° 10´·30S., 178° 28´·14E.
18° 08´·16S., 178° 28´·16E.
18° 07´·85S., 178° 28´·12E.

2.37
Wk04/23
 II
310* SOUTH PACIFIC OCEAN - Fiji Islands - Submarine cables. NM Blocks. (continued)

Chart 1674 ( Panel, Approaches to Laucala Bay) [ previous update 2695/22 ] WGS84 DATUM
Insert submarine cable, É , joining: 18° 09´·63S., 178° 28´·15E.
18° 10´·30S., 178° 28´·14E.
18° 10´·72S., 178° 28´·18E.
18° 10´·85S., 178° 28´·19E.
18° 11´·02S., 178° 28´·10E.
18° 11´·26S., 178° 28´·12E.
18° 11´·45S., 178° 28´·08E.
18° 11´·83S., 178° 28´·18E.

Chart 2462 (INT 6899) [ previous update 4578/22 ] WGS84 DATUM

Insert submarine cable, É , joining: 22° 16´·14S., 166° 24´·77E.
22° 16´·39S., 166° 24´·77E.
22° 17´·06S., 166° 24´·34E.
22° 17´·82S., 166° 24´·61E.
22° 18´·86S., 166° 25´·42E.
22° 19´·63S., 166° 26´·30E.
22° 20´·80S., 166° 29´·17E.
(a) 22° 20´·90S., 166° 29´·63E.
22° 21´·11S., 166° 30´·00E.
and
(a) above
22° 20´·56S., 166° 29´·46E.
22° 19´·60S., 166° 30´·00E.
and
22° 17´·79S., 166° 30´·00E.
22° 17´·36S., 166° 29´·94E.
22° 16´·82S., 166° 29´·61E.
22° 16´·79S., 166° 28´·77E.

2.38
Wk04/23
 II
310* SOUTH PACIFIC OCEAN - Fiji Islands - Submarine cables. NM Blocks. (continued)

Chart 2463 (INT 6883) [ previous update 2594/22 ] WGS84 DATUM

Insert submarine cable, É , joining: 22° 16´·14S., 166° 24´·77E.
22° 16´·39S., 166° 24´·77E.
22° 17´·06S., 166° 24´·34E.
22° 17´·82S., 166° 24´·61E.
22° 18´·86S., 166° 25´·42E.
22° 19´·63S., 166° 26´·30E.
22° 20´·53S., 166° 28´·50E.
and
22° 18´·23S., 166° 32´·46E.
22° 17´·67S., 166° 33´·90E.
22° 16´·75S., 166° 34´·53E.
and
22° 21´·67S., 166° 32´·47E.
22° 22´·58S., 166° 35´·59E.
22° 22´·92S., 166° 38´·19E.
the accompanying block, centred on: 22° 19´·2S., 166° 30´·5E.

Chart 4636 (INT 636) [ previous update 4593/22 ] WGS84 DATUM

Insert submarine cable, É , joining: 20° 54´·5S., 167° 15´·8E.
20° 51´·9S., 167° 21´·9E.
20° 53´·1S., 167° 25´·7E.

Chart 4637 (INT 637) [ previous update 4840/22 ] WGS84 DATUM

Insert submarine cable, É , joining: 20° 53´·1S., 167° 25´·7E.
20° 51´·9S., 167° 21´·9E.
20° 55´·1S., 167° 15´·0E.

246 MEXICO - Pacific Ocean Coast - Lights.

Source: Mexican Notices 17/262/22 and 17/270/22

Chart 1028 [ previous update 2151/22 ] WGS84 DATUM

Amend range of light to, 32M 23° 25´·6N., 110° 14´·0W.
Move
¶ Fl(2)10M from: 24° 38´·4N., 112° 09´·4W.
to: 24° 38´·2N., 112° 08´·4W.

258 PERU - Depths.

Source: ENC PE502237

Chart 1853 [ previous update 4879/22 ] WGS84 DATUM

Insert depth, 78, and extend 10m contour S to enclose (a) 12° 05´·24S., 77° 08´·43W.
Delete depth, 111, close SE of: (a) above
Insert depth, 85, and extend 10m contour S to enclose (b) 12° 05´·22S., 77° 08´·09W.
Delete depth, 97, close NW of: (b) above

2.39
Wk04/23
 II

276 ECUADOR - Radar beacon.

Source: Ecuadorean Daily Notice 16/11/22

Chart 586 [ previous update 4356/22 ] WGS84 DATUM

Replace radar beacon, Racon(P) with radar beacon, Racon(C), at light-
buoy 2° 55´·11S., 80° 29´·91W.

305 MEXICO - Pacific Ocean Coast - Lights. Firing practice area.

Source: Mexican Chart 63000

Chart 1022 (INT 8088) [ previous update 4577/21 ] WGS84 DATUM

Insert
¶ Ldg Iso.2s24M & Fl.3s24M (a) 14° 33´·8N., 92° 15´·2W.
Delete
¶ Ldg Iso.2s15M & Fl.3s24M, close SE of: (a) above

Chart 1023 [ previous update 5058/22 ] WGS84 DATUM

Insert
¶ Ldg Iso.2s24M & Fl.3s24M (a) 14° 33´·8N., 92° 15´·2W.
Delete
¶ Ldg Iso.2s15M & Fl.3s24M, close SE of: (a) above
limit of firing practice area, pecked line, joining: 15° 46´·2N., 93° 40´·0W.
15° 40´·2N., 93° 32´·0W.
15° 35´·5N., 93° 35´·7W.
15° 41´·5N., 93° 43´·5W.

234 BRAZIL - South Coast - Buoy.

Source: Brazilian Notice 19/S 217/22

Chart 431 [ previous update 90/23 ] WGS84 DATUM

Insert
GqQV (6)+LFl.15s 22° 56´·07S., 43° 51´·47W.

2.40
Wk04/23
 II

274 BRAZIL - South Coast - Buoyage.

Source: Brazilian Notice 19/S 218/22
Note: Former Notice 214(P)/21 is cancelled.

Chart 579 [ previous update New Edition 28/07/2022 ] WGS84 DATUM

Delete
GYo 25° 33´·64S., 48° 16´·03W.

GWr 25° 31´·42S., 48° 17´·88W.

Dd 25° 30´·82S., 48° 18´·20W.

25° 30´·46S., 48° 18´·36W.

GVq 25° 29´·46S., 48° 17´·42W.

25° 29´·48S., 48° 17´·22W.

Chart 589 [ previous update 4542/22 ] WGS84 DATUM

Delete
GYo 25° 33´·66S., 48° 15´·95W.

255 GUYANA - Wreck.

Source: Maritime Administration Department of Guyana Notice 180/22

Chart 527 [ previous update 1681/22 ] WGS84 DATUM

Insert
´PA 7° 30´·30N., 58° 24´·30W.

Chart 572 [ previous update 121/23 ] UNDETERMINED DATUM

Insert
´PA 7° 30´·5N., 58° 24´·4W.

313 UNITED STATES OF AMERICA - Gulf of Mexico - Wreck.

Source: ENC US4FL1XA

Chart 3851 [ previous update 5076/22 ] NAD83 DATUM

Insert
´Masts 30° 15´·5N., 87° 28´·0W.

322 MEXICO - Gulf of Mexico - Lights.

Source: Mexican Notice 19/293-294/22

Chart 2753 (Panel, Tuxpan) [ previous update 3920/22 ] WGS84 DATUM

Insert
¶ 2Iso.G.2s10m5M 20° 56´·61N., 97° 21´·50W.

¶{ 20° 56´·62N., 97° 21´·49W.

2.41
Wk04/23
 II

242 UNITED STATES OF AMERICA - East Coast - Radar beacon.

Source: US Coast Guard District 5 LNM 46/12225/22

Chart 2920 (Panel 1) [ previous update 4493/22 ] NAD83 DATUM

Delete symbol, radar beacon, Racon(O), at light-buoy 37° 25´·60N., 76° 05´·10W.

245 UNITED STATES OF AMERICA - East Coast - Depths.

Source: ENC US5NYCFH

Chart 3451 [ previous update 616/22 ] NAD83 DATUM

Insert depth, 0, enclosed by 0ft contour 40° 48´·180N., 73° 53´·207W.
depth, 3, and extend 6ft contour SW to enclose 40° 48´·148N., 73° 53´·178W.
Delete depth, 16 40° 48´·137N., 73° 53´·148W.

253 UNITED STATES OF AMERICA - East Coast - Obstructions.

Source: US Notice 50/11524/22

Chart 2809 [ previous update 4411/22 ] NAD83 DATUM

Insert
48,Obstns 32° 48´·20N., 79° 54´·88W.

257 UNITED STATES OF AMERICA - East Coast - Light-beacon.

Source: US Coast Guard District 5 LNM 42/12278/22

Chart 2850 [ previous update 4631/22 ] NAD83 DATUM

Delete
T©Fj l.R.4s15ft4M ’2’ 39° 13´·13N., 76° 26´·48W.

268 UNITED STATES OF AMERICA - East Coast - Obstruction.

Source: OCS

Chart 2850 [ previous update 257/23 ] NAD83 DATUM

Insert
4+ Obstn 39° 07´·67N., 76° 24´·69W.

282 UNITED STATES OF AMERICA - East Coast - Obstruction.

Source: OCS

Chart 2921 (Panel 2) [ previous update 177/23 ] NAD83 DATUM

Insert
9+Obstn 39° 02´·30N., 76° 19´·26W.

2.42
Wk04/23
 II

284 UNITED STATES OF AMERICA - East Coast - Wrecks.

Source: ENC US4SC22M

Chart 2801 [ previous update 3661/22 ] NAD83 DATUM

Replace
4+Wk with 2+Wk 32° 03´·49N., 80° 49´·59W.
Delete
´PA 32° 03´·18N., 80° 49´·84W.

Chart 2807 [ previous update 175/23 ] NAD83 DATUM

Replace
4+Wk with 2+Wk 32° 03´·49N., 80° 49´·59W.
Delete
´PA 32° 03´·18N., 80° 49´·84W.

290 UNITED STATES OF AMERICA - East Coast - Obstruction. Depths. Wreck.

Source: ENC US5FAVCB

Chart 2732 (Panel 5, State Pier) [ previous update 137/23 ] NAD83 DATUM
Insert
12,Obstn 41° 42´·282N., 71° 09´·916W.
depth, 5, enclosed by 6ft contour (a) 41° 42´·340N., 71° 09´·746W.
Delete depth, 21, close NE of: (a) above

Chart 2732 (Panel 4, Fall River Harbor) [ previous update 137/23 ] NAD83 DATUM
Delete
´PA 41° 44´·046N., 71° 08´·600W.

292 UNITED STATES OF AMERICA - East Coast - Dredged depth.

Source: ENC US5GA18M

Chart 2818 [ previous update New Edition 22/08/2019 ] NAD83 DATUM

Insert dredged depth to, 24FT (2022), centred on: 30° 40´·74N., 81° 27´·98W.

308 UNITED STATES OF AMERICA - East Coast - Breakwater. Lights.

Source: US Coast Guard District 1 LNM 47/12331/22

Chart 3458 [ previous update 134/23 ] NAD83 DATUM

Insert breakwater, single firm line, joining: (a) 40° 29´·687N., 74° 14´·488W.
(b) 40° 29´·700N., 74° 14´·439W.

¶ Fl.Y.2·5s ’E’ (a) above

¶ Fl.Y.4s ’F’ (b) above

2.43
Wk04/23
 II

323 UNITED STATES OF AMERICA - East Coast - Depths.

Source: ENC US5MA1DF

Chart 2456 [ previous update 4024/22 ] NAD83 DATUM

Replace depth, 81, with depth, 73 41° 28´·47N., 71° 01´·00W.
depth, 94, with depth, 82 41° 25´·55N., 70° 58´·30W.

Chart 2890 [ previous update 141/23 ] NAD83 DATUM

Replace depth, 81, with depth, 73 41° 28´·47N., 71° 01´·00W.
depth, 94, with depth, 82 41° 25´·55N., 70° 58´·30W.

343 UNITED STATES OF AMERICA - East Coast - Depths.

Source: ENC US5VA19M

Chart 2829 [ previous update 4704/22 ] NAD83 DATUM

Insert depth, 26, enclosed by 30ft contour 37° 00´·38N., 76° 01´·63W.
depth, 38 37° 00´·23N., 76° 01´·56W.
depth, 33 and extend 36ft contour SW to enclose (a) 37° 00´·20N., 76° 01´·41W.
Delete depth, 44, close SW of: (a) above
Replace depth, 32, with depth, 21, extend 30ft contour SW to enclose 37° 00´·63N., 76° 01´·97W.

Chart 2919 [ previous update 204/23 ] NAD83 DATUM

Insert depth 33 and extend 36ft contour SW to enclose (a) 37° 00´·20N., 76° 01´·41W.
Delete depth 44, close SW of: (a) above

2.44
Wk04/23
 II

256(P)/23 SCOTLAND - Shetland Islands - General information.

Source: SaxaVord Spaceport
1. A rocket is due to be launched from SaxaVord Spaceport, Unst in position 60° 49´·01N., 0° 46´·79W. between 9th March
and 8th June 2023 from 0700-1000 UTC.
2. The rocket will be launched northwards and is expected to travel 80 km.
3. The rocket is expected to splash down, and there may be space debris, within a circular radius 20 km, centred on
61° 31´·2N., 0° 38´·7W.
4. A temporary space launch hazard area will be established, bounded by the following positions:

60° 48´·8N., 0° 47´·8W.

61° 25´·2N., 1° 45´·3W.
61° 46´·0N., 1° 45´·3W.
61° 46´·0N., 0° 00´·0E.
61° 25´·2N., 0° 00´·0E.
60° 48´·8N., 0° 43´·5W.
60° 48´·0N., 0° 43´·5W.
60° 48´·0N., 0° 47´·9W.
5. The area around the launch site, hazard area and the splash down area are extremely hazardous and all mariners are advised
to avoid these areas during the launch period.
6. More precise date/s and details of the launch will be promulgated through the MSI service, and UK Coastguard VHF and
MF MSI Broadcast from 5 days before the launch.
7. Contact SaxaVord Spaceport Range Control at [email protected] or Telephone +44(0)1479 782042 extension
1010 for further details.
(WGS84 DATUM)

Charts affected - 2 (INT 160) - 219 (INT 1060) - 245 - 1233 (INT 1500) - 1239 - 2182C (INT 1041) - 2182D (INT
1040) - 3282 - 4140 (INT 140)

241(T)/23 FINLAND - South Coast - Buoy.

Source: Finnish Notice 22/186(T)/22
1. An unlit yellow ODAS buoy, has been deployed in position 60° 36´·26N., 21° 01´·22E.
(WGS84 DATUM)

Chart affected - 3828 (INT 1192)

302(T)/23 SWEDEN - East Coast - Measuring instruments.

Source: Swedish Notice 943/17319(T)/22
1. Oceanographic measuring instruments, have been established on the seabed in the following positions:

Position
57° 41´·50N., 18° 48´·71E.
57° 41´·32N., 18° 49´·62E.
57° 39´·42N., 18° 52´·95E.
57° 40´·97N., 18° 54´·53E.
57° 41´·74N., 18° 57´·51E.
57° 38´·82N., 18° 57´·51E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 798 (INT 1220) - 2055 (INT 1204) - 2059 (INT 1216)

2.45
Wk04/23
 II

346(P)/23 SWEDEN - East Coast - Buoyage. Lights.

Source: Swedish Notices 941/17206/22 and 942/17200, 17211, 17213, 17253, 17255, 17257-17258 and 17260-17261/22 and
943/17229, 17230 and 17273/22
1. There have been extensive changes to aids to navigation in Lake Mälaren, between the following positions:

Location Position
Viksäter 59° 14´·44N., 17° 35´·96E.
Västerås 59° 35´·50N., 16° 33´·15E.
Köping 59° 29´·50N., 16° 02´·80E.
2. Changes to buoyage and other aids to navigation should be expected.
3. *Lights and sectors have been altered. The new light characteristics are as follows:

Light Name New Characteristic Position

Märsön Iso.WRG.3s 59° 31´·201N., 16° 59´·350E.
Nybyholm Iso.WRG.3s 59° 31´·682N., 17° 01´·952E.
Strömskär Iso.WRG.3s 59° 31´·732N., 16° 59´·242E.
Koholmsgrund Fl(2)WRG.3s 59° 31´·712N., 17° 03´·000E.
Lilla Aggarö Iso.WRG.3s 59° 30´·849N., 16° 43´·877E.
Stora Aggarö Iso.WRG.3s 59° 30´·734N., 16° 42´·338E.
Högholm Fl(2)WRG.3s 59° 30´·251N., 16° 34´·697E.
Fröholmen Iso.WRG.3s 59° 31´·70N., 16° 40´·62E.
Hallingön Iso.WRG.3s 59° 29´·44N., 16° 51´·93E.
*Gisselholmen Fl(2)WRG.3s 59° 29´·661N., 16° 57´·133E.
*Hästskär Iso.WRG.3s 59° 28´·88N., 16° 53´·02E.
*Västra Holmen Iso.WRG.3s 59° 34´·73N., 16° 33´·58E.
4. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
5. These changes will be included in New Editions of 800, 802, 803 and 810 to be published early 2023.
6. Former notice 107(P)/23 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 800 (INT 1773) - 802 (INT 1772) - 803 - 810 (INT 1771)

349(T)/23 SWEDEN - East Coast - Buoy.

Source: Swedish Notice 944/17341(T)/23
1. The port hand spar light-buoy, Q R, in position 59° 18´·485N., 18° 17´·712E. is reported missing.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 820 (INT 1238)

354(T)/23 SWEDEN - West Coast - Marine farms.

Source: Swedish Notice 944/17337(T)/23
1. Marine farms in Stigfjorden have been reported damaged in the following positions:

58° 05´·61N., 11° 37´·65E.

58° 04´·82N., 11° 38´·10E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 870 (INT 1310)

2.46
Wk04/23
 II

353(T)/23 NETHERLANDS - Buoy.

Source: Netherlands Notice 1/9(T)/23
1. A west cardinal buoy, Q(9)15s, has been deployed, until further notice, in position 52° 12´·46N., 4° 22´·51E.
(WGS84 DATUM)

Chart affected - 130 (INT 1423)

355(T)/23 NETHERLANDS - Buoy.

Source: Netherlands Notice 1/6(T)/23
1. A starboard lateral buoy, Iso.G.4s, has been deployed, until further notice, in position 51° 13´·740N., 3° 48´·380E.
(WGS84 DATUM)

Chart affected - 114 (INT 1476)

291(P)/23 ISRAEL - Mediterranean Sea Coast - Works.

