0% found this document useful (0 votes)
29 views

57-606 Eclipse Model 706 Hart Io

Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
29 views

57-606 Eclipse Model 706 Hart Io

Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 104

HART® Installation and Operating

Manual for Eclipse® Model 706


Software Version 1.x

High Performance,
4th Generation
Guided Wave Radar
Level Transmitter

2014/68/EU
Read this Manual Before Installing WARNING! Explosion hazard. Do not connect or dis-
This manual provides information on the Eclipse® trans- connect designs rated Explosion proof or Non-incendive
mitter. It is important that all instructions are read care- unless power has been switched off and/or the area is
fully and followed in sequence. The QuickStart known to be non-hazardous.
Installation instructions are a brief guide to the sequence
of steps for experienced technicians to follow when Low Voltage Directive
installing the equipment. Detailed instructions are For use in Installations Category II, Pollution Degree 2.
included in the Complete Installation section of this manual. If equipment is used in a manner not specified by the
manufacturer, protection provided by equipment may be
Conventions Used in this Manual impaired.
Certain conventions are used in this manual to convey
specific types of information. General technical material, Warranty
support data, and safety information are presented in All Magnetrol electronic level and flow controls are war-
narrative form. The following styles are used for notes, ranted free of defects in materials or workmanship for
cautions, and warnings. eighteen months from the date of original factory ship-
ment. If returned within the warranty period; and, upon
NOTES factory inspection of the control, the cause of the claim is
Notes contain information that augments or clarifies an determined to be covered under the warranty; then,
operating step. Notes do not normally contain actions. Magnetrol will repair or replace the control at no cost to
They follow the procedural steps to which they refer. the purchaser (or owner) other than transportation.
Cautions Magnetrol shall not be liable for misapplication, labor
Cautions alert the technician to special conditions that claims, direct or consequential damage or expense arising
could injure personnel, damage equipment, or reduce from the installation or use of equipment. There are no
a component’s mechanical integrity. Cautions are also other warranties expressed or implied, except special writ-
used to alert the technician to unsafe practices or the ten warranties covering some Magnetrol products.
need for special protective equipment or specific
materials. In this manual, a caution box indicates a Quality Assurance
potentially hazardous situation which, if not avoided, The quality assurance system in place at Magnetrol
may result in minor or moderate injury. guarantees the highest level of quality throughout the
company. Magnetrol is committed to providing full
WARNINGS
customer satisfaction both in quality products and
Warnings identify potentially dangerous situations or quality service.
serious hazards. In this manual, a warning indicates an
imminently hazardous situation which, if not avoided, The Magnetrol quality assurance system is registered to
could result in serious injury or death. ISO 9001 affirming its commitment to known interna-
tional quality standards providing the strongest assurance
Safety Messages of product/service quality available.
The Eclipse system is designed for use in Category II,
Pollution Degree 2 installations. Follow all standard
industry procedures for servicing electrical and computer
equipment when working with or around high voltage. Copyright © 2023 AMETEK Magnetrol USA, LLC.
Always shut off the power supply before touching any All rights reserved.
components. Although high voltage is not present in this
system, it may be present in other systems. Performance specifications are effective with date of issue
and are subject to change without notice. Magnetrol®
Electrical components are sensitive to electrostatic discharge. reserves the right to make changes to the product
To prevent equipment damage, observe safety procedures described in this manual at any time without notice.
when working with electrostatic sensitive components. Magnetrol makes no warranty with respect to the accura-
cy of the information in this manual.
This device complies with Part 15 of the FCC rules.
Operation is subject to the following two conditions:
(1) This device may not cause harmful interference, and
(2) This device must accept any interference received,
including interference that may cause undesired operation.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter


Eclipse® Model 706 Guided Wave Radar Transmitter
Table of Contents

1.0 QuickStart Installation 2.5 Wiring ....................................................................21


1.1 Getting Started..........................................................5 2.5.1 General Purpose or Non-Incendive
1.1.1 Equipment and Tools .....................................5 (CI I, Div 2) ..................................................21
1.1.2 Configuration Information.............................6 2.5.2 Intrinsically Safe ...........................................22
1.2 QuickStart Mounting................................................6 2.5.3 Explosion Proof............................................22
1.2.1 Probe..............................................................7 2.6 Configuration .........................................................23
1.2.2 Transmitter.....................................................7 2.6.1 Bench Configuration....................................23
1.3 QuickStart Wiring ....................................................8 2.6.2 Menu Traversal and Data Entry....................24
1.4 QuickStart Configuration .........................................8 2.6.2.1 Navigating the Menu.............................24
1.4.1 QuickStart Menu Options ...........................10 2.6.2.2 Data Selection .......................................24
1.4.1.1 QuickStart Numerical Data Entry.........11 2.6.2.3 Entering Numeric Data Using
Digit Entry............................................25
2.0 Complete Installation
2.6.2.4 Entering Numeric Data
2.1 Unpacking ..............................................................12
Using Increment/Decrement .................25
2.2 Electrostatic Discharge (ESD)
2.6.2.5 Entering Character Data........................26
Handling Procedure ................................................12
2.6.3 Password Protection .....................................26
2.3 Before You Begin.....................................................13
2.6.4 Model 706 Menu: Step-By-Step Procedure ..27
2.3.1 Site Preparation ............................................13
2.6.5 Model 706 Configuration Menu —
2.3.2 Equipment and Tools ...................................13
Device Setup ................................................29
2.3.3 Operational Considerations..........................13
2.7 Configuration Using HART® ..................................35
2.4 Mounting................................................................14
2.7.1 Connections .................................................35
2.4.1 Installing a Coaxial Probe.............................14
2.7.2 HART Communicator Display ....................35
2.4.1.1 To install a coaxial probe .......................15
2.7.3 HART Revision Table ..................................35
2.4.2 Installing a Segmented Coaxial Probes .........15
2.7.4 HART Menu — Model 706 ........................35
2.4.3 Installing a Caged Probe...............................16
2.4.3.1 To install a caged probe .........................16 3.0 Reference Information
2.4.4 Installing a Single Rod Probe .......................17 3.1 Transmitter Description ..........................................40
2.4.4.1 To install a rigid single rod probe ..........18 3.2 Theory of Operation...............................................40
2.4.4.2 To install a flexible single rod probe 3.2.1 Guided Wave Radar .....................................40
for liquids ..............................................18 3.2.2 Time Domain Reflectometry (TDR)............40
2.4.4.3 To install a flexible single rod probe 3.2.3 Equivalent Time Sampling (ETS).................41
for solids................................................19 3.2.4 Interface Detection.......................................41
2.4.5 Installing the Eclipse Model 706 3.2.5 Saturated Steam Applications .......................42
Transmitter...................................................20 3.2.6 Overfill Capability........................................43
2.4.5.1 Integral Mount ......................................20
2.4.5.2 Remote Mount ......................................20

57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.3 Troubleshooting and Diagnostics ............................43 3.6 Specifications ..........................................................67
3.3.1 Diagnostics (Namur NE 107) ......................44 3.6.1 Functional/Physical ......................................67
3.3.2 Diagnostic Indication Simulation.................46 3.6.2 O-ring (Seal) Selection Chart .......................69
3.3.3 Diagnostic Indication Table..........................46 3.6.3 Probe Selection Guide ..................................70
3.3.4 Diagnostic Help ...........................................49 3.6.4 Probe Specifications......................................71
3.3.5 Troubleshooting Application Issues ..............50 3.6.5 Physical Specifications — Transmitter ..........72
3.3.5.1 Model 706 (Dual Element Coaxial) ......50 3.6.6 Physical Specifications — Coaxial Probes.....73
3.3.5.2 Model 706 (Single Rod Probe) ..............51 3.6.7 Physical Specifications — Caged Probes.......74
3.4 Configuration Information .....................................53 3.6.8 Physical Specifications — 705/706 Adapter...74
3.4.1 Level Offset Description...............................53 3.6.9 Physical Specifications —
3.4.2 End-of-Probe Analysis ..................................54 Single Rod Flexible Probes ...........................75
3.4.3 Echo Rejection .............................................55 3.6.10 Physical Specifications —
3.4.4 Volumetric Capability ..................................55 Single Rod Rigid Probes...............................76
3.4.4.1 Configuration using built-in 3.6.11 Power Supply Requirements .........................77
vessel types ............................................55 3.6.11.1 Safe Operating Area...............................77
3.4.4.2 Configuration using Custom Table........57 3.6.11.2 Supply Voltage.......................................77
3.4.5 Open Channel Flow Capability....................58 3.7 Model Numbers......................................................78
3.4.5.1 Configuration using Flume/Weir 3.7.1 Transmitter...................................................78
Equations ..............................................59 3.7.2 Enlarged Coaxial Probe ................................79
3.4.5.2 Configuration using Generic 3.7.3 Small Coaxial Probe .....................................81
Equation................................................60 3.7.4 Caged Probe.................................................83
3.4.5.3 Configuration using Generic 3.7.5 Single Rod Rigid Probe ................................85
Equation................................................61 3.7.6 Single Cable Flexible Probe ..........................87
3.4.6 Reset Function .............................................62 3.7.7 Segmented Probe Options............................89
3.4.7 Additional Diagnostic/Troubleshooting 3.8 Parts ........................................................................90
Capabilities ................................................62 3.8.1 Replacement Parts ........................................90
3.4.7.1 Event History ........................................62 4.0 Advanced Configuration/Troubleshooting Techniques
3.4.7.2 Context-sensitive Help ..........................62 4.1 End-of-Probe Analysis (EOPA) ................................92
3.4.7.3 Trend Data ............................................62 4.1.1 Enable EOPA using PACTware .....................92
3.5 Agency Approvals....................................................63 4.1.2 Enable EOPA using keyboard/LCD...............93
3.5.1 Agency Specifications 4.2 Sloped Threshold .....................................................94
(Special Conditions for use) .........................64 4.3 Echo Rejection .........................................................96
3.5.2 Agency Specifications (XP Installation) ........64 4.4 Buildup Detection....................................................99
3.5.3 Agency Specifications (IS Installation)..........65 4.4.1 Buildup Detection Setup
3.5.4 Agency Specifications using PACTware ........................................100
(IS, FOUNDATION™ fieldbus Installation) ......66 4.4.2 Buildup Detection Setup
using the Keypad........................................101

57-606 Eclipse Model 706 Guided Wave Radar Transmitter


1.0 QuickStart Installation
The QuickStart