Source: Israeli Notice 172/22
1. Gas pipeline laying operations are taking place within an area between the approaches to the ports of Ashqelon and Ashdod.
2. All marine activities including anchoring and fishing are prohibited within 1NM of a line joining the following positions:

31° 51´·50N., 34° 39´·30E.

31° 52´·53N., 34° 38´·35E.
31° 53´·08N., 34° 36´·73E.
31° 53´·00N., 34° 35´·90E.
31° 52´·47N., 34° 34´·92E.
31° 47´·92N., 34° 32´·37E.
31° 41´·50N., 34° 27´·95E.
31° 40´·57N., 34° 27´·68E.
31° 39´·73N., 34° 28´·42E.
31° 39´·17N., 34° 29´·85E.
3. The works vessel, MV SEMINOLE, may be at anchor anywhere within this area. Anchor cables extending up to 800 meters
in length will be established around the vessel.
4. All marine activities are prohibited within 1·5NM of the works vessel.
5. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
6. Charts will be updated when full details are available.
(WGS84 DATUM)

Charts affected - 1591 (INT 3681) - 2634

2.47
Wk04/23
 II

342(P)/23 QATAR - Restricted areas.

Source: Qatar Energy
1. A restricted area, entry restricted, has been established bounded by the following positions:

26° 47´·08N., 51° 55´·43E.

26° 34´·12N., 52° 10´·90E.
26° 26´·30N., 52° 19´·72E.
26° 23´·05N., 52° 18´·47E.
26° 19´·07N., 52° 07´·50E.
26° 17´·70N., 52° 00´·48E.
26° 21´·90N., 51° 56´·03E.
26° 32´·87N., 51° 49´·57E.
26° 37´·88N., 51° 49´·92E.
2. Restricted areas, entry restricted, have been established, radius 1000m (0·54M), centred on the following positions:

Platform Position
26° 28´·94N., 51° 45´·61E.
WH-8 26° 14´·59N., 52° 00´·97E.
WH-9 26° 13´·58N., 51° 56´·31E.
NFQ14 26° 06´·30N., 52° 08´·55E.
NFQ15 26° 00´·97N., 52° 11´·13E.
NFQ16 25° 54´·26N., 52° 07´·74E.
NFQ17 25° 57´·46N., 52° 01´·75E.
NFQ18 25° 51´·28N., 52° 02´·37E.
NFQ19 25° 51´·93N., 51° 55´·56E.
NFQ20 26° 14´·53N., 52° 19´·74E.
NFQ21 26° 09´·94N., 52° 15´·09E.
3. Mariners are advised to navigate with caution in the area and obtain permission from the relevant authorities before entering
these areas.
4. These changes will be included in the next New Edition of Chart 2523 to be published early 2023.
5. Charts 2837, 2847, 2883, 2886, 2887 and 3950 will be updated by Notice to Mariners.
(WGS84 DATUM)

Chart affected - 2523 (INT 7250)

344(P)/23 UNITED ARAB EMIRATES - Buoyage. Works.

Source: Abu Dhabi Ports Company
1. The Inner Harbour Channel (24° 47’ .75N. , 54° 39’ .54E. ) within Khalifa Port has been permanently closed.
2. The following light-buoys have been removed:

Characteristic Designation Position

Fl(4)R.10s KP-22 24° 48’ .23N. , 54° 39’ .48E.
VQ.R HM 24° 47’ .89N. , 54° 39’ .20E.
VQ.G IHC-1 24° 47’ .74N. , 54° 39’ .30E.
VQ.R IHC-2 24° 47’ .82N. , 54° 39’ .33E.
VQ.G IHC-3 24° 47’ .67N. , 54° 39’ .78E.
VQ.R IHC-4 24° 47’ .75N. , 54° 39’ .79E.
VQ.G IHC-5 24° 47’ .59N. , 54° 40’ .24E.
VQ.R IHC-6 24° 47’ .67N. , 54° 40’ .27E.
Fl.G.3s IHC-7 24° 47’ .53N. , 54° 40’ .71E.
Fl.R.3s IHC-8 24° 47’ .60N. , 54° 40’ .73E.
3. The South Quay development (24° 48’ .10N., 54° 39’ .60E.) is complete and dredged to 18·5m.
4. *A 250m wide dredged channel, depth 16·0m, linking the existing Khalifa Port Basin (24° 48´·80N., 54° 40´·20E. ) to
the new Khalifa Port Logistic Terminal (24° 47´·90N., 54° 41´·00E. ) has been established.

2.48
Wk04/23
 II
344(P)/23 UNITED ARAB EMIRATES - Buoyage. Works. (continued)
5. *The Logistic Terminal development (24° 47´·84N., 54° 41´·58E. ) is complete. Berths 1-13 are dredged to 8m and berths
14-17 are dredged to 16m.
6. * Aids to navigation have been established, marking the new channel and basin.
7. Charts will be updated when full details are available.
8. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
9. *Former Notice 2646(P)/22 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Chart affected - 3752

240(T)/23 INDIA - West Coast - Wreck.

Source: Hydropac 2176/22
1. A wreck is reported to exist in approximate position: 22° 34´·08N., 69° 23´·89E.
(WGS84 DATUM)

Charts affected - IN 203 (INT 7319) - IN 2068

244(P)/23 VIETNAM - Works. Wind farm. Wind turbines. Lights. Automatic Identification Systems.
Buoyage.
Source: Vietnamese Notice 221/22
1. Works are in progress to establish a wind farm North East of Cua Ham Luong.
2. Turbines are marked by lights, Mo(U)15s11m5M, and associated Automatic Identification System, AIS, in the positions:

Designation Position
T-01 9° 58´·77N., 106° 40´·62E.
T-07 9° 57´·80N., 106° 41´·08E.
3. The construction works, which are marked by lit special buoys, FI(3+1)18s, in the following positions:

Designation Position
V-01 9° 57´·71N., 106° 41´·15E.
V-02 9° 58´·81N., 106° 40´·74E.
4. Mariners are advised to navigate with caution in the area.
5. Chart GB1261 will be updated when full details are available.
(WGS84 DATUM)

Chart affected - 1261

2.49
Wk04/23
 II

263(T)/23 TAIWAN - Buoyage. Virtual aids to navigation.

Source: Taiwanese Notices 125(T)22 and 138(T)/22
1. The cardinal buoys marking the Yunlin Offshore Wind Farm, have been replaced by virtual aids to navigation (V-AIS), in
positions:

Designation Type Position

N1 North Cardinal 23° 39´·68N., 120° 01´·75E.
N2 North Cardinal 23° 39´·72N., 120° 04´·39E.
E1 East Cardinal 23° 36´·40N., 120° 04´·28E.
E2 East Cardinal 23° 33´·23N., 120° 03´·67E.
S1 South Cardinal 23° 31´·15N., 119° 59´·00E.
S2 South Cardinal 23° 31´·74N., 120° 02´·51E.
W1 West Cardinal 23° 37´·77N., 119° 59´·73E.
W2 West Cardinal 23° 34´·68N., 119° 59´·08E.
2. Mariners are advised to navigate with caution in the area.
3. Former Notices 4840(T)/21 and 822(T)/22 are cancelled.
(WGS84 DATUM)

Charts affected - 1760 - 2409 - 3231

329(T)/23 JAPAN - Hokkaidō - Wreck.

Source: Japanese Notice 2/5007(T)/23
1. A wreck, approximately 15m in length, exists in position: 42° 15´·27N., 141° 00´·50E.
(WGS84 DATUM)

Charts affected - 1800 - JP 1030 - JP 1034

330(T)/23 JAPAN - Hokkaidō - Wreck.

Source: Japanese Notice 2/5008(T)/23
1. A wreck, approximately 15m in length, exists in position 42° 53´·9N., 144° 05´·0E.
(WGS84 DATUM)

Charts affected - 1800 - 1803 - JP 1032

2.50
Wk04/23
 II

331(T)/23 JAPAN - Honshū - Obstructions. Works.

Source: Japanese Notice 2/5010(T)/23
1. Caisson stocked works are taking place, until further notice, within areas bounded by the following positions:

40° 32´ 10·2"N., 141° 32´ 18·9"E.

40° 32´ 09·7"N., 141° 32´ 27·4"E.
40° 32´ 03·2"N., 141° 32´ 26·8"E.
40° 32´ 03·7"N., 141° 32´ 18·3"E.
and
40° 33´ 10·7"N., 141° 30´ 44·0"E.
40° 33´ 08·8"N., 141° 30´ 52·2"E.
40° 33´ 02·6"N., 141° 30´ 49·8"E.
40° 33´ 04·4"N., 141° 30´ 41·6"E.
(WGS84 DATUM)

Chart affected - JP 65

332(T)/23 JAPAN - Honshū - Works.

Source: Japanese Notice 2/5011(T)/23
1. Soil improvement works are taking place, until 10 March 2023, within an area bounded by the following positions:

38° 23´ 43·4"N., 141° 17´ 41·9"E.

38° 23´ 41·5"N., 141° 17´ 19·4"E.
38° 23´ 28·6"N., 141° 17´ 21·2"E.
38° 23´ 30·5"N., 141° 17´ 43·7"E.
(WGS84 DATUM)

Chart affected - JP 1100

333(T)/23 JAPAN - Seto Naikai - Depth.

Source: Japanese Notice 2/5013(T)/23
1. A depth of 0·9m exists in position 34° 38´ 31·8"N., 134° 58´ 20·4"E.
(WGS84 DATUM)

Chart affected - JP 131

334(T)/23 JAPAN - Seto Naikai - Depth.

Source: Japanese Notice 2/5014(T)/23
1. A depth of 11·9m exists in position 33° 56´ 38·4"N., 130° 56´ 39·0"E.
(WGS84 DATUM)

Charts affected - JP 135 - JP 1262 - JP 1263

2.51
Wk04/23
 II

238(T)/23 KOREA - East Coast - Buoy.

Source: Korean Notice 45/991(T)/22
1. The ODAS light-buoy, Fl(5)Y.20s, in position 37° 51´·15N., 129° 02´·18E., has been temporarily extinguished.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 882

251(T)/23 KOREA - South Coast - Buoyage. Automatic Identification Systems.

Source: Korean Notice 46/1020(T)/22
1. Yellow pillar ODAS buoys, Fl(5)Y.20s, have been established in the following positions:

Designation Position
A 34° 19´·79N., 127° 24´·97E.
B 34° 12´·76N., 127° 25´·07E.
2. Automatic Identification Systems (AIS) have been established in the above positions.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 127 - 3365 (INT 5252) - 3929

252(T)/23 KOREA - East Coast - Works.

Source: Korean Notice 42/364/22
1. Pipeline works are taking place in an area joining the following positions:

35° 28´·34N., 129° 23´·09E.

35° 28´·38N., 129° 23´·13E.
35° 28´·23N., 129° 23´·39E.
35° 28´·14N., 129° 23´·51E.
35° 28´·05N., 129° 23´·59E.
35° 27´·96N., 129° 23´·65E.
35° 27´·76N., 129° 23´·74E.
35° 27´·74N., 129° 23´·66E.
35° 27´·93N., 129° 23´·58E.
35° 28´·06N., 129° 23´·48E.
35° 28´·19N., 129° 23´·34E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 896 (INT 5355) - 898

356(T)/23 AUSTRALIA - Queensland - Beacon.

Source: Australian Notice 1/31(T)/23
1. The west cardinal beacon structure, is temporarily coloured BY, in position 10° 03´·59S., 143° 10´·01E.
(WGS84 DATUM)

Chart affected - Aus 839

2.52
Wk04/23
 II

357(T)/23 AUSTRALIA - New South Wales - Buoy.

Source: Australian Notice 1/19(T)/23
1. The special light buoy, Fl.Y.5s FAD (Sep-Jun), in position 29° 32´·48S., 153° 26´·52E., is off station and exists in position
29° 37´·72S., 153° 29´·13E.
(WGS84 DATUM)

Chart affected - Aus 812

2.53
Wk04/23
To accompany Notice to Mariners 235/23. Image Size (mm) 253.5 by 185

Wk04/23
To accompany Notice to Mariners 261/23. Image Size (mm) 67.7 by 149

Wk04/23
 To accompany Notice to Mariners 262/23. Image Size (mm) 185.8 by 99

Wk04/23
To accompany Notice to Mariners 262/23. Image Size (mm) 51.5 by 176.3

Wk04/23
To accompany Notice to Mariners 262/23. Image Size (mm) 42.2 by 177.1

Wk04/23
To accompany Notice to Mariners 262/23. Image Size (mm) 251.3 by 182.7

Wk04/23
To accompany Notice to Mariners 265/23. Image Size (mm) 82.8 by 161.8

Wk04/23
To accompany Notice to Mariners 285/23. Image Size (mm) 161.3 by 113

Wk04/23
To accompany Notice to Mariners 300/23. Image Size (mm) 83.8 by 93

Wk04/23
To accompany Notice to Mariners 300/23. Image Size (mm) 125.7 by 128.2

Wk04/23
 To accompany Notice to Mariners 300/23. Image Size (mm) 207.8 by 133.3

Wk04/23
To accompany Notice to Mariners 300/23. Image Size (mm) 51.5 by 97.3

Wk04/23
 To accompany Notice to Mariners 310/23. Image Size (mm) 226.9 by 136.2

Wk04/23
To accompany Notice to Mariners 310/23. Image Size (mm) 180.3 by 131.3

Wk04/23
To accompany Notice to Mariners 314/23. Image Size (mm) 86.9 by 78.5

Wk04/23
To accompany Notice to Mariners 314/23. Image Size (mm) 37.5 by 46

Wk04/23
To accompany Notice to Mariners 317/23. Image Size (mm) 140.3 by 182

Wk04/23
To accompany Notice to Mariners 351/23. Image Size (mm) 63.8 by 169

Wk04/23
To accompany Notice to Mariners 351/23. Image Size (mm) 248 by 178.5

Wk04/23
To accompany Notice to Mariners 351/23. Image Size (mm) 60 by 99

Wk04/23
To accompany Notice to Mariners 351/23. Image Size (mm) 207.7 by 184.1

Wk04/23
 III

NAVIGATIONAL WARNINGS

See The Mariner’s Handbook (2020 Edition). Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via Enhanced Group Call (EGC) and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: [email protected]
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA Co-
ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 04 published on the UKHO website 16 Jan 23.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 04
The following NAVAREA I warnings were in force at 160500 UTC Jan 23.

2022 series: 168, 194, 213, 217, 219, 220, 221, 226.
2023 series: 003, 005, 008, 009.

Summary of Navarea I warnings issued since Weekly Edition 02:

005 NORTH SEA.

Dogger Bank. Chart GB 266.
Dogger Bank B Offshore Wind Farm construction area, 55-04.4N 001-29.0E, 55-06.3N 001-40.4E, 55-06.3N 001-
51.7E, 54-51.1N 001-52.2E and 54-52.0N 001-26.9E, perimeter buoys established.

006 Cancelled.

007 Cancelled. Cancel 001/23.

008 1. Navarea I warnings in force at 131000 UTC Jan 23. 2. Cancel 002/23.

009 1. RIGLIST. Correct at 160500 UTC Jan 23.

Southern North Sea: 51N to 55N

52-29.8N 004-13.0E Valaris 123 ACP Q10-A
52-41.8N 004-17.7E JB-115 ACP HNA
52-45.4N 003-45.5E Swift 10 ACP P6-A
53-00.0N 001-50.8E Valaris 72 ACP Hewett Gas Field
53-11.0N 002-05.9E Noble Hans Deul ACP Southwark
53-14.0N 003-14.5E 590021 ACP Allseas Test
53-19.4N 002-34.5E Seafox 7 ACP 49/23-AQ
53-21.9N 001-39.1E Well Safe Protector ACP Anglia Gas Field
53-27.7N 001-55.1E Seafox 4 ACP Galleon Gas Field
53-37.5N 004-08.7E Maersk Resolute ACP L7-H
53-58.7N 006-55.1E Seafox 2 ACP Dolwin Beta
53-59.0N 000-47.4E Haeva ACP Neptune Gas Field
54-04.0N 000-28.8E Noble Innovator
54-04.4N 000-54.9E Erda ACP 42/30-ST3
54-05.1N 002-01.6E Valaris Gorilla V
54-14.7N 002-09.2E Ensco 92 ACP Boulton Gas Field
54-34.2N 002-17.6E Prospector 1 ACP Cygnus Gas Field
54-54.4N 000-03.4W Maersk Resilient

3.1
Wk04/23
 III

North Sea: 55N to 60N, East of 5W

55-28.6N 005-06.4E Maersk Reacher ACP Dan Oil Field
55-28.6N 005-06.4E Noble Sam Turner ACP Dan Oil Field
55-48.2N 004-33.7E Maersk Interceptor ACP Valdemar Oil Field
56-19.5N 003-21.2E Maersk Integrator ACP Valhall Oil Field
56-23.5N 002-53.5E Linus
56-25.4N 003-13.6E West Elara ACP Eldfisk Oil Field
56-37.5N 002-12.4E Noble Sam Hartley
56-41.8N 002-20.1E Valaris 121 ACP Judy Oil Field
56-51.0N 002-15.3E Valaris 120 ACP Jade Oil Field
57-09.2N 001-40.4E Valaris Gorilla VI
NEW 57-17.8N 001-21.9E Stena Don
57-22.5N 001-59.9E Valaris Norway ACP Mungo Oil Field
57-41.9N 001-24.2E Valaris 122
57-45.4N 004-22.2E Valaris Viking
57-48.9N 004-32.0E Maersk Inspirer ACP YME Oil Field
57-54.2N 000-03.5E Well Safe Guardian
58-00.8N 000-55.4W COSL Innovator
58-25.3N 000-32.9W COSL Pioneer
58-44.9N 002-34.1E Deepsea Atlantic
NEW 59-01.3N 002-04.6E Scarabeo 8
NEW Aamoyfjorden Noble Invincible
59-11.9N 002-24.7E West Phoenix
59-15.8N 002-37.4E Deepsea Aberdeen
59-20.5N 001-49.6E Deepsea Nordkapp
59-22.7N 001-40.8E Ocean Patriot

Norwegian Sea: 60N to 65N, East of 5W

60-11.4N 001-42.2E Paul B Loyd Jr
60-21.3N 002-54.0E Askepott
NEW Skipavika Transocean Endurance
61-02.4N 002-20.2E Noble Lloyd Noble ACP Valemon

South and West Coasts of the British Isles

Nil.

NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform.
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no

2. Cancel 004/22.

3.2
Wk04/23
 IV

[04/23]
UPDATES TO ADMIRALTY SAILING DIRECTIONS

NP1 Africa Pilot Volume 1 (2020 Edition) NP18 Baltic Pilot Volume 1 (2022 Edition)

Mauritania -- Nouadhibou --
Port Minéralier de Cansado —
Limiting conditions; maximum draughts Sweden -- Kattegat -- Approaches to Goteberg —
Prohibited anchorage
180

Paragraph 6.39 1 including existing Section IV Notice 99

Week 39/22 Replace by:
1 The entrance channel was dredged (2021) to After Paragraph 3.121 1 line 5 Insert:
229 m in its outer part, reducing to 22 m in the
vicinity of the pilot boarding position (6.41). The inner Within an area centred on 573358N 113627E,
part of the entrance channel and the turning basin between Anchorage Area A and Area B (3.119).
were dredged (2021) to 20 m.
Maximum authorised draught on arrival is 12 m; on
departure maximum authorised draught is 1615m. Swedish Notice 917/16870/22
The port authority should be contacted for the latest [NP18--No 12--Wk 04/23]
information on depths and authorised draughts.

French SD C4 [NP1--No 69--Wk 04/23]

NP19 Baltic Pilot Volume 2 (2022 Edition)

NP15 Australia Pilot Volume 3 (2022 Edition)

Australia -- Queensland -- Whitsunday Passage --

Shute Bay — Wrecks Sweden – Baltic Sea – Norrköping —
Limiting conditions; controlling depths
239

Paragraph 7.110 3 lines 1--7 Replace by: 214

3 Anchorage, with restricted swinging room and for
vessels of suitable size and draught only, may be Paragraph 5.186 including heading Replace by:
obtained in the channel, within an area (201790S
1484730E) SSE of the wharf at Shutehaven and W
of Repair Island. Several wrecks lie in the N part of
the anchorage. Controlling depths
5.186
Australian Notice 11/416/22 [NP15--No 10--Wk 04/23] 1 The controlling depths and permitted draughts in
the channels to the various sections of the harbour
are as follows:
Australia -- Queensland -- East coast -- Entrance channel — dredged to 149 m (2021).
Townsville — Harbour; development Channel to Bråvikenshamn — swept to 89 m;
Bråvikenshamn basin -- swept to 88 m (2008).
263 2 Channel to Pampushamnen — 142 m (2020),
After Paragraph 8.92 1 Insert: except 141 m close SW of Nr 20 light buoy
(starboard hand);
approaches to Berth 3 RoRo berth -- dredged
Development to 125 m.
8.92a Channel to inner harbour Lindökanalen — swept to
1 Works are in progress (2022) to widen the port 89 m (2021) and has a maximum permitted
approach channel in order to accommodate vessels of draught of 78 m.
up to 300 m. Beacons marking the channel may be Islet Blixholmen to Ståthögahamnen — swept to
substituted with V--AIS during the works period. An 80 m.
associated reclamation area is situated to the E of the Cementkajen basin — dredged to 70 m (2021).
port. Works are expected to be completed in 2024.

Australian Notices 9/345--346/2022 Swedish Notices 917/16880/22, 918/16882/22

[NP15--No 9--Wk 04/23] [NP19--No 30--Wk 04/23]

4.1 Wk04/23
 IV

Sweden – Baltic Sea – Norrköping — 2 The section on the SW side of Händelö which
Limiting conditions; under--keel clearance; includes Gästgivarehagen, Cementkajen,
vertical clearance Ramshällskajen and Ståthögahamnen contains a total
of 450 m of berthing space with depths alongside of
214
70 to 84 m. A fixed RoRo berth with a ramp width of
Paragraph 5.186a existing Section IV Notice Week 45/22 8 m and a depth of 84 m lies at the N end of
including heading Replace by: Berth 38, Gästgivarehagen. Berth 38 has a heavy lift
crane, capacity 350 ton, with a depth alongside of
Under–keel clearance 84 m.
5.186a
1 The port authority or terminal operator should be Swedish Notice 917/16880/22 [NP19--No 33--Wk 04/23]
contacted for the appropriate under–keel clearance
requirements for intended fairways, terminals and
berths. See also www.sjofartsverket.se for specific Sweden – Stockholms Skärgård –
East approach to Herrhamraleden —
limitations. Directions; buoy
Vertical clearance
5.186b 266
1 A bridge (583569N 161211E), under
construction (2022), spans the Motala River (5.195) at Paragraph 7.44 3 line 6 For (port hand) Read (S cardinal)
Norrköping (5.184). Unauthorised entry is prohibited
into an area, marked by light buoys special, which
surrounds the bridge. Swedish Notice 918/16891/22
[NP19--No 29--Wk 04/23]
UKHO [NP19--No 31--Wk 04/23]
Estonia -- Gulf of R ga --
Sweden – Baltic Sea – Norrköping — North--east of Ruhnu Saar — Directions; wreck
Directions for entering harbour; depths
404
216

Paragraph 5.201 1 line 9 For 147 m (2011) Read 149 m After Paragraph 11.96 2 line 2 Insert:
(2021) Clear of a dangerous wreck (575728N
232332E), thence:
Paragraph 5.201 3 line 5 For 82 m Read 89 m
Estonian Notice 4/56/22 [NP19--No 34--Wk 04/23]
Swedish Notice 917/16880/22 [NP19--No 32--Wk 04/23]

Estonia -- Gulf of R ga --
Sweden – Baltic Sea – Norrköping — South--east of Allirahu — Directions; wreck
Basins and berths

217 405

Paragraph 5.204 1 Replace by: After Paragraph 11.105 3 line 4 Insert:

1 Pampushamnen (583731N 161495E) has an oil Clear of a dangerous wreck (580307N

terminal at Berth 1, which has a length of 70 m with 230569E), thence:
breasting dolphins and has a dredged depth of 120 m
alongside. A RoRo berth, 80 m in length, lies close N Estonian Notice 4/56/22 [NP19--No 35--Wk 04/23]
of Berth 1 and has a dredged depth of 91 m. The
multi--purpose terminal has a quay with total length of
450 m with a dredged depth of 142 m (2020); the NW
end of the quay is a RoRo berth, 160 m in length, NP22 Bay of Biscay Pilot (2019 Edition)
with a dredged depth of 100 m (2018); buoys
(special) lie in the vicinity of development (5.196).
Spain -- North coast -- Bilbao —
Paragraph 5.205 1--2 Replace by: Outer anchorages; caution
1 Berths 57–45 on Öhmanskajen have a length of
237
600 m with a depth alongside dredged to 84 m
(2021). Two fixed RoRo berths lie at the NE end of After Paragraph 9.138 1 Insert:
this quay, the northern most having a dredged depth
of 71 m (2021). The remainder of this section which Caution. A submarine cable is laid within
includes Edstrandskajen and the river area SW of Anchorage C. Light buoys may be moored within, or in
Blixholmen (583618N 161299E) has a total of the approaches to, the anchorages.
3030 m of berthing space with depths alongside of 50
to 90 m. UKHO [NP22--No 56--Wk 04/23]

Wk04/23 4.2
 IV

NP30 China Sea Pilot Volume 1 (2021 Edition) NP67 West Coasts of Spain and Portugal Pilot
(2021 Edition)
China -- Outer approaches to Hong Kong --
Dangan Shuidao — Directions; wreck
281 Spain -- South Coast -- Cadiz — Directions; lights
After Paragraph 8.148 2 line 4 Insert: 185
Clear of dangerous wreck (220850N 1140620E),
position approximate, reported (2022), thence: Paragraph 6.184 7--8 Replace by:
UKHO [NP30--No 135--Wk 04/23] 7 Entry to International Free Zone harbour. The
bearing (2093) of a directional light (white round
NP32A China Sea Pilot Volume 3 (2022 Edition) tower, red bands, 12 m in height) (363012N
61577W), situated at the head of the harbour, leads
Taiwan -- North coast -- Taipei Port — between the breakwater heads into the basin.
Directions; obstruction
8 A light (green post, 3 m in height) is exhibited from
104 the head of the W breakwater and lights are exhibited
Paragraph 4.182 4 line 7 Replace by: from the extremities of the berths in the harbour.
...is exhibited, thence:
S of an obstruction (250925N 1212193E), which Spanish Notice 44/22; Derrotero 5
lies on the N edge of the channel. [NP67--No 27--Wk 04/23]
UKHO [NP32A-- No 23--Wk 04/23]

NP45 Mediterranean Pilot Volume 1

(2021 Edition)
Spain -- East coast -- Valencia to Cabo de
Oropesa — Directions; ODAS superbuoy
123
Paragraph 3.56 3 Replace by:
3 SE of Cabo Canet (394030N 01223W),
between the mouths of Río Palancia; a light
(394047N 01246W) (3.55) is exhibited
2 cables NW from the cape. Shifting
sandbanks form off the mouth of the river
during freshets. Canet de Berenguer marina
(394038N 01208W) lies close N of the
point. And:
Clear of an ODAS superbuoy (special) (393064N
01214E), thence:
Spanish Notice 17/141/22 (Revised 18/22)
[NP45--No 85--Wk 04/23]
Spain -- Mallorca -- Ensenada sa Costera —
Anchorage; caution
179
After Paragraph 4.152 2 line 4 Insert:
Caution. A submarine pipeline is laid within the
bay.
Spanish Notice 21/185/22 [NP45--No 86--Wk 04/23]

4.3 Wk04/23
 V

UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS

NP74, Vol A Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

A2398 - Tabs Head 52 56·01 N QW 4 1 Red & on mast Tide gauge

0 04·92 E 10
* *

A3292·1 - South Harbour. West Pier 57 30·15 N 2 F R(Vert) 4 1 Metal post Lights 2·5m apart
1 46·42 W
* * * * * * * *

WEST COAST. INNER SOUND. CAOL MÓR. RAASAY

A3909·6 - Eyre Point 57 20·01 N Fl WR 3s 6 W 8 White clad metal fl 0·4.
(GB:N) 6 01·28 W R 8 framework tower W215°-267°(52°), R267°-288°(21°),
5 W288°-063°(135°)
*

WEST COAST. LIVERPOOL BAY. RIVER RIBBLE

A4927 - S Side. 14¼ mile Perch 53 42·76 N Fl G 5s 6 3 Solid metal perch TE 2023
3 04·88 W with tripod support
12
*

A5538·2 - Second Severn Crossing. 51 34·45 N F Bu .. 5 .. ..

Centre Span. S Side 2 42·02 W
*

A5538·25 - Second Severn Crossing. 51 34·47 N F Bu .. 5 .. ..

Centre Span. N Side 2 42·01 W
*

CAVENDISH FIELD
A7668 - Dogger Bank. South-West 54 28·68 N Mo(U)W 21 15 Platform On NW and SE Corners of Platform.
Patch. Cavendish 1 44·33 E TE; Replaced by four cardinal light
(GB) buoys (T) 2022
---- .. Fl R 22 .. .. On NE and SW Corners of Platform.
TE; Replaced by four cardinal light
buoys (T) 2022
---- .. Horn Mo(U) .. .. .. On NE and SW Corners of Platform
---- .. AIS .. .. .. MMSI No 992351159
*

TYRA GASFIELD
A7780·948 - Tyra East. Platform E 55 43·21 N Mo(U)R 15s 29 3 Platform ..
DK, , 132 C (DK) 4 47·95 E
--- .. AIS .. .. .. MMSI No 992191524
* * * * * * * *

A7780·949 - Tyra East. Platform G 55 43·11 N Mo(U)R 15s 33 3 Platform ..

DK, , 132D (DK) 4 47·75 E
--- .. AIS .. .. .. MMSI No 992191539
* * * * * * * *

A7780·9501 - Tyra East. Platform C 55 43·15 N Mo(U)W 15s 29 15 Platform ..

DK, , 132B (DK) 4 47·88 E
--- .. Mo(U)R 15s .. 3 .. ..
--- .. AIS .. .. .. MMSI No 992191523
* * * * * * * *

A7780·955 - Tyra East. Platform B 55 43·21 N Mo(U)R 15s 29 3 Platform ..

DK, , 132A (DK) 4 47·95 E
--- .. AIS .. .. .. MMSI No 992191524
* * * * * * * *

5.1 Wk04/23
 V

NP74, Vol A Edition 2022 continued.

A7780·958 - Tyra East. Platform H 55 43·12 N Mo(U)W 15s 30 15 Platform ..

DK, , 132 E (DK) 4 47·70 E
--- .. AIS .. .. .. MMSI No 992191538
--- .. Racon .. .. .. ALRS Vol 2 Station 55732.5
* * * * * * * *

A7780·96 - Tyra West. Platform B 55 42·94 N Mo(U)W 15s 30 15 Platform ..

DK, , 131A (DK) 4 44·91 E
--- .. Mo(U)R 15s .. 3 .. ..
--- .. AIS .. .. .. MMSI No 992191527
* * * * * * * *

A7780·972 - Tyra West. Platform E 55 42·92 N Mo(U)W 15s 30 15 Platform ..

DK, , 131C (DK) 4 44·95 E
--- .. Mo(U)R 15s .. 3 .. ..
* * * * * * * *

A7780·973 - Tyra West. Platform C 55 42·89 N Mo(U)W 15s 30 15 Platform ..

DK, , 131B (DK) 4 44·84 E
--- .. Mo(U)R 15s .. 3 .. ..
--- .. AIS .. .. .. MMSI No 992191528
--- .. Racon .. .. .. ALRS Vol 2 Station 55735
* * * * * * * *

NP75, Vol B Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

OOSTERSCHELDE APPROACHES
B0400·3 Remove from list; deleted

B0899 - Vlieland. Ldg Lts 282°. 53 17·73 N Oc W 10s 9 1 ..

NL, HP2, 2076 Front 5 04·56 E 10
*

B0899·1 - Vlieland. Ldg Lts 282°. 53 17·75 N Oc W 10s 15 1 .. Sync with front
NL, HP2, 2078 Rear. 102m from front 5 04·47 E 15
*

B2831·97 - Vessøyhauet 58 19·92 N Iso R 6s 5 4 Post Floodlit

NO, , 065108 8 35·67 E 9
* * * * *

NP76, Vol C Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

C2217 - Rødby Arbejdshavn 54 38·09 N QR 9 3 Red and white tower ..

DK, , 5771 B 11 22·59 E 6
* * * * * * * *

C2217·1 - Rødby Arbejdshavn 54 38·04 N QG 9 3 Green and white ..

DK, , 5771 D 11 22·77 E tower
6
* * * * * * * *

5.2 Wk04/23
 V

NP76, Vol C Edition 2022 continued.

C2217·2 - Rødby Arbejdshavn 54 37·94 N QG 9 3 Green and white ..

DK, , 5771 C 11 22·69 E tower
6
* * * * * * * *

C2217·3 - Rødby Arbejdshavn 54 37·99 N QR 9 3 Red and white tower ..

DK, , 5771 A 11 22·51 E 6
* * * * * * * *

ZATOKA POMORSKA. SWINA RIVER. PORT ŚWINOUJŚCIE

C2678·4 Remove from list; deleted

ZATOKA POMORSKA. SWINA RIVER. PORT ŚWINOUJŚCIE

C2678·45 Remove from list; deleted

C2679·8 - S Entrance to Basen 53 53·67 N Oc G 6s 6 3 Green post ec 1

PL, , 0741 Baltycki. Rybackie Wharf 14 15·77 E
* * * * * * * *

ZATOKA POMORSKA. DZIWNOW STRAIT

C2900·66 - Dziwnów. Bridge. N Pier. 54 01·17 N Iso G 2s 6 1 Green mast ..
PL, 521, 0639 E Head 14 45·10 E
* * * * * * * *

C3029 - Kanał Portowy. Nabrzeże 54 32·12 N FR 7 1 Red pole ..

PL, 521, 0358 Norweskie. Basen V. NW 18 32·09 E
End
* *

C3029·2 - Kanał Portowy. Nabrzeże 54 32·18 N FG 7 1 Green pole ..

PL, 521, 0360 Słowackiego. Basen V. SE 18 31·91 E
Side
* *

WESTERN PART
C6685·4 - Hjulstafjärden. 59 31·71 N Fl(2)WRG 3s 6 W 9 White tower, red G074·1°-079·1°(5°),
Koholmsgrund 17 03·00 E R 6 band on black base W079·1°-084·3°(5·2°),
G 5 R084·3°-186°(101·7°),
G186°-263·6°(77·6°),
W263·6°-270·2°(6·6°),
R270·2°-275·4°(5·2°)
* *

C6685·6 - Hjuslstafjärden. Nybyholm 59 31·68 N Iso WRG 3s 4 W 8 White hut, green G259°-263·7°(4·7°),
17 01·95 E R 6 band R263·7°-337·5°(73·8°),
G 5 G337·5°-045°(67·5°),
W045°-102°(57°), R102°-121°(19°)
* *

C6686·4 - Hjuslstafjärden. Strömskär 59 31·73 N Iso WRG 3s 2 W 9 White house, red roof G354·4°-359·4°(5°),
16 59·24 E R 6 W359·4°-005·8°(6·4°),
G 5 R005·8°-010·8°(5°),
G010·8°-034·2°(23·4°),
W034·2°-228°(193·8°),
R228°-242·7°(14·7°)
* *

C6686·6 - Hjuslstafjärden. Märsön 59 31·20 N Iso WRG 3s 6 W 7 White structure, red G014°-084·6°(70·6°),
16 59·35 E R 5 band R084·6°-119·4°(34·8°),
G 4 G119·4°-155°(35·6°),
W155°-163·8°(8·8°),
R163·8°-172·7°(8·9°)
* *

5.3 Wk04/23
 V

NP76, Vol C Edition 2022 continued.

C6687·4 - Gisselholmen 59 29·66 N Fl(2)WRG 3s 6 R 4 Tripod mast, white G195·6°-205·8°(10·2°),

16 57·13 E G 4 pedestal, green band W205·8°-214·7°(8·9°),
W 6 R214·7°-295°(80·3°),
G295°-070°(135°)
* * *

C6687·6 - Hästskär 59 28·87 N Iso WRG 3s 3 W 6 White tower, red G091°-122·8°(31·8°),

16 53·03 E R 4 band W122·8°-129·1°(6·3°),
G 3 R129·1°-154°(24·9°),
W154°-251·7°(97·7°),
G251·7°-273·5°(21·8°),
W273·5°-283·3°(9·8°),
R283·3°-309·5°(26·2°)
* *

C6687·8 - Hallingön 59 29·44 N Iso WRG 3s 6 W 5 White tower, green G313·4°-102·9°(149·5°),

16 51·93 E R 4 band W102·9°-112·1°(9·2°),
G 3 R112·1°-122·1°(10°)
* *

C6688·6 - Aggarösundet. Lilla Aggarö 59 30·85 N Iso WRG 3s 5 W 6 White tower, red G082°-091·4°(9·4°),
16 43·88 E R 4 band W091·4°-094·4°(3°),
G 3 R094·4°-098·7°(4·3°),
G098·7°-142°(43·3°),
R142°-240°(98°),
G240°-278·6°(38·6°),
W278·6°-280·3°(1·7°),
R280·3°-284°(3·7°),
G284°-287·7°(3·7°),
W287·7°-289·5°(1·8°),
R289·5°-319°(29·5°)
* *

C6688·8 - Aggarösundet. Stora 59 30·73 N Iso WRG 3s 5 W 5 Lantern on white hut, R058°-114°(56°),
Aggarö 16 42·34 E R 3 red band G114°-124·9°(10·9°),
G 2 W124·9°-127·4°(2·5°),
R127·4°-179°(51·6°),
G179°-254°(75°), R254°-258°(4°)
* *

C6689·2 - Fröholmen 59 31·70 N Iso WRG 3s 6 W 5 White hut, green G311·7°-321·9°(10·2°),

16 40·62 E R 3 band W321·9°-333°(11·1°),
G 2 R333°-355°(22°),
G355°-097·5°(102·5°),
W097·5°-098·6°(1·1°),
R098·6°-110·3°(11·7°),
G110·3°-120·4°(10·1°)
* *

C6689·8 - Västra Holmen 59 34·73 N Iso WRG 3s 6 W 7 White tower, green G018·9°-151·9°(133°),
16 33·58 E R 5 band W151·9°-170·8°(18·9°),
G 4 R170·8°-235°(64·2°),
G235°-345·6°(110·6°),
W345·6°-350·1°(4·5°),
R350·1°-018·9°(28·8°).
Floodlit
* *

C6691·1 - Ldg Lts 028°. Front. 59 30·25 N Fl(2)WRG 3s 4 W 7 White hut, green G203°-209·9°(6·9°),
Högholm 16 34·70 E R 5 band R209·9°-297·9°(88°),
G 4 G297·9°-025°(87·1°),
W025°-035·5°(10·5°),
R035·5°-055·5°(20°)
* *

5.4 Wk04/23
 V

NP76, Vol C Edition 2022 continued.

C6694·7 - Kalvö Hampetorp. Östra 59 27·96 N Fl(2)WRG 6s 4 W 5 White hut, green G288·2°-306°(17·8°),
Torpet 16 11·56 E R 3 band on pedestal W306°-310·4°(4·4°),
G 2 R310·4°-316·7°(6·3°),
G316·7°-009·7°(53°),
R009·7°-030·8°(21·1°)
*

NP78, Vol E Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

E6380 - Île Kuriat 35 48·02 N Fl WR 5s 30 W18 White square tower, fl 1.

TN, , 3700 11 02·02 E R14 red top, white W053°-348°(295°), R348°-053°(65°).
dwelling F (T) 2022
26
* *

E6483·3 El Kala (La Calle). Pointe 36 54·06 N Mo(N)R 5s 10 8 .. PA

DZ, , 4300A des Carrieres. S Breakwater. 8 25·55 E
Head
* * * *

E6490 - S Quay. Head 36 54·12 N Fl R 4s 15 14 White round tower ..

DZ, , 4207 7 46·76 E 14
FR, L2, 07480
* *

E6506 Phare de Ras el Hamra. 36 58·05 N Fl W 5s 143 29 Grey square tower, fl 0·4
DZ, , 4200 Cape de Garde 7 47·01 E white dwelling
26
- - Reserve light .. Lit .. .. .. ..
*

E6518 Port d' El Marsa. Kef Sidi 37 01·57 N Iso W 4s 10 10 White pylon ..
DZ, , 4101 Merouane 7 14·94 E 4
*

Port de Dellys
E6588 - Jetty. Head 36 54·81 N Oc W 4s 12 10 White round tower ec 1.
DZ, , 2702 3 55·13 E 8 Obscured by Point de Dellys when
FR, L2, 08520 bearing less than 193°.
TE 2022
*

E6626 - Jetée Principale 36 38·28 N Fl W 4s .. .. .. fl 1.

DZ, , 2303 2 40·24 E TE 2022
*

E6714 Îles Habibas 35 43·24 N Fl W 5s 112 23 Brown square tower fl 0·6

DZ, , 1300 1 08·01 W on building
12
*

EAST OF RAVENNA
E7518·58 Remove from list; deleted

5.5 Wk04/23
 V

NP79, Vol F Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 1, dated 05 January 2023.

F3306 - Passe du Lapérouse. Le 20 49·61 N Fl(2+1)W 5s 48 15 White tower, red ..

Cancrelat 107 17·69 E lantern
5
* * *

F3311 - Dang Tieu. 8 20 59·94 N Fl R 5s 6 2·8 White post, red band ..

107 22·09 E
* * * * * * * *

NP80, Vol G Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

G0324 - Ponta do Tagano. Ldg Lts 20 19·26 S QR 20 15 Red % on white TE 2022

BR, DH2, 2024 C 087°. No 5. Front 40 16·55 W square concrete tower
4
*

G0324·1 - Ponta do Tagano. Ldg Lts 20 19·26 S Iso R 2s 25 15 Red + on white TE 2022
BR, DH2, 2028 C 087°. No 6. Rear. 130m 40 16·48 W square concrete tower
from front 4
*

NP82, Vol J Edition 2023. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

SOUTHEAST COAST. SMITHS ISLAND

J5837·4 - Smiths Island 11 11·00 N Fl W 5s 18 5 .. ..
TT, , 2007 60 39·03 W
* * *

SOUTHEAST COAST
J5841·5 - Crown Point 11 08·88 N Fl(4)W 20s 35 12 Aluminium (fl 0·5, ec 1·5) x 3, fl 0·5, ec 13·5
TT, , 2011 60 50·68 W framework tower
topmark
26
* * *

NORTHWEST COAST
J5841·58 - Booby Point 11 11·01 N Fl W 3s .. 4 .. ..
TT, , 2018 60 48·65 W
* * *

J5841·6 - Courland Point 11 13·32 N LFl W 10s .. 8 .. fl 2

TT, , 2020 60 46·80 W
* *

GULF OF PARIA. CHAGUARAMAS BAY. GASPAR GRAND ISLAND

J5856 - Espolon Point. Pointe 10 39·89 N Fl W 4s 13 8 White framework TE 2023
TT, , 1007 Baleine 61 39·96 W tower
*

5.6 Wk04/23
 V

NP83, Vol K Edition 2023. NEW EDITION Weekly Edition No. 4, Dated 26 January 2023.
NOTE: These are the first updates issued for the New Edition.

Cut out the above and paste it in the NEW EDITION First Updates box immediately below the
RECORD OF UPDATES title on page ii of NP83, Vol K Edition 2023 New Edition.

K2857·4 - North West Channel. NW 2 26 49·84 S Fl Y 2·5s .. . . Yellow × on pile ..

153 08·97 E
--- .. AIS .. .. .. MMSI No 995036072
*

K2878·2 - Saint Helena Island. North 27 22·19 S QW .. . . ) on yellow beacon, ..

Point. 840m N 153 14·19 E black top
*

MORETON BAY. SOUTH PART

K2900·85 - Rous Channel. No 17 27 24·15 S Fl G 2·5s .. . . Green % on beacon ..
153 20·44 E
*

K2901·54 - Fison Channel. Oyster. Ldg 27 31·94 S Q Bu .. . . White % on beacon ..

Lts 274°25′. Front 153 17·19 E
*

VITI LEVU. EAST COAST. OVALAU Island

K4722 - Levuka. Na Tubari. Ldg Lts 17 40·96 S F Bu 15 7 Orange % on church Neon U.
FJ, F201, 4722 263°08′. Front 178 50·06 E tower TE 2022
*

K4983·4 - N Side. Pointe Papuaa. 16 27·77 S Fl G 2·5s 4 3 Green % on green fl 0·5

FR, L2, 65380 North-north-westward 151 45·38 W beacon
(FR) 6
*

K5004·64 - Passe Tiritepakau. N Side 16 21·81 S Fl R 2·5s 5 5 Red & on red metal fl 0·5.
FR, L2, 56480 (FR) 143 11·38 W column Destroyed (T) 2022
7
* *

NP84, Vol L Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

L0486 - Måløysundet. V-løp. NW 61 55·79 N FR 8 2·9 Post R 159·00°-274°.

NO, , 286734 5 07·26 E 16 Floodlit.
TE; works in progress (T) 2022
*

L0486·4 - Måløysundet. V-løp. NE 61 55·78 N FG 6 2·9 Post G080°-212°(132°).

NO, , 286733 5 07·37 E 10 Floodlit.
TE; works in progress (T) 2022
*

L0486·5 - Måløysundet. V-løp. SE 61 55·72 N FG 7 2·9 Post G087°-204°(117°).

NO, , 286731 5 07·35 E 12 Floodlit.
TE; works in progress (T) 2022
*

L0486·6 - Måløysundet. V løp, 2 61 55·75 N FR 43 6 Bridge R187·5°-192·5°(5°).

NO, , 286737 5 07·31 E TE; works in progress (T) 2022
*

5.7 Wk04/23
 V

NP84, Vol L Edition 2022 continued.

L0486·601 - Måløysundet. V løp, 1 61 55·76 N FR 43 6·7 Bridge R187·5°-192·5°(5°).

NO, , 286738 5 07·31 E TE; works in progress (T) 2022
* *

L1895·4 - Masteskjæret 64 56·40 N Iso WRG 6s 6 W3·5 Column G220·1°-234·9°(14·8°),

NO, , 544500 10 49·24 E R2·6 9 R234·9°-258·6°(23·7°),
G2·6 G258·6°-035·6°(137°),
W035·6°-044·3°(8·7°),
R044·3°-056·9°(12·6°)
* * *

LEKAFJORD
L1956 Remove from list; deleted

LEKAFJORD
L1956·1 Remove from list; deleted

SKIBBÅTSVÆR
L2324 - Djupsøy. E Side 66 07·30 N Fl(2)WRG 5s 7 W7·8 Post G166·2°-172·5°(6·3°),
NO, , 656000 12 03·91 E R6·8 3 W172·5°-181·3°(8·8°),
G6·8 R181·3°-195·7°(14·4°),
G195·7°-211·9°(16·2°),
W211·9°-219·7°(7·8°),
R219·7°-223·7°(4°),
G223·7°-226·1°(2·4°),
W226·1°-228·4°(2·3°),
R228·4°-233·5°(5·1°),
G233·5°-314°(80·5°),
W314°-321·6°(7·6°),
R321·6°-331·9°(10·3°),
G331·9°-334·3°(2·4°),
W334·3°-344·3°(10°),
R344·5°-349·4°(4·9°)
* *

SANDSUNDVÆRET
L2328 - Skarholmen 66 07·30 N Iso WRG 2s 19 W7·6 Framework structure G264·6°-293·6°(29°),
NO, , 656500 11 56·99 E R6·6 6 W293·6°-299·3°(5·7°),
G6·6 R299·3°-343·2°(43·9°),
G343·2°-350·5°(7·3°),
W350·5°-008·2°(17·7°),
R008·2°-017°(8·8°),
G017°-021·1°(4·1°),
W021·1°-043·3°(22·2°),
R043·3°-078·1°(34·8°),
G078·1°-086·2°(8·1°),
W086·2°-089·2°(3°),
R089·2°-135·1°(45·9°),
G135·1°-138°(2·9°),
W138°-158·9°(20·9°),
R158·9°-213·9°(55°)
* * *

NP85, Vol M Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

M4155·37 - Baguyeo 37 04·78 N Q(3)W 10s 16 6 * on black round ..

KR, 410, 3306·7 125 57·82 E concrete tower,
yellow band
21
* * * * * * * *

5.8 Wk04/23
 V

NP85, Vol M Edition 2022 continued.

M4173·8 - Lock Gate. N Breakwater 37 28·13 N Fl G 5s 12 10 White round concrete . .

KR, 410, 3610 126 35·69 E tower
9
* *

M4189·5 Oeyeondo Hang. E 36 13·44 N Fl R 4s 16 8 Red round concrete ..

KR, 410, 3238 Breakwater 126 04·84 E tower
9
* * * *

M4207·02 Remove from list; renumbered to M4207.025

M4207·021 Remove from list; renumbered to M4207.023

M4207·022 Remove from list; renumbered to M4207.0227

M4207·0227 Renumbered; was previously M4207.022

KR, 410, 3146·3
- Gochang. Wind Farm. No 1 35 29·19 N Mo(U)Y 10s 14 9 Yellow round steel ..
126 20·48 E post
2
* *

M4207·023 Remove from list; renumbered to M4207.03

M4207·023 Renumbered; was previously M4207.021

KR, 410, 3146·9
- Gochang. Wind Farm. No 6 35 29·41 N Fl(4)Y 8s 14 3 Yellow round steel ..
126 20·02 E post
2
* *

M4207·024 Remove from list; renumbered to M4207.038

M4207·024 - Gochang. Wind Farm. No 35 29·62 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·32 11 126 19·56 E post
2
* * * * * * * *

M4207·025 Remove from list; renumbered to M4207.04

M4207·025 Renumbered; was previously M4207.02

KR, 410, 3146·13
- Gochang. Wind Farm. No 35 29·85 N Mo(U)Y 10s 14 9 Yellow round steel Other identical lights mark the wind
16 126 19·11 E post farm limits
2
* *

M4207·026 Remove from list; renumbered to M4207.041

M4207·026 - Gochang. Wind Farm. No 35 29·53 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·40 17 126 18·74 E post
2
* * * * * * * *

M4207·027 Remove from list; renumbered to M4207.033

M4207·027 - Gochang. Wind Farm. No 35 29·32 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·34 12 126 19·19 E post
2
* * * * * * * *

5.9 Wk04/23
 V

NP85, Vol M Edition 2022 continued.

M4207·028 - Gochang. Wind Farm. No 7 35 29·10 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·24 126 19·65 E post
2
* * * * * * * *

M4207·029 - Gochang. Wind Farm. No 2 35 28·88 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·20 126 20·11 E post
2
* * * * * * * *

M4207·03 Renumbered; was previously M4207.023

KR, 410, 3146·5
- Gochang. Wind Farm. No 3 35 28·57 N Fl(4)Y 8s 14 3 Yellow round steel ..
126 19·74 E post
2
*

M4207·031 - Gochang. Wind Farm. No 8 35 28·79 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·26 126 19·28 E post
2
* * * * * * * *

M4207·032 - Gochang. Wind Farm. No 35 29·01 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·36 13 126 18·82 E post
2
* * * * * * * *

M4207·033 Renumbered; was previously M4207.027

KR, 410, 3146·15
- Gochang. Wind Farm. No 35 29·23 N Fl(4)Y 8s 14 3 Yellow round steel ..
18 126 18·37 E post
2
*

M4207·034 - Gochang. Wind Farm. No 35 28·93 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·42 19 126 18·00 E post
2
* * * * * * * *

M4207·035 - Gochang. Wind Farm. No 35 28·70 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·38 14 126 18·45 E post
2
* * * * * * * *

M4207·036 - Gochang. Wind Farm. No 9 35 28·48 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·28 126 18·91 E post
2
* * * * * * * *

M4207·037 - Gochang. Wind Farm. No 4 35 28·26 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·22 126 19·36 E post
2
* * * * * * * *

M4207·038 Renumbered; was previously M4207.024

KR, 410, 3146·7
- Gochang. Wind Farm. No 5 35 27·95 N Mo(U)Y 10s 14 9 Yellow round steel ..
126 18·99 E post
2
* *

M4207·039 - Gochang. Wind Farm. No 35 28·17 N Fl(4)Y 8s 14 3 Yellow round steel ..

KR, 410, 3146·30 10 126 18·54 E post
2
* * * * * * * *

5.10 Wk04/23
 V

NP85, Vol M Edition 2022 continued.

M4207·04 Renumbered; was previously M4207.025

KR, 410, 3146·11
- Gochang. Wind Farm. No 35 28·39 N Fl(4)Y 8s 14 3 Yellow round steel ..
15 126 18·08 E post
2
* *

M4207·041 Renumbered; was previously M4207.026

KR, 410, 3146·17
- Gochang. Wind Farm. No 35 28·61 N Mo(U)Y 10s 14 9 Yellow round steel ..
20 126 17·63 E post
2
---- .. AIS .. .. .. MMSI No 994403671
---- .. Racon .. .. .. ALRS Vol 2 Station 82506.25
*

M4212·95 Gasan 34 45·99 N Fl W 5s 10 7 White 8-sided ..

KR, 410, 3121 126 00·11 E concrete tower
14
* *

M4297·1 Sisando. Sisan Hang. W 34 24·05 N Fl(4)Y 8s 13 7 Yellow round TE; Fl(4)Y 8s 7M 8m close SE (T)
KR, 410, 2527·7 Breakwater. N Head 127 15·68 E concrete tower 2022
10
*

M4297·12 Sisando. Sisan Hang. W 34 23·97 N Fl(2)R 6s 13 7 Red round concrete TE; Fl(2)R 6s 8m 7M close NE (T)
KR, 410, 2527·6 Breakwater. S Head 127 15·70 E tower 2022
10
*

M4297·2 Sisando. Sisan Hang. W 34 23·96 N Fl(3)G 7s 9 7 White 8-sided TE; Fl(3)G 7s 6m 7M close NE (T)
KR, 410, 2527 Breakwater 127 15·63 E concrete tower 2022
8
*

M4446·622 - Donghaesin Hang. No 1 37 28·10 N Fl(4)Y 8s 11 7 Yellow round steel ..

KR, 410, 1251·4 129 10·58 E post
22
* * * * * * * *

M4446·623 - Donghaesin Hang. No 2 37 28·34 N Fl(4)Y 8s 11 7 Yellow round steel ..

KR, 410, 1251·3 129 10·31 E post
22
* * * * * * * *

M4446·624 - Donghaesin Hang. No 3 37 28·58 N Fl(4)Y 8s 11 7 Yellow round steel ..

KR, 410, 1251·4 129 10·03 E post
22
* * * * * * * *

M4458·7 Bongpo Hang. Breakwater 38 15·02 N Fl R 5s 15 8 Red round concrete ..

KR, 410, 1215·5 128 34·23 E tower
13
* * *

M5070 - Kamiagata 34 33·92 N Fl W 3s 134 12 White tower ..

JP, 411, 6035 129 17·30 E 12
* * *

5.11 Wk04/23
 V

NP86, Vol N Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

N3877 - Órmos Fiskárdo. Mole. 38 27·70 N FR 3 2 White metal column Destroyed (T) 2022
GR, , 0870 Head 20 34·70 E on pedestal, red band
2
*

N4363 - Malakonta. E. Groyne. 38 23·75 N Fl Y 3s 6 3 Yellow × topmark on fl 0·3

GR, , 5350·1 Head 23 45·59 E yellow metal
framework
4
* * * * * * * *

N4576·8 - Kontiás Bay. Mole. Head 39 51·07 N Fl R 3s .. . . Metal column with fl 0·3
GR, , 7061 25 09·18 E red band
* * * * * * * *

N4735·5 - Vrachonisída 36 30·84 N Fl(3)W 12s 30 15 Metal framework and (fl 0·8, ec 1·2) x 2, fl 0·8, ec 7·2
GR, , 9510 Koulountrós 27 52·14 E gallery on white
round hut
6
* *

NP87, Vol P Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 3, dated 19 January 2023.

P3322·95 Dianbailiao Gang. Beihai 21 24·73 N Fl W 5s 11 3 Red and white post ..

CN, G103, 4892·022 Huaqiao Gang International 109 07·35 E 7
Passenger. Pier No 2
* * * * * * * *

P3323·03 Dianbailiao Gang. Beihai 21 24·99 N Fl W 5s 8 3 Red and white post ..

CN, G103, 4892·025 Huaqiao Gang International 109 07·41 E 4
Passenger. Pier No 5
* * * * * * * *

P3323·05 Dianbailiao Gang. Beihai 21 24·97 N Fl W 5s 8 3 Red and white post ..

CN, G103, 4892·024 Huaqiao Gang International 109 07·49 E 4
Passenger. Pier No 4
* * * * * * * *

P3323·0501 Dianbailiao Gang. Beihai 21 25·12 N Fl W 5s 8 3 Red and white post ..

CN, G103, 4892·026 Huaqiao Gang International 109 07·39 E 4
Passenger. Pier No 6
* * * * * * * *

BAIQUAN LIEDAO
P3633·97 - Changle Wind Power. 51, 25 49·01 N Mo(C)Y 12s 22 5 Yellow × on yellow ..
CN, G102, 2975·21 52 120 01·87 E beacon
2
--- .. AIS .. .. .. MMSI No 994141311
* * * * * * * *

P3633·971 - Changle Wind Power. 53 25 49·09 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·23 120 00·70 E beacon
2
* * * * * * * *

P3633·972 - Changle Wind Power. 54 25 49·15 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·24 119 59·53 E beacon
2
* * * * * * * *

5.12 Wk04/23
 V

NP87, Vol P Edition 2022 continued.

P3633·973 - Changle Wind Power. 55 25 49·22 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·25 119 58·36 E beacon
2
* * * * * * * *

P3633·974 - Changle Wind Power. 56, 25 49·29 N Mo(C)Y 12s 22 5 Yellow × on yellow ..
CN, G102, 2975·27 57 119 57·18 E beacon
2
--- .. AIS .. .. .. MMSI No 994141312
* * * * * * * *

P3633·975 - Changle Wind Power. 58, 25 50·38 N Mo(C)Y 12s 22 5 Yellow × on yellow ..
CN, G102, 2975·29 59 119 56·97 E beacon
2
--- .. AIS .. .. .. MMSI No 994141313
--- .. Racon .. .. .. ALRS Vol 2 Station 81525.45
* * * * * * * *

P3633·976 - Changle Wind Power. 60 25 51·02 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·3 119 58·14 E beacon
2
* * * * * * * *

P3633·977 - Changle Wind Power. 61 25 51·69 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·31 119 59·34 E beacon
2
--- .. AIS .. .. .. MMSI No 994141314
* * * * * * * *

P3633·978 - Changle Wind Power. 62 25 52·13 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·32 120 00·15 E beacon
2
* * * * * * * *

P3633·979 - Changle Wind Power. 63 25 52·58 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·33 120 00·96 E beacon
2
* * * * * * * *

P3633·98 - Changle Wind Power. 64 25 53·02 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·34 120 01·76 E beacon
2
* * * * * * * *

P3633·981 - Changle Wind Power. 65 25 53·46 N Mo(C)Y 12s 22 5 Yellow × on yellow ..

CN, G102, 2975·35 120 02·57 E beacon
2
* * * * * * * *

P3633·982 - Changle Wind Power. 66, 25 53·43 N Mo(C)Y 12s 22 5 Yellow × on yellow ..
CN, G102, 2975·37 67 120 02·93 E beacon
2
--- .. AIS .. .. .. MMSI No 994141315
--- .. Racon .. .. .. ALRS Vol 2 Station 81525.38
* * * * * * * *

P3633·983 - Changle Wind Power. 68 25 51·97 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·38 120 02·91 E beacon
2
* * * * * * * *

P3633·984 - Changle Wind Power. 69, 25 50·97 N Mo(C)Y 12s 22 5 Yellow × on yellow ..
CN, G102, 2975·4 70 120 02·96 E beacon
2
--- .. AIS .. .. .. MMSI No 994141316
* * * * * * * *

5.13 Wk04/23
 V

NP87, Vol P Edition 2022 continued.

P3633·985 - Changle Wind Power. 71 25 49·98 N Mo(C)Y 12s 22 4 Yellow × on yellow ..

CN, G102, 2975·41 120 02·61 E beacon
2
* * * * * * * *

P3717·9645 - Zhongsheng Power. No 4 30 42·80 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·024 121 59·16 E post
1
* * * * * * * *

P3717·9647 - Zhongsheng Power. No 3 30 44·18 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·023 121 59·19 E post
1
* * * * * * * *

P3717·9905 - Zhongsheng Power. No 1 30 44·76 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·021 122 01·49 E post
1
--- .. AIS .. .. .. MMSI No 994121452
* * * * * * * *

P3717·9908 - Zhongsheng Power. No 2 30 44·15 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·022 122 00·59 E post
1
--- .. AIS .. .. .. MMSI No 994121453
* * * * * * * *

P3717·9909 - Zhongsheng Power. No 5 30 42·73 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·025 122 00·94 E post
1
--- .. AIS .. .. .. MMSI No 994121454
* * * * * * * *

HANGZHOU WAN AND ZHOUSHAN QUNDAO. HANGZHOU WAN

P3747·45 - Zhongsheng Power. No 8 30 40·87 N Mo(C)Y 12s 12 5 Yellow × on yellow ..
CN, G102, 2322·028 122 03·48 E post
1
--- .. AIS .. .. .. MMSI No 994121456
* * * * * * * *

P3747·48 - Zhongsheng Power. No 9 30 40·86 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·029 122 02·16 E post
1
* * * * * * * *

P3747·49 - Zhongsheng Power. No 10 30 40·85 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·03 122 01·09 E post
1
* * * * * * * *

P3747·5 - Zhongsheng Power. No 7 30 42·23 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·027 122 03·48 E post
1
* * * * * * * *

P3747·8 - Zhongsheng Power. No 6 30 42·68 N Mo(C)Y 12s 12 5 Yellow × on yellow ..

CN, G102, 2322·026 122 02·32 E post
1
--- .. AIS .. .. .. MMSI No 994121455
* * * * * * * *

P4659·2 T'ai-hsi Yü-kang. S 23 42·20 N Fl R 4s 29 . . White tower ..

TW, 5, 23310 Breakwater. W End 120 10·31 E 9
* *

5.14 Wk04/23
 V

NP87, Vol P Edition 2022 continued.

P4659·4 T'ai-hsi Yü-kang. N 23 42·25 N Fl G 4s 20 . . White tower ..

TW, 5, 23300 Breakwater. S End 120 10·29 E 9
* *

P4693 Pi-t'ou Chiao 25 07·73 N Oc W 11s 64 17 White round concrete ec 5.

TW, 5, 10200 121 55·36 E tower W090°-325°(235°).
12 TE 2023
*

NP88, Vol Q Edition 2022. Weekly Edition No. 4, Dated 26 January 2023.
Last Updates: Weekly Edition No. 1, dated 05 January 2023.

E OF MONTEBELLO ISLANDS. CAMPBELL FIELD

Q1693·3 - Campbell 20 24·85 S Mo(U)Y 15s .. 15 Platform TE 2023
115 43·81 E
*

SSE OF MONTEBELLO ISLANDS. BAMBRA FIELD

Q1693·5 - 20 32·83 S Mo(U)Y 15s .. . . Beacon ..
115 36·29 E
* * * * * *

5.15 Wk04/23
 VI

ONGOING MAINTENANCE PROCESS IN ADMIRALTY RADIO SIGNALS VOLUMES

In order to guarantee the safety of Mariners at sea, avoid any unsafe and unnecessary duplication/updating of information
appearing in different paper and digital ADMIRALTY Radio Signals Volumes, the information will now be centralised into the most
relevant ADMIRALTY Radio Signals Volume.

For more information, a reference to the location of any required information will also be added to each ADMIRALTY
Radio Signals Volume.

EFFECTIVE FROM 19  DEC 2022 THE NAVAREA I AND METAREA  I CO-ORDINATORS WILL HAVE FULL
OPERATIONAL CAPABILITY (FOC) FOR BROADCASTING NAVIGATIONAL AND METEOROLOGICAL WARNINGS
VIA THE IRIDIUM SAFETYCAST SERVICE
The Co-Ordinators will promulgate SafetyCast messages as part of a numbered series in accordance with the joint
IMO/IHO/WMO maritime safety information manual.

For more information see ALRS Volumes 3 and 5.

Contact information for NAVAREA I is:

Phone: +44 (0)1823 353448
Fax: +44 (0)1823 322352
email: [email protected]

VI

UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS

Weekly Edition No. 4 dated 26 January 2023

The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2023.pdf)

VOLUME 1, NP281(1), Third Edition, 2022

Published Wk 42/22
(Last Updates: Weekly Edition No. 3 dated 19 January 2023)

MARITIME RADIO STATIONS

PAGE 196, LITHUANIA.

POLLUTION REPORTING.
Delete entry and replace by:

POLLUTION REPORTING
MRCC OF THE LITHUANIAN NAVY
Telephone: +370 46 391257 Fax: +370 46 391259
+370 46 391258
+370 698 18275
Email: [email protected]

PROCEDURE:
All vessels navigating in Lithuanian territorial waters or Exclusive Economic Zone are requested to report pollution and accidents which could lead to such pollution.
See BALTIC SEA AREA, POLLUTION REPORTING

CONTENT OF REPORT:
1. Details of observer (Name, IMO or MMSI number of reporting vessel, name of person making report, contact details).
2. Time and date of observation.
3. Location of pollution (Latitude and Longitude, drifting speed and direction).
4. Size of pollution (length and width of slick).
5. Type and description of pollution (visible sheen or colours on water surface). Wk04/23
6.1
6. Weather condition (wave height, wind speed and direction, current speed and direction, visibility).
7. Pollution source (name and type of vessel, IMO or MMSI number, position, course and speed).
The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2023.pdf) VI

VOLUME 1, NP281(1), Third Edition, 2022

Published Wk 42/22
(Last Updates: Weekly Edition No. 3 dated 19 January 2023)

MARITIME RADIO STATIONS

PAGE 196, LITHUANIA.

POLLUTION REPORTING.
Delete entry and replace by:

POLLUTION REPORTING
MRCC OF THE LITHUANIAN NAVY
Telephone: +370 46 391257 Fax: +370 46 391259
+370 46 391258
+370 698 18275
Email: [email protected]

PROCEDURE:
All vessels navigating in Lithuanian territorial waters or Exclusive Economic Zone are requested to report pollution and accidents which could lead to such pollution.
See BALTIC SEA AREA, POLLUTION REPORTING

CONTENT OF REPORT:
1. Details of observer (Name, IMO or MMSI number of reporting vessel, name of person making report, contact details).
2. Time and date of observation.
3. Location of pollution (Latitude and Longitude, drifting speed and direction).
4. Size of pollution (length and width of slick).
5. Type and description of pollution (visible sheen or colours on water surface).
6. Weather condition (wave height, wind speed and direction, current speed and direction, visibility).
7. Pollution source (name and type of vessel, IMO or MMSI number, position, course and speed).

REMARKS: Additional communication facilities - see Maritime Radio Stations section.

Lithuanian Navy correspondence (RSDRA2023000007753) 4/23

PAGES 222 and 224 to 226, NORWAY.

NORWEGIAN COASTAL RADIO SOUTH (LGQ).
Delete entry and replace by:

NORWEGIAN COASTAL RADIO SOUTH (LGQ)

Control Centre: 58°53′·35N 5°38′·02E MMSI 002570000 DSC VHF MF AMVER Diagram page 223
Telephone: +47 51 690044 Fax: +47 78 988331
Call: Norwegian Coast Radio Email: [email protected]
Website: www.kystradio.no
NOTE(S): Further changes to the VHF frequencies for other aerials are planned over the coming months. These will be updated by Notice to Mariner once
confirmation has been received that they have been implemented.
Continued on next page

6.1

Wk04/23
6.2
 VI
VI

NORWAY
NORWEGIAN COASTAL RADIO SOUTH (LGQ) (Continued)

VHF
Central Area (South of 63°00´N)
Ålesund (Aksla) 62°28′·57N 6°10′·75E Ch 02 16
Aurland 60°54′·35N 7°11′·52E Ch 07 16
Bangsberg (Mjøsa) 60°50′·77N 10°53′·85E Ch 16 62
Bergen (Lindås) 60°34′·63N 5°19′·73E Ch 05 16
Bergen (Rundemanen) 60°24′·77N 5°21′·93E Ch 16 60
Brattvåg (Gamlemstveten) 62°34′·52N 6°19′·12E Ch 16 22
Bremanger 61°50′·40N 4°59′·22E Ch 16 61
Fjærland 61°25′·37N 6°45′·52E Ch 22
Florø (Storåsen) 61°35′·55N 5°01′·58E Ch 28
Fosnavåg (Nerlandshorn) 62°20′·95N 5°33′·18E Ch 16 21
Geiranger 62°07′·37N 7°11′·48E Ch 16 27
Gudvangen 60°52′·00N 6°50′·78E Ch 16 60
Gulen 61°02′·06N 5°09′·30E Ch 02 16
Gullfaks A (The North Sea) 61°10′·90N 2°11′·43E Ch 16 66
Hareid (Hjørungnes) 62°21′·53N 6°07′·40E Ch 16 81 H24
Hellesylt (Ljønibba) 62°05′·02N 6°53′·48E Ch 16 20
I. Hardanger (Grimo) 60°24′·37N 6°38′·17E
Ch 16 20
Kinn 61°33′·42N 4°45′·50E
Ligtvor (Balestrand) 61°06′·08N 6°32′·13E Ch 01
Måløy (Raudeberg) 61°59′·23N 5°09′·08E Ch 01 16
Molde 62°45′·16N 7°07′·97E
Ch 07 16
Nordfjordeid (Sagtennene) 61°53′·40N 6°06′·50E
Ørskogfjellet 62°30′·95N 6°52′·33E Ch 16 78
Oseberg A (The North Sea) 60°29′·90N 2°50′·05E Ch 16 21
Snorre (The North Sea) 61°27′·25N 2°09′·07E Ch 16 64
Sogndal (Storehogen) 61°10′·38N 7°07′·15E Ch 16 65
Sotra (Pyttane) 60°19′·09N 5°06′·54E Ch 03 16
Tingvoll (Reinsfjell) 62°55′·85N 7°55′·62E Ch 16 20
Y. Hardanger (Ljoneshøgda) 60°15′·83N 6°10′·15E Ch 66
Northern Area (South of 65°30´N)
Åsgård B (The North Sea) 65°07′·02N 6°47′·60E Ch 16 79
Buholmraen (Yttervag) 64°17′·83N 10°17′·90E Ch 03 16
Draugen (The North Sea) 64°21′·25N 7°47′·35E Ch 01 16
Heidrun (The North Sea) 65°19′·75N 7°19′·60E Ch 16 78
Kristiansund (Varden) 63°06′·95N 7°42′·75E Ch 16 66
Litlefonni (Tjeldbergodden) 63°22′·80N 8°42′·92E Ch 16 78
Mosvik (Skavlen) 63°46′·32N 10°57′·05E Ch 07 16
H24
Namsos (Spillumsaksla) 64°26′·53N 11°32′·27E Ch 16 62
Njord A (The North Sea) 64°16′·40N 7°11′·92E Ch 22
Norne (The North Sea) 66°01′·62N 8°05′·13E Ch 66
Ørland (Kopparen) 63°48′·40N 9°44′·30E Ch 16 27
Rørvik (Falkhetta) 64°52′·75N 11°13′·53E Ch 16 20
Stjørdal (Forbordsfjell) 63°31′·62N 10°53′·27E Ch 16 65
Vardheia (Rissa) 63°32′·15N 9°57′·70E Ch 16
Continued on next page

6.2
6.3 Wk04/23
 VI
VI

NORWAY
NORWEGIAN COASTAL RADIO SOUTH (LGQ) (Continued)
Southern Area (South of 60°00´N)
Arendal (Hisøy) 58°26′·02N 8°44′·63E Ch 05 16
Bjerkreim (Urdalsnipa) 58°37′·99N 5°57′·64E Ch 16 64
Drammen (Bukten) 59°40′·38N 10°26′·02E Ch 16 61
Draupner (The North Sea) 58°11′·29N 2°28′·26E Ch 16 66
Ekofisk (The North Sea) 56°32′·56N 3°13′·03E Ch 16 20
Farsund 58°04′·32N 6°44′·67E Ch 01 16
Frigg (The North Sea) 59°53′·23N 2°04′·40E Ch 20
Halden (Hoyås) 59°10′·52N 11°25′·67E Ch 07 16
Haugesund (Steinsfjeld) 59°25′·30N 5°19′·67E Ch 01 16
Heimdal (The North Sea) 59°34′·42N 2°13′·63E Ch 16 22
Horten 59°24′·83N 10°28′·92E Ch 79
Kristiansand (Dolsveden) 58°08′·15N 8°08′·02E Ch 16 61
Lifjell (Sandnes) 58°55′·19N 5°47′·38E Ch 16 20
Lillesand (Justoeya) 58°12′·47N 8°20′·83E Ch 81
Lindesnes (Skibmannsheia) 58°01′·26N 7°03′·42E Ch 02 16
Lista (Storefjell) 58°09′·22N 6°42′·67E Ch 07 16
H24
Lyngdal (Kalåskniben) 58°11′·55N 6°55′·95E Ch 21
Lysebotn (Forsand) 59°05′·50N 6°45′·75E Ch 16 60
Mandal (Husheia) 58°01′·45N 7°34′·71E Ch 60
Oslo (Tryvann) 59°59′·08N 10°40′·20E Ch 16 66
Porsgrunn (Vealøs) 59°14′·17N 9°51′·93E Ch 01 16
Risør (Ranvikheia) 58°42′·83N 9°12′·47E Ch 16 20
Sand (Preståsen) 59°29′·37N 6°15′·12E Ch 79
Sleipner A (The North Sea) 58°22′·00N 1°54′·42E Ch 16 79
Stavanger (Bokn) 59°13′·19N 5°25′·67E Ch 16 28
Stavanger (Ullandhaug) 58°56′·42N 5°42′·40E Ch 16 61
Stord (Kattnakken) 59°52′·43N 5°29′·63E Ch 07 16
Svensheia (Sogne) 58°05′·08N 7°54′·43E Ch 20
Tjøme 59°04′·82N 10°24′·37E Ch 16 62
Tønsberg 59°16′·08N 10°24′·73E Ch 03
Ula (The North Sea) 57°06′·67N 2°50′·82E Ch 16 81
Valhall (The North Sea) 56°16′·65N 3°23′·63E Ch 16 22
MARITIME SAFETY INFORMATION FOLLOWED BY TRAFFIC LISTS: All Channels shown in bold: 0233 0633 1033 1433 1833 2233

RT (MF)
Position Transmits Receives Hours of Watch
Central Area (South of 63°00´N)
1728 2072
21771 2189·51 H24
2182 2182
2642 3146
Bergen (MF aerial) 60°42′·72N 4°52′·20E 2667 3277
2670 3203
2878 1964
3631 2449
3638 2456
Continued on next page

Wk04/23 6.3
6.4
 VI
VI

NORWAY
NORWEGIAN COASTAL RADIO SOUTH (LGQ) (Continued)
Position Transmits Receives Hours of Watch
Bergen (MF aerial) 60°42′·72N 4°52′·20E 3642 2470
1680 (Ch 256) 2105
1719 2063
2177 2189·5 H24
Florø 61°35′·86N 4°59′·88E 2182 2182
2646 3165
2649 3217
3645 2466
Northern Area (South of 65°30´N)
1653 2078
1737 2081
1782 (Ch 290) 2126
Ørlandet 63°39′·70N 9°32′·80E 2177 2189·5 H24
2182 2182
2635 3200
3628 2463
Southern Area (South of 60°00´N)
Bergen (Rogaland) 58°39′·50N 5°36′·30E 2182 2182
1671 (Ch 253) 2096
1785 (Ch 291) 2129
Farsund 58°04′·32N 6°44′·67E 21771 2189·51 H24
2182 2182
2676 3214
1665 2090
Jeloy 59°26′·21N 10°35′·66E 21771 2189·51 H24
2182 2182
1692 (Ch 260) 2117
1725 (Ch 271) 2069
Vigre (Rogaland) 58°39′·50N 5°36′·30E 21771 2189·51 H24
2182 2182
2656 3210
MARITIME SAFETY INFORMATION FOLLOWED BY TRAFFIC LISTS: All Channels shown in bold: 0233 0633 1033 1433 1833 2233
1 DSC Public Correspondence frequency

(former updates 47/22, 51/22)

Telenor Coast Radio website (RSDRA2023000003056) 4/23

PAGE 305, UNITED KINGDOM.

FALMOUTH MRCC, RT(MF) Table.
Delete and replace by:

RT (MF)
VI
Position Transmits Receives Hours of Watch
18801 18801
UPDATES TO ADMIRALTY LIST
1
OF RADIO SIGNALS
1
Scillies 49°55′·73N 6°18′·23W
Weekly Edition No. 4 2182
dated 26 January 2023 2182
HX
26701 26701
Treen 50°04′·22N 5°40′·96W
The ADMIRALTY List of Radio Signals diagrams included in the paper version of the2182weekly Notice to Mariners (Section
VI)1 Temporarily
are printed in black
inoperative andnotice
until further white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2023.pdf)
NAVAREA I Coordinator correspondence (RSDRA2023000001932) 4/23

VOLUME 1, NP281(1),
6.4
Third Edition, 2022 Wk04/23
Published 6.5
Wk 42/22
(Last Updates: Weekly Edition No. 3 dated 19 January 2023)
 VI
VI

VOLUME 1, NP281(2), Third Edition, 2022

Published Wk 47/22
(Last Updates: Weekly Edition No. 1 dated 05 January 2023)

MARITIME RADIO STATIONS

PAGE 356, SAINT VINCENT AND THE GRENADINES, below SAINT VINCENT AND THE GRENADINES COAST GUARD
BASE.
Insert:

POLLUTION REPORTING
SAINT VINCENT AND THE GRENADINES
TELEPHONE FAX E-Mail
MARITIME ADMINISTRATION
Saint Vincent and the Grenadines Maritime
+1 784 4561378 +1 784 4512445 [email protected]
Administration
Saint Vincent and the Grenadines Coast
+1 784 4574578 [email protected]
Guard
PROCEDURE:
If there is an incident the information required is:
1. Location; GPS coordinates if possible, or direction and distance to the nearest port.
2. Vessel description.
3. What substances were spilled.
4. Any other useful information that could be used to find the incident.

St.Vincent & the Grenadines correspondence (RSDRA2023000002834) 4/23

VOLUME 2, NP282(1), Third Edition, 2022

Published Wk 12/22
(Last Updates: Weekly Edition No. 2 dated 12 January 2023)

RADAR BEACONS

PAGE 62, RUSSIA (Arctic Coast).

85400 Mys Krutova Lt.
Delete entry

Russian Notice 51/5538/22 (RSDRA2023000007673) 4/23

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 80, BALEARES, ISLAS (Spain).

Mahón Lt.
Delete entry

Spanish Radio Signals Edition 2022 (RSDRA2022000323665) 4/23

PAGE 80, BALEARES, ISLAS (Spain), below Puerto de Mahón Lt.

Insert:

Punta de Sant Carles Lt 39°51′·91N 4°18′·41E 992241076 Real

Spanish Radio Signals Edition 2022 (RSDRA2022000323665) 4/23

PAGE 88, CROATIA, below Pokonji Dol Lt.

Insert:

Rovinj CIM ODAS Lt Buoy No 1 45°05′·00N 13°36′·28E 992381991 Real 21

Rovinj CIM ODAS Lt Buoy No 2 45°04′·43N 13°30′·85E 992381992 Real 21

Croatian Notice 12/3/22 (RSDRA2023000007293) 4/23

Wk04/23 6.5
6.6
 VI
VI

PAGE 160, SPAIN (Mediterranean Coast).

Faro Punta de San Cristobal Lt.
Delete entry

Spanish Bulletin 52/22 (RSDRA2022000323716) 4/23

PAGE 162, SPAIN (Mediterranean Coast), below Punta de la Baña Lt.

Insert:

Punta de San Cristóbal Lt 41°13′·02N 1°44′·24E 992242164 Real

Spanish Bulletin 52/22 (RSDRA2022000323716) 4/23

DIFFERENTIAL GPS (DGPS)

PAGE 232, BALEARES, ISLAS (Spain).

Mahón Lt.
Delete entry and replace by:

Punta de Sant Carles Lt 39°51′·91N 4°18′·41E 293 100 524 362 100 3 6 7 9 16

Spanish Radio Signals Edition 2022 (RSDRA2022000323665) 4/23

VOLUME 2, NP282(2), Third Edition, 2022

Published Wk 12/22
(Last Updates: Weekly Edition No. 3 dated 19 January 2023)

RADAR BEACONS

PAGE 18, CHINA, below 80980 Bingma Jiao Lt.

Insert:

CGN Wind Measurement Lt Buoy No

20°12′·18N 108°56′·43E 3 O 80985
11

Chinese Notice 52/1754/22 (RSDRA2023000002833) 4/23

PAGE 24, CHINA, below 81524·5 Changle Wind Power Lt Buoy No 1.

Insert:

Changle Offshore Wind Farm Lt Bn

25°44′·55N 119°59′·85E 3 10 Q 81524·75
No 2

Chinese Bulletin 51/22 (RSDRA2023000000021) 4/23

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 114, AUSTRALIA, below Herald Patches North Starboard Lateral Lt Buoy.
Insert:

Herald Patches Shoal 10°30′·04S 142°21′·49E 995036234 Virtual

Australian Notice 1/7/23 (RSDRA2023000008743) 4/23

PAGE 116, AUSTRALIA, below Twin Island Lt Buoy TB4.

Insert:

Varanus Island Sand Bank East 20°39′·68S 115°34′·84E 995036214 Virtual

Varanus Island Sand Bank West 20°39′·56S 115°34′·63E 995036215 Virtual

Australian Notice 1/14/23 (RSDRA2023000008743) 4/23

6.6
6.7 Wk04/23
 VI
VI

PAGE 134, CHINA, below CFD181 WHPF Platform.

Insert:

CGN Shanwei Houhu Offshore

22°46′·33N 116°12′·14E 994121802 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 1
CGN Shanwei Houhu Offshore
22°45′·59N 116°12′·91E 994121803 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 3
CGN Shanwei Houhu Offshore
22°44′·69N 116°12′·19E 994121804 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 4
CGN Shanwei Houhu Offshore
22°43′·90N 116°09′·68E 994121805 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 6
CGN Shanwei Houhu Offshore
22°43′·25N 116°07′·59E 994121806 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 8
CGN Shanwei Houhu Offshore
22°42′·53N 116°05′·29E 994121807 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 10
CGN Shanwei Houhu Offshore
22°41′·79N 116°02′·96E 994121808 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 12
CGN Shanwei Houhu Offshore
22°43′·47N 116°02′·28E 994121809 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 15
CGN Shanwei Houhu Offshore
22°44′·24N 116°04′·00E 994121812 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 17
CGN Shanwei Houhu Offshore
22°43′·75N 116°05′·85E 994121813 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 19
CGN Shanwei Houhu Offshore
22°44′·37N 116°08′·13E 994121814 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 21
CGN Shanwei Houhu Offshore
22°45′·36N 116°10′·15E 994121815 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 23
CGN Shanwei Houhu Offshore
22°40′·58N 115°59′·16E 994121816 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 25
CGN Shanwei Houhu Offshore
22°42′·14N 115°57′·46E 994121817 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 29
CGN Shanwei Houhu Offshore
22°40′·66N 115°53′·12E 994121818 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 32
CGN Shanwei Houhu Offshore
22°39′·20N 115°54′·75E 994121819 Broadcasts every 3 minutes Real
Wind Farm Lt Bn No 36
CGN Wind Measurement Lt Buoy
20°12′·18N 108°56′·43E 994121667 Broadcasts every 3 minutes Real
No 11

Chinese Notice 51/1711/22 (RSDRA2023000000021) 4/23

Chinese Notice 52/1754/22 (RSDRA2023000002833) 4/23

PAGE 138, CHINA, below Changjiang-Changshu Port.

Insert:

Changle Offshore Wind Farm Lt Bn

25°44′·48N 119°59′·77E 994141305 Broadcasts every 3 minutes Real
No 1
Changle Offshore Wind Farm Lt Bn
25°45′·37N 119°57′·97E 994141306 Broadcasts every 3 minutes Real
No 3
Changle Offshore Wind Farm Lt Bn
25°47′·99N 119°57′·35E 994141307 Broadcasts every 3 minutes Real
No 7
Changle Offshore Wind Farm Lt Bn
25°47′·88N 120°01′·36E 994141308 Broadcasts every 3 minutes Real
No 14
Changle Offshore Wind Farm Lt Bn
25°47′·55N 120°01′·33E 994141309 Broadcasts every 3 minutes Real
No 16
Changle Offshore Wind Farm Lt Bn
25°45′·33N 120°00′·24E 994141310 Broadcasts every 3 minutes Real
No 20

Chinese Notice 51/1698/22 (RSDRA2023000000021) 4/23

Wk04/23 6.7
6.8
 VI
VI

PAGE 158, CHINA, below Huaneng Rudong Wind Power Lt Bn No 12.

Insert:

Huaneng Shantou Lemen II

23°14′·49N 117°05′·92E 994121970 Broadcasts every 3 minutes Real
Offshore Windfarm Lt Buoy No LM1
Huaneng Shantou Lemen II
23°11′·09N 117°02′·82E 994121971 Broadcasts every 3 minutes Real
Offshore Windfarm Lt Buoy No LM4
Huaneng Shantou Lemen II
23°11′·08N 116°54′·27E 994121972 Broadcasts every 3 minutes Real
Offshore Windfarm Lt Buoy No LM8
Huaneng Shantou Lemen II
Offshore Windfarm Lt Buoy No 23°14′·49N 116°57′·34E 994121973 Broadcasts every 3 minutes Real
LM10

Chinese Notice 52/1751/22 (RSDRA2023000002833) 4/23

PAGE 312, VIETNAM, below My An 1 Wreck.

Insert:

Nghi Son Approach Channel Lt

19°16′·63N 105°50′·65E 995741899 Broadcasts every 3 minutes Real 6 21
Buoy No 0
Nghi Son Approach Channel Lt
19°17′·22N 105°50′·07E 995741898 Broadcasts every 3 minutes Real 6 21
Buoy No 1
Nghi Son Approach Channel Lt
19°17′·17N 105°50′·00E 995741897 Broadcasts every 3 minutes Real 6 21
Buoy No 2
Nghi Son Approach Channel Lt
19°17′·83N 105°49′·45E 995741896 Broadcasts every 3 minutes Real 6 21
Buoy No 3
Nghi Son Approach Channel Lt
19°17′·78N 105°49′·35E 995741895 Broadcasts every 3 minutes Real 6 21
Buoy No 4
Nghi Son Approach Channel Lt
19°18′·28N 105°49′·08E 995741893 Broadcasts every 3 minutes Real 6 21
Buoy No E6
Nghi Son Approach Channel Lt
19°18′·36N 105°49′·05E 995741892 Broadcasts every 3 minutes Real 6 21
Buoy No E8
Nghi Son Approach Channel Lt
19°18′·43N 105°49′·07E 995741891 Broadcasts every 3 minutes Real 6 21
Buoy No E10
Nghi Son Approach Channel Lt
19°18′·49N 105°49′·04E 995741890 Broadcasts every 3 minutes Real 6 21
Buoy No E12
Nghi Son Approach Channel Lt
19°18′·21N 105°49′·17E 995741894 Broadcasts every 3 minutes Real 6 21
Buoy No N4
Nghi Son Approach Channel Lt
19°18′·71N 105°48′·96E 995741889 Broadcasts every 3 minutes Real 6 21
Buoy No N14

Vietnamese Notice 342/22 (RSDRA2022000323257) 4/23

DIFFERENTIAL GPS (DGPS)

PAGE 324, CANADA (Atlantic Coast).

Cape Norman (S. Anthony).
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Cape Race.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Cape Ray.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

6.8
6.9 Wk04/23
 VI
VI

PAGE 324, CANADA (Atlantic Coast).

Cardinal.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Fox Island.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Hartlen Point.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Lauzon.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Moisie.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Partridge Island.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Point Escuminac.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Rigolet.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Riviere du Loup.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Saint-Jean-sur-Richelieu.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Atlantic Coast).

Western Head.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

Wk04/23 6.9
6.10
 VI
VI

PAGE 324, CANADA (Great Lakes).

Wiarton.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Pacific Coast).

Alert Bay.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Pacific Coast).

Amphitrite Point (Tofino).
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 324, CANADA (Pacific Coast).

Richmond.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 325, CANADA (Pacific Coast).

Sandspit.
Delete entry

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

DGPS DIAGRAMS

PAGE 333, Diagram, RADIOBEACONS TRANSMITTING DGPS CORRECTIONS NORTH AMERICA - WEST COAST.

Delete symbol and legend Sandspit in position 53°14′·12N 131°48′·54W.

Delete symbol and legend Alert Bay in position 50°35′·19N 126°55′·49W.
Delete symbol and legend Richmond in position 49°05′·74N 123°10′·61W.
Delete symbol and legend Amphitrite Point (Tofino) in position 48°55′·46N 125°32′·53W.

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

PAGE 335, Diagram, RADIOBEACONS TRANSMITTING DGPS CORRECTIONS NORTH AMERICA - EAST COAST.
Delete diagram and replace by new diagram on page 6.12

Canadian Notice 12/1206/22 (RSDRA2023000001638 & RSDRA2023000001914) 4/23

6.10
6.11 Wk04/23
 VI

V2(DGPS)NAMERICAE/C V0011 04/01/23

90° 80° 70° 60° 50°

RADIOBEACONS TRANSMITTING DGPS

50° 50°
CORRECTIONS
NORTH AMERICA — EAST COAST

Penobscot

Acushnet

Moriches
Sandy Hook
40° Reedy Point 40°

Driver

Kensington

Savannah

30° 30°

Tampa (Macdill)

Card Sound

20° 20°

90° 80° 70° 60° 50°

13

Wk04/23
6.12
6.11
 VI
VI

VOLUME 3, NP283(1), Third Edition, 2022

Published Wk 48/22
(Last Updates: Weekly Edition No. 52 dated 29 December 2022)

RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS

PAGES 185, 186 and 187, NORWAY.

NORWEGIAN COASTAL RADIO SOUTH (LGQ).
Delete entry and replace by:

NORWEGIAN COASTAL RADIO SOUTH (LGQ)

Control Centre: 58°53′·35N 5°38′·02E
1728 Bergen (MF aerial) 60°42′·72N 4°52′·20E
1785 Farsund 58°04′·32N 6°44′·67E
1680 Florø 61°35′·86N 4°59′·88E
A RT (MF)
1665 Jeloy 59°26′·21N 10°35′·66E
1782 Ørlandet 63°39′·70N 9°32′·80E
1692 Vigre (Rogaland) 58°39′·50N 5°36′·30E
Northern Area (South of 65°30´N)
Ch 79 Åsgård B (The North Sea) 65°07′·02N 6°47′·60E
Ch 03 Buholmraen (Yttervag) 64°17′·83N 10°17′·90E
Ch 01 Draugen (The North Sea) 64°21′·25N 7°47′·35E
Ch 78 Heidrun (The North Sea) 65°19′·75N 7°19′·60E
Ch 66 Kristiansund (Varden) 63°06′·95N 7°42′·75E
B Ch 78 VHF Litlefonni (Tjeldbergodden) 63°22′·80N 8°42′·92E
Ch 07 Mosvik (Skavlen) 63°46′·32N 10°57′·05E
Ch 62 Namsos (Spillumsaksla) 64°26′·53N 11°32′·27E
Ch 27 Ørland (Kopparen) 63°48′·40N 9°44′·30E
Ch 20 Rørvik (Falkhetta) 64°52′·75N 11°13′·53E
Ch 65 Stjørdal (Forbordsfjell) 63°31′·62N 10°53′·27E
Central Area (South of 63°00´N)
Ch 02 Ålesund (Aksla) 62°28′·57N 6°10′·75E
Ch 07 Aurland 60°54′·35N 7°11′·52E
Ch 62 Bangsberg (Mjøsa) 60°50′·77N 10°53′·85E
Ch 05 Bergen (Lindås) 60°34′·63N 5°19′·73E
Ch 60 Bergen (Rundemanen) 60°24′·77N 5°21′·93E
Ch 22 Brattvåg (Gamlemstveten) 62°34′·52N 6°19′·12E
Ch 61 Bremanger 61°50′·40N 4°59′·22E
Ch 22 Fjærland 61°25′·37N 6°45′·52E
Ch 28 Florø (Storåsen) 61°35′·55N 5°01′·58E
Ch 21 Fosnavåg (Nerlandshorn) 62°20′·95N 5°33′·18E
C Ch 27 VHF Geiranger 62°07′·37N 7°11′·48E
Ch 60 Gudvangen 60°52′·00N 6°50′·78E
Ch 02 Gulen 61°02′·06N 5°09′·30E
Ch 66 Gullfaks A (The North Sea) 61°10′·90N 2°11′·43E
Ch 81 Hareid (Hjørungnes) 62°21′·53N 6°07′·40E
Hellesylt (Ljønibba) 62°05′·02N 6°53′·48E
Ch 20 I. Hardanger (Grimo) 60°24′·37N 6°38′·17E
Kinn 61°33′·42N 4°45′·50E
Ligtvor (Balestrand) 61°06′·08N 6°32′·13E
Ch 01
Måløy (Raudeberg) 61°59′·23N 5°09′·08E
Ch 07 Molde 62°45′·16N 7°07′·97E
Continued on next page

6.12
6.13 Wk04/23
 VI
VI

NORWAY
NORWEGIAN COASTAL RADIO SOUTH (LGQ) (Continued)
Ch 07 Nordfjordeid (Sagtennene) 61°53′·40N 6°06′·50E
Ch 78 Ørskogfjellet 62°30′·95N 6°52′·33E
Ch 21 Oseberg A (The North Sea) 60°29′·90N 2°50′·05E
Ch 64 Snorre (The North Sea) 61°27′·25N 2°09′·07E
C VHF
Ch 65 Sogndal (Storehogen) 61°10′·38N 7°07′·15E
Ch 03 Sotra (Pyttane) 60°19′·09N 5°06′·54E
Ch 20 Tingvoll (Reinsfjell) 62°55′·85N 7°55′·62E
Ch 66 Y. Hardanger (Ljoneshøgda) 60°15′·83N 6°10′·15E
Southern Area (South of 60°00´N)
Ch 05 Arendal (Hisøy) 58°26′·02N 8°44′·63E
Ch 64 Bjerkreim (Urdalsnipa) 58°37′·99N 5°57′·64E
Ch 61 Drammen (Bukten) 59°40′·38N 10°26′·02E
Ch 66 Draupner (The North Sea) 58°11′·29N 2°28′·26E
Ch 20 Ekofisk (The North Sea) 56°32′·56N 3°13′·03E
Ch 01 Farsund 58°04′·32N 6°44′·67E
Ch 07 Halden (Hoyås) 59°10′·52N 11°25′·67E
Ch 01 Haugesund (Steinsfjeld) 59°25′·30N 5°19′·67E
Ch 22 Heimdal (The North Sea) 59°34′·42N 2°13′·63E
Ch 79 Horten 59°24′·83N 10°28′·92E
Ch 61 Kristiansand (Dolsveden) 58°08′·15N 8°08′·02E
Ch 20 Lifjell (Sandnes) 58°55′·19N 5°47′·38E
Ch 81 Lillesand (Justoeya) 58°12′·47N 8°20′·83E
Ch 02 Lindesnes (Skibmannsheia) 58°01′·26N 7°03′·42E
Ch 07 Lista (Storefjell) 58°09′·22N 6°42′·67E
D VHF
Ch 21 Lyngdal (Kalåskniben) 58°11′·55N 6°55′·95E
Ch 60 Mandal (Husheia) 58°01′·45N 7°34′·71E
Ch 66 Oslo (Tryvann) 59°59′·08N 10°40′·20E
Ch 01 Porsgrunn (Vealøs) 59°14′·17N 9°51′·93E
Ch 20 Risør (Ranvikheia) 58°42′·83N 9°12′·47E
Sand (Preståsen) 59°29′·37N 6°15′·12E
Ch 79
Sleipner A (The North Sea) 58°22′·00N 1°54′·42E
Ch 28 Stavanger (Bokn) 59°13′·19N 5°25′·67E
Ch 61 Stavanger (Ullandhaug) 58°56′·42N 5°42′·40E
Ch 07 Stord (Kattnakken) 59°52′·43N 5°29′·63E
Ch 20 Svensheia (Sogne) 58°05′·08N 7°54′·43E
Ch 62 Tjøme 59°04′·82N 10°24′·37E
Ch 03 Tønsberg 59°16′·08N 10°24′·73E
Ch 81 Ula (The North Sea) 57°06′·67N 2°50′·82E
Ch 22 Valhall (The North Sea) 56°16′·65N 3°23′·63E
Diagrams pages 181 and 182
Weather forecast in English and Norwegian for North Sea, coastal waters off southern and western Norway
A-D: 1215 2315 including Haltenbank, area from Storegga-Haltenbank to Greenwich meridian, Norwegian Sea between 63°N
Weather
and 65°N and from 0° to 10°W.
Bulletins
0900 1200 1500 1800
B-D: Local weather forecasts.
2100 LT
Continued on next page

Wk04/23 6.13
6.14
 VI
VI

NORWAY
NORWEGIAN COASTAL RADIO SOUTH (LGQ) (Continued)
Storm and gale warnings for coastal waters and adjoining Sea Areas in English and Norwegian.
On receipt 0233 0633 Navigational Warnings in English and Norwegian.
Navigational A-D:
1033 1433 1833 2233 Vital and important navigational warnings are broadcast on receipt and at the next two scheduled times. All
Warnings
warnings are repeated daily at 1033 for 7 days.
A-D: On request Storm and gale warnings, Navigational Warnings and ice reports.
NOTE(S): 1. Initial VHF & MF broadcasts: Important navigational and strong wind warnings (below force 9) are announced on VHF Ch 16 and 2182 kHz before
being broadcast on the working channels. Additionally, vital storm warnings (force 9 and up) and very important navigational warnings are
augmented by prior announcement on DSC.
2. Further changes to the VHF frequencies for other aerials are planned over the coming months. These will be updated by Notice to Mariner in due
course.

(former updates 48/22, 51/22)

Telenor Coast Radio website (RSDRA2023000003056) 4/23

PAGE 254, UNITED KINGDOM.

FALMOUTH MRCC.
Delete entry and replace by:

FALMOUTH MRCC
Control Centre: 50°08′·71N 5°02′·73W
A 18801 RT (MF) Scillies 49°55′·73N 6°18′·23W
Dartmouth 50°21′·30N 3°35′·20W
B Ch 10
Fowey 50°19′·62N 4°38′·19W
East Prawle 50°13′·14N 3°42′·55W
C Ch 62 Falmouth 50°08′·71N 5°02′·73W
VHF
Trevose Head 50°32′·91N 5°01′·99W
D Ch 63 Lizard 49°57′·86N 5°12′·46W
Rame Head 50°19′·03N 4°13′·18W
E Ch 64
Scillies 49°55′·73N 6°18′·23W
Diagrams pages 233, 234, 235, 236, 237 and 252
Shipping Forecast and outlook for Sea Areas: Portland, Plymouth, Sole, Lundy and Fastnet.
A-E: 0710 1910 LT 3-day Fisherman's Forecast for Sea Areas: Plymouth, Fitzroy, Sole, Lundy and Fastnet, when and where
Weather appropriate (October–March).
Bulletins 0110 0410 0710 1010
A-E: 1310 1610 1910 2210 Inshore Forecast, Gale and Strong Wind Warnings for WZ Areas 8 and 9.
LT
A-E: On receipt Gale Warnings for Sea Areas: Portland, Plymouth, Sole, Lundy and Fastnet.
Local Navigational Warnings.
Navigational Coastal (WZ) Navigational Warnings for WZ Areas 8 and 9.
Warnings A-E: 0710 1910 LT SUBFACTS/GUNFACTS Warnings: Submarine and Gunnery exercise warnings for Southwestern Approaches
(Isles of Scilly to Lizard Point), Plymouth Approaches (Lizard Point to Start Point), Portland Approaches (Start
Point to St. Albans Head) and Portsmouth Approaches (St. Albans Head to Selsey Bill).
1 Temporarily inoperative until further notice.
NOTE(S): 1. New Gale Warnings, Storm Warnings and Navigational Warnings will be broadcast (VHF & MF) on receipt and repeated at every scheduled
broadcast whilst valid. Such warnings may be announced on DSC.
2. Negative Tidal Surge Warnings will be broadcast (VHF only) on receipt, and at hourly intervals until the next scheduled routine broadcast. Such
warnings may also be announced on DSC.

NAVAREA I Coordinator correspondence (RSDRA2023000001932) 4/23

6.14
6.15 Wk04/23
 VI
VI

VOLUME 4, NP284, Fourth Edition, 2023

Published Wk 4/23

VOLUME 5, NP285, Third Edition, 2022

Published Wk 32/22
(Last Updates: Weekly Edition No. 52 dated 29 December 2022)

MF DSC, LIST OF COAST STATIONS FOR SEA AREA A2

PAGE 156, NAVAREA I, UNITED KINGDOM.

FALMOUTH MRCC.
Delete entry and replace by:

FALMOUTH MRCC 002320014 N/A Operational (Falmouth MRCC)

Remotely controlled stations:- Operational (Falmouth MRCC)
Scillies 49°55′·73N 6°18′·23W 150
Note Temporarily inoperative until further notice.
Treen 50°04′·22N 5°40′·96W 150

NAVAREA I Coordinator correspondence (RSDRA2023000001932) 4/23

NAVTEX

PAGE 258, NAVAREA II.

AÇORES (Portugal).
CENCOMARACORES (São Miguel).
Delete entry and replace by:

CENCOMARACORES (São Miguel) [F] [J] 37°48′·50N 25°33′·20W

TELEPHONE: +351 296 281777 X3
FAX: +351 296 205239 300 n miles
E-MAIL: [email protected]
NAVTEX [F]
TIME UT(GMT) WEATHER BULLETINS NAVIGATIONAL WARNINGS

0050 ● ●
0450 ● ●
0850 ● ●
1250 ● ●
1650 ● ●
2050 ● ●

Wk04/23 6.15
6.16
 VI
VI

AÇORES (Portugal)
NAVTEX [J]
Frequency: 490 kHz Language: Portuguese
TIME UT(GMT) WEATHER BULLETINS NAVIGATIONAL WARNINGS

0130 ● ●
0530 ● ●
0930 ● ●
1330 ● ●
1730 ● ●
2130 ● ●

Portuguese HO correspondence (RSDRA2023000002829) 4/23

PAGE 258, NAVAREA II.

MADEIRA (Portugal).
CENCOMARMADEIRA (Porto Santo).
Delete entry and replace by:

CENCOMARMADEIRA (Porto Santo) [P] [M] 33°05′·65N 16°20′·29W

TELEPHONE: +351 291 213112 X3
FAX: +351 211 938582 300 n miles
E-MAIL: [email protected]
NAVTEX [P]
TIME UT(GMT) WEATHER BULLETINS NAVIGATIONAL WARNINGS

0230 ● ●
0630 ● ●
1030 ● ●
1430 ● ●
1830 ● ●
2230 ● ●
NAVTEX [M]
Frequency: 490 kHz Language: Portuguese
TIME UT(GMT) WEATHER BULLETINS NAVIGATIONAL WARNINGS

0200 ● ●
0600 ● ●
1000 ● ●
1400 ● ●
1800 ● ●
2200 ● ●

Portuguese HO correspondence (RSDRA2023000002829) 4/23

6.16
6.17 Wk04/23
 VI
VI

VOLUME 6, NP286(1), Third Edition, 2022 Information

Reporting Point Traffic Centre VHF Channel
Published Wk 20/22 Required
Lt buoy 15A
––––––––––––––––––
(51°22′·84N
Vessel’s name Traffic Centre 03
(Last Updates: Weekly Edition No. 03 dated 19 January 2023) 3°42′·93E)/Lt buoy
and position Terneuzen
E2A (51°24′·45N
PAGES 25 to 27, BELGIUM AND NETHERLANDS, WESTERSCHELDE, 3°44′·47E)
Vessel Traffic Service Scheldemond (VTS-SM), REPORTING, section (1).
Lt buoy 35
Delete and replace by:
(51°23′·09N
Vessel’s name Traffic Centre
3°57′·18E)
(1) Vessels inward-bound: and position Hansweert 65
3°56′·65E)/Lt buoy
Information MG2 (51°23′·84N
Reporting Point Traffic Centre VHF Channel
Required 3°54′·27E)
see diagram Lt buoy 35
Vessel’s name Schelde Informatie
30 mins before Relevant Traffic (1A) VESSEL (51°23′·09N 19
Vessel’s name, and position Dienst
entering the VTS- Centre for the area TRAFFIC 3°57′·18E)
position, draught
SM Area which vessel will enter SERVICE Lt buoy 55 Vessel’s name,
and destination Traffic Centre
the system SCHELDEMOND (51°24′·14N position and 12
(VTS-SM) Zandvliet
4°01′·79E) destination
A line connecting Lt buoy 65 Vessel’s name,
the following: Traffic Centre
(51°22′·11N position and 12
Position Zandvliet
4°07′·06E) destination
51°25′·95N
Vessel’s name,
2°27′·50E/OD1 Zuid Saeftinge Traffic Centre
Vessel’s name, position and ETA 12
buoy (51°21′·45N Lt (51°21′·85N Zandvliet
position, ETA destination
2°30′·83E)/ Traffic Centre 65 4°13′·05E)
Vlissingen Roads
Middelkerkebank Wandelaar
and planned
Lt buoy
route
(51°18′·20N (Former updates 51/22 & 01/23)
2°42′·75E)/
Westende water Netherlands Bulletin 51-52/22, (RSDRA2022000323530), 04/23
tower (51°10′·60N
2°47′·56E)
PAGE 426, UNITED KINGDOM, STORNOWAY, Isle of Lewis, Pilots,
Vessel’s name, PROCEDURE, section (1).
SBZ Lt buoy position, ETA Delete and replace by:
Traffic Centre 64
(51°42′·45N Vlissingen Roads
Steenbank
3°16′·62E) and planned
route (1) Pilotage is compulsory for the following vessels navigating anywhere within the
harbour N of a line through 58°11′·50N including Glumaig Harbour:
A line connecting
(a) Vessels carrying on board dangerous goods in bulk
the following:
(b) Vessels over 30m LOA carrying 12 or more passengers
Lt buoy OBST
(c) Vessels over 25m LOA engaged in towing
14 (51°15′·57N
(d) Vessels less than 25m LOA engaged in towing vessels or structures over 20m
2°58′·01E)/
in length excluding, with prior approval of the Hr Mr, such vessels engaged in
Lt buoy A1 bis
Vessel’s name, emergency towing
(51°21′·69N
position, ETA (e) Vessels over 65m LOA with single propulsion unit and without an operational
2°58′·02E)/ Traffic Centre 69
Vlissingen Roads bow thruster
Lt buoy S2 Zeebrugge
and planned (f) Vessels over 75m LOA without both operational bow thruster and stern thruster
(51°23′·37N
route (g) All vessels over 95m LOA
2°58′·07E)/VG6 Lt
(h) Any vessel which has any defect in its hull, machinery or equipment which
buoy (51°25′·22N
might affect its safe navigation within the harbour
2°56′·24E)/
(i) Any vessel which in the opinion of the Hr Mr is restricted or hampered in
position
any way in its operation so as to present a potential hazard to the safety of
51°28′·75N
navigation within the harbour
2°56′·00E
Lt buoy W5 Stornoway Port Authority Notice 13/22, (RSDRA2022000323272), 04/23
(51°24′·32N
Vessel’s name Traffic Centre 14
3°24′·51E)/Lt buoy
OG17 (51°29′·05N
and position Vlissingen ––––––––––––––––––––––––––––––
3°29′·50E)
Vessel’s name,
Traffic Centre 14
Vlissingen Roads ETA destination
Vlissingen
and route

continued on next column

1
Wk04/23
6.18
 VIVI

VOLUME 6, NP286(2), Third Edition, 2022 Port

Published Wk 24/22 CONTACT DETAILS:

–––––––––––––––––– Muara Harbour

Call: Muara Harbour (V8L3)
(Last Updates: Weekly Edition No. 52 dated 29 December 2022)
VHF Channel: Ch 16; 12
PAGE 53, DENMARK, TUNNELHAVN RØDBYHAVN, Port, below NOTE RT Frequency (kHz): 2182
section. Telephone: +673(0)2 770270
Insert: +673(0)2 771998
Fax: +673(0)2 770293
Maritime and Port Authority
CONTACT DETAILS: Telephone: +673(0)2 770222
Port Office +673(0)8 312809 (WhatsApp & SMS)
VHF Channel: Ch 12 Fax: +673(0)2 770283 (Administration)
Telephone: +45 24 879512 +673(0)2 770625 (Operations)
E-mail: lol-whm@c-jv.com E-mail: [email protected]
Website: mpabd.gov.bn
(Former update 28/22) Port Operator
Danish Bulletin 50/22, (RSDRA2022000323098), 04/23 Telephone: +673(0)2 770239
+673(0)2 770238
Fax: +673(0)2 770131 (HQ)
PAGE 429, SWEDEN, ÖRNSKÖLDSVIK, Pilots, PROCEDURE, section (6). +673(0)2 770136 (Operation Control Room)
Delete and replace by: E-mail: [email protected]
Website: www.muaraportcompany.com.bn
(6) Pilot boards in the following positions:
HOURS: H24
(a) No 1: 63°09′·40N 18°59′·80E (Skagsudde)
(b) No 2: 63°18′·10N 19°16′·10E (Husum) Tugs
CONTACT DETAILS:
Swedish Notices 944/17279/23 & 944/17285/23, (RSDRA2023000006887), 04/23
VHF Channel: Ch 08

–––––––––––––––––––––––––––––– HOURS: H24

(Former update 47/22)

VOLUME 6, NP286(4), Third Edition, 2022
UKHO, (RSDRA2022000317733), 04/23
Published Wk 36/22

–––––––––––––––––– ––––––––––––––––––––––––––––––
(Last Updates: Weekly Edition No. 01 dated 05 January 2023)
VOLUME 6, NP286(6), Fourth Edition, 2023
PAGE 53, AUSTRALIA, HAY POINT, Queensland, Pilots, PROCEDURE,
section (4) (a). Published Wk 03/23
Delete and replace by: ––––––––––––––––––
(Last Updates: Weekly Edition No. 03 dated 19 January 2023)
(a) Bravo: 21°13′·30S 149°21′·20E
PAGE 290, KOREA, SOUTH, DONGHAE, Vessel Traffic Service, AREA,
Australian Notice 01/05/23, (RSDRA2023000008743), 04/23 section (2) (a).
Delete and replace by:
PAGE 109, BRUNEI, MUARA.
Delete entry and replace by: (a) Sector 1 (Donghae, Mukho Hang, Samcheok Hang and Okgye Hang):
(i) 37°46′·38N 128°57′·08E
(ii) 37°50′·30N 128°59′·28E
MUARA 5°01′N 115°04′E (iii) 37°49′·23N 129°08′·50E
UNCTAD LOCODE: BN MUA
(iv) 37°34′·72N 129°19′·50E
Pilots (v) 37°26′·67N 129°24′·53E
(vi) 37°21′·40N 129°18′·20E
CONTACT DETAILS: (vii) 37°22′·76N 129°15′·39E
VHF Channel: Ch 16; 08 12
Fax: +673(0)2 772717 Korean Notice 49/1098/22, (RSDRA2022000311661), 04/23
PROCEDURE:
(1) Pilotage is compulsory for merchant vessels over 46m in length using the
deepwater channel. PAGE 291, KOREA, SOUTH, diagram DONGHAE VESSEL TRAFFIC
(2) Pilot ordering: Vessels should send request for Pilots to Director of Marine, SERVICE.
Serasa Muara, Brunei Darussalam at least 24h in advance. Delete diagram DONGHAE VESSEL TRAFFIC SERVICE and replace
(3) Pilot boards in position 5°04′·65N 115°06′·48E. by diagram on page 6.22.

continued on next column Korean Notice 49/1098/22, (RSDRA2022000311661), 04/23

2
Wk04/23
6.19
 VI
VI

PAGE 292, KOREA, SOUTH, DONGHAE, Vessel Traffic Service, CONTACT DETAILS:
PROCEDURE, section (2), table. Call: CROSS SOI
Delete VHF Channel: Ch 16
RT Frequency (kHz): 2182 8291
Telephone: +262(0)2 62434343 (196 (abbreviated number from a landline or
Leaving VTS Area mobile))
(1) Vessel’s name
Leaving Report crossing the Reporting +262(0)6 92880433 (SMS)
(2) Position
Line +262(0)6 92610108 (Voice/SMS/MMS/WhatsApp)
Fax: +262(0)2 62711595
Telex: +583 422799193 (Inmarsat C)
and replace by: +881 631448080 (Iridium)
E-mail: [email protected]
[email protected]
When leaving the VTS
Leaving Report (Sector (1) Vessel’s name Website: https://www.dm.sud-ocean-indien.developpement-durable.gouv.fr/
Area crossing the
2 only) (2) Position cross-r24.html
Reporting Line
MMSI: 006601000
HOURS: H24
Korean Notice 49/1098/22, (RSDRA2022000311661), 04/23
PROCEDURE:
(1) The regulations are mandatory for the following:
––––––––––––––––––––––––––––––
(a) Vessels carrying hydrocarbons or residual gases of hydrocarbons stated in the
list in Annex 1 of MARPOL 73.
VOLUME 6, NP286(8), Third Edition, 2022 (b) Non-inerted tankers carrying:
Published Wk 13/22 (i) Harmful liquid substances as dened in Annex 2 of the MARPOL
Convention and classied in categories A and B of Chapter 17 of the IMO
–––––––––––––––––– International Bulk Carriers (IBC) Code
(ii) Bulk liquied gas
(Last Updates: Weekly Edition No. 03 dated 19 January 2023)
(iii) Plutonium 239, Uranium 233, 235 or 238, Thorium, or any other substance
PAGE 67, IRAQ, AL BAŞRAH TERMINAL (AL BAKR TERMINAL), containing these with the exception of minerals
Pilots, PROCEDURE, section (2). (iv) Acetaldehyde (UN 1089), alcoholic ether (UN 1155), ethylvinylic ether
Delete and replace by: (UN 1302), monoethylamine (UN 1036), ammonium nitrate (UN 0222), or
propylene oxide (UN 1280)
(v) Organochlorate compounds (e.g. organochlorate pesticides UN 2761,
(2) Pilot boards in the vicinity of the Fairway Lt buoy (29°20′·01N 49°03′·00E). 2762, 2995 or 2996)
(c) Vessels carrying:
Iraqi Maritime Affairs correspondence, (RSDRA2023000010425), 04/23 (i) Harmful liquid substances as dened in MARPOL Annex 2 and not listed
above
(ii) Noxious liquid substances as dened in MARPOL Annex 3
PAGE 68, IRAQ, KHAWR AL AMAYA TERMINAL, Pilots, PROCEDURE,
(iii) Dangerous goods as dened in The International Maritime Dangerous
section (2). Goods (IMDG) Code, including radioactive products listed in the INF rules,
Delete and replace by: Chapter 17 of the IMO International Bulk Carriers (IBC) Code and Chapter
19 of the IMO International Gas Carriers (IGC) Code
(2) Pilot boards in the vicinity of the Fairway Lt buoy (29°20′·01N 49°03′·00E). (2) Participating vessels navigating or located in the AREA are required to contact
CROSS SOI 6h prior to entering territorial waters or 4h before leaving a port or
Iraqi Maritime Affairs correspondence, (RSDRA2023000010425), 04/23 anchorage, stating:
(a) Intentions concerning movements in territorial waters
(b) Ability to manoeuvre or navigate
PAGES 131 to 133, RÉUNION (France), SURNAV (RÉUNION AND (3) The message should be sent by one of the following methods:
SOUTHERN OCEAN). (a) Fax or telephone
Delete entry and replace by: (b) E-mail
(c) Inmarsat C
SURNAV (RÉUNION AND SOUTHERN 30°15′S 56°28′E (4) If the vessel is in a French port, the message can be sent as directed by the Port
OCEAN) Authority. Frequencies 2182 and 8291 kHz should be used only as a last option.

SURNAV (Système de Comptes Rendus de Mouvements des continued on next page

Navires) Reporting System
LOCATION: CROSS South Indian Ocean (CROSS SOI) RÉUNION MRCC, Port
Réunion
AREA:
The French Territorial Waters of the South Indian Ocean (La Réunion, Mayotte, Terres
Australes and French Antarctica (TAAF: Îles Saint-Paul & Amsterdam, Îles Crozet,
Îles Kerguelen, Bassas da India, Île Europa, Îles Glorieuses, Île Juan de Nova and
Île Tromelin)).

continued on next column

3
Wk04/23
6.20
 VI
VI

(5) The message should be addressed to SURNAV CROSS SOI and headed ID Information required
RAPPORT SURNAV - CIRCULATION EAUX TERRITORIALES/SIGNALEMENT
CARGAISON TRANSPORTÉE, with the following information: Cargo and details enabling information to be obtained about dangerous
P
merchandise or pollutants carried on board
ID Information required
Q Nature of the incident or situation encountered
A Vessel’s name, call sign, MMSI and ag
Description of any pollution caused or observed and every container,
B Date and time in UT (GMT) in 6 gures (DD HH MM), suffixed Z
R package or merchandise lost overboard or observed adrift and presenting a
C Position (latitude/longitude) danger to navigation or the environment
E Course S Weather conditions
F Speed Name and details of the owner, charter company, or any possible consignee
T
G Last port of call in France
Date and time in UT (GMT) and point of entry into French Territorial Waters U Type of vessel
H
or date and time of departure W Number of persons on board
I Destination and ETA Date and time in UT (GMT) of any distress call or request for tow, presence
Date and time in UT (GMT) and point of exit from French Territorial Waters, X and name of any assisting vessel or UT (GMT) time of arrival of an
K or date and time of arrival in port, anchorage, waiting or deballasting zone, assisting vessel; other information
and destination in French waters Request for transmission of the report to another system (AMVER,
Y
L Intentions AUSREP, JASREP, MAREP etc.)
M RT watch kept Z End of report
P Detailed description of dangerous goods or pollutants on board (see note) NOTE: Vessels should consult IMO resolution A.851(20) to ensure that the information
Q Any defects, damage, faults or restrictions required in PAPA, QUEBEC, ROMEO and X-RAY is given correctly.
S Weather conditions in the area (10) Vessels providing assistance to damaged or defective vessels of 300 gt
or over, and which are less than 50 n miles from the Réunion (French) coast
Notication to the authorities holding information (lists, manifests, cargo must report to CROSS SOI, with a message prexed SURNAV AVARIES stating the
T
plan) relating to dangerous goods on board following information:
U Type of vessel, LOA and draught ID Information required
W Number of people on board A Vessel’s name, call sign, MMSI and ag
X Other remarks B Date and time in UT (GMT) in 6 gures (DD HH MM), suffixed Z
Z End of message C Position (latitude/longitude) of assisting vessel
Note: Vessels should consult IMO resolution A.851(20) to ensure that the information E Course of assisting vessel
required in PAPA is given correctly. F Speed of assisting vessel
(6) Any subsequent changes should be reported immediately. I Destination and ETA
(7) Vessels should maintain a continuous listening watch on 2182 kHz and VHF Ch
16 whilst in the AREA, except when alongside, and respond to requests from French M Available means of communication
Government vessels and French CRSs to change to an alternative frequency. P Cargo of vessel being assisted
(8) Reports of accidents or incidents at sea: All vessels of 300 gt navigating Q Damage sustained to vessel being assisted (if known)
in the area of the French Economic Zone (ZEE) of the South Indian Ocean, must
immediately report the following to CROSS SOI: Name and address of shipowner, shipping agent, or eventual consignatory
T
(a) Any incident or accident affecting the safety of the vessel (e.g. collision, of the assisting vessel in France
grounding, damage, failure or breakdown, piracy, shifting of cargo, all hull U Type of assisting vessel
defects or structural failures) Date and time in UT (GMT), position, weather, name, callsign, ag of the
(b) Any incident or accident affecting navigational safety (e.g. failures likely to X vessel, course and speed of the vessel involved in the accident; other
affect the manoeuvrability of the vessel, or any defects affecting the propulsion information
or steering system, the electrical generating system and navigation and
communications equipment) Request for transmission of the report to another system (AMVER,
Y
(c) Any situation likely to cause pollution of the water or coastline (e.g. any AUSREP, JASREP, MAREP etc.)
discharge or risk of discharging pollutants into the sea) Z End of report
(d) Any slicks of pollutant and any containers or packages observed adrift in the
sea
(9) The message should be addressed to CROSS SOI, and prexed SURNAV- French Bulletin 25/22, (RSDRA2022000156514), 04/23
AVARIES, stating the following:
ID Information required ––––––––––––––––––––––––––––––
A Vessel’s name, call sign, MMSI and ag
B Date and time in UT (GMT) in 6 gures (DD HH MM), suffixed Z
C Position (latitude and longitude)
E Course
F Speed
G Last port of call
I Destination and ETA
M RT watch kept
O Draught

continued on next column

4
Wk04/23
6.21
 VI

V6(6)DONGHAE V006 23/12/22

55´ 129° 05´ 10´ 15´ 20´ 25´ 30´

50´ 50´

45´ 45´

40´ 40´

Okgye Hang Sector 1

VHF Ch 12
Okgye No 4

35´ 35´

Mukho Hang
Mukho No 1

Donghae
37° Hang 37°
30´ No 2 30´
Donghae

Samcheok Hang
Samcheok
No 3
25´ 25´

20´ 20´

15´ 15´

No 6

Hosan
10´ DONGHAE Hosan Hang
10´

VESSEL TRAFFIC SERVICE Sector 2

VHF Ch 14
VTS Service Zone Limits

05´ 05´

55´ 129° 05´ 10´ 15´ 20´ 25´ 30´

Wk04/23
6.22
 VII

UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS

There are no updates to miscellaneous Nautical Publications this week

UKRAINE NAVIGATIONAL INFORMATION

Owing to insufficient information, it is not always possible to ensure that ADMIRALTY Nautical
Publications are completely up-- to-- date for new dangers or changes to aids to navigation.

Mariners are therefore advised to exercise particular caution when navigating in Ukrainian waters.

7.1
Wk04/23
 VIII

ADMIRALTY DIGITAL SERVICES

1. ENC / ECDIS and AVCS

a) ENCs temporarily withdrawn from AVCS

A list of ENCs that have been temporarily withdrawn from AVCS for safety reasons can be found in the README file and on the
AVCS Updates page, accessed from admiralty.co.uk/avcs.

b) ENC Readme.txt file

The README.TXT file located within the ENC_ROOT folder of AVCS Exchange sets contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the AVCS Support page, accessed from admiralty.co.uk/avcs.

This file should be consulted each week to ensure that all related issues are taken into consideration. The file header indicates the last
time that the README file was updated and the date that it was issued.

c) Temporary information in ENCs

Mariners should take temporary information into account when planning and executing a passage with ENCs and most ENC producers
now include temporary information in their ENCs. It is usually compiled as normal ENC updates, sometimes with the start and end dates
attributed or described as ‘Temporary’ in the pick report.

The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file at: admiralty.co.uk/ENC-TP-NMs. Note that T&P NMs are compiled for paper charts and may not align with
any temporary information that is compiled into ENCs.

ADMIRALTY Information Overlay (AIO) includes ADMIRALTY T&P NMs for paper charts where the ENC Producer has not
confirmed that they include temporary information in their ENCs.

Further guidance can be found in the AIO User Guide on the AVCS Support page, accessed from admiralty.co.uk/avcs.

d) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)

The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.

The ARCS Online Updating Service was withdrawn in July 2019.

2. ADMIRALTY Products Supporting Digital Navigation

i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.

iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.

8.1
Wk 04/23
 VIII

3. ADMIRALTY Digital Publications (ADP)

ADMIRALTY Sailing Directions: Removal of AIS and Racons

In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as this is held in
greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon information will be removed
from new editions of each Sailing Direction volume, and AIS and Racon information present in existing Sailing Direction volumes will
no longer be updated. For accurate, up-to-date information on AIS and Racons, refer to ADMIRALTY Radio Signals publications.

ADP V23 is available on the ADP Weekly Update DVD.

ADP V23 will be released on 15th December 2022. ADP V18 (until July 2023), V19 and V23 are supported by the UKHO and are the
only versions that allow users to receive tidal updates as they are made available. Users of older versions of ADP should upgrade to a
supported version at their earliest convenience.

ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT

The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.

For information: Please note the UKHO will not be supporting V18 from July 2023.

The ADP software and the Data updates can still be downloaded from weekly ADP Update and Software DVDs.

To get access to the ADP Update and Software DVD, please contact your ADMIRALTY Distributor.

For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to [email protected]

4. ADMIRALTY e-Nautical Publications (AENP)

There is currently an e-Reader 1.3 enabling users to read Digital copies of our Sailing Directions paper publications.

A new e-Reader 1.4 was released to the Channel on 01/10/2020. This version 1.4 has got the same functionalities as the current version
1.3 but is more performant and user-friendly. While the current 1.3 version can be used on Windows 7 and 8.1 Operating Systems (OS),
the e-Reader 1.4 can only be used on Windows 8.1 and 10 OS, to follow the Microsoft guidelines of withdrawing support for Windows
7 OS.

To enable users to activate this new application, users might need to delete one e-Reader application from their Fleet Manager Licences
if the maximum 3 allowed has been reached.

Both the e-Readers 1.3 and 1.4 are supported at the UKHO.

The e-Reader 1.4 software and the Data updates can be downloaded from weekly ADP Update and Software DVDs.

To get access to the AENP Update and Software DVD, please contact your ADMIRALTY Distributor.

8.2
Wk 04/23
 VIII

5. Status of ADMIRALTY Digital Services

Update status table

Product Last issue date/Week Reissue Date/Week

i. ADMIRALTY Vector Chart Service (AVCS) Base .zip download 01 December 2022 - 48
ii. ADMIRALTY Information Overlay (AIO) Base CD 31 March 2022 - 13
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 03 November 2022 - 44
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 22 September 2022 - 38 16 February 2023 - 07
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 15 December 2022 - 50
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 24 November 2022 - 47
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 08 September 2022 - 36 06 April 2023 - 14
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 19 January 2023 - 03
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 26 May 2022 - 21 23 March 2023 - 12
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 11August 2022 - 32 02 March 2023 - 09
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 28 July 2022 - 30
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 10 March 2022 - 10 02 February 2023 - 05
06 October 2022 - 40
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts

ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.

6. Supported ADMIRALTY Software Versions

Product Supported Versions

ADP V18, V19, V23
ADMIRALTY e-Reader 1.3, 1.4
NavPac and Compact Data 4.2

If you are using an unsupported version, contact your Chart Distributor to upgrade to the latest version as soon as possible.

8.3
Wk 04/23
 HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

Reporting Port Information affecting ADMIRALTY Products

NAME OF PORT

APPROXIMATE POSITION Latitude Longitude

GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.

Number of ships or tonnage handled per

year.

Maximum size of vessel handled.

Copy of Port Handbook (if available).

ANCHORAGES
Designation, depths, holding ground,
shelter afforded.

PILOTAGE
Authority for requests.

Embark position.

Regulations.

DIRECTIONS
Entry and berthing information.

Tidal streams.

Navigational aids.

TUGS
Number available.

WHARVES
Names, numbers or positions & lengths.

Depths alongside.

CARGO HANDLING
Containers, lighters, Ro-Ro etc.

REPAIRS
Hull, machinery and underwater.

Shipyards.

Docking or slipping facilities.

(Give size of vessels handled or
dimensions)

Divers.
 HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

RESCUE AND DISTRESS

Salvage, Lifeboat, Coastguard, etc.

SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)

Fresh water.
(with method of delivery and rate of
supply)

Provisions.

SERVICES
Medical.

Ship Sanitation.

Garbage and slops.

Ship chandlery, tank cleaning, compass

adjustment, hull painting.

COMMUNICATIONS
Nearest airport or airfield.

Port radio and information service. (with

frequencies and hours of operating)

PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.

VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.

ADDITIONAL DETAILS

NOTES:

1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.

2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
 HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
 HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.

2. Objective of GNSS Data Collection

The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.

It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.

It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.

3. Details required

a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.

b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).

c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.

d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
 Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services

For emergency information affecting safety of life at sea forward to: [email protected]
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: [email protected]
This form H.102 and instructions are available online: admiralty.co.uk/msi

Date Ref. number

Name of ship or sender IMO number
Address and general locality

E-mail / Tel / Fax of sender

Subject

Position
Latitude Longitude
(see Instruction 2)

GPS Datum Accuracy

ADMIRALTY Charts affected Edition

Latest Weekly Edition of

Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected

Latest update disk applied Week:

Make, model and or age of ECDIS if

applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:

Name of observer / reporter

H.102A submitted Yes No H.102B submitted Yes No

Tick box if not willing to be named as source of this information

Alternatively use our H-Note App located here:

admiralty.co.uk/H-note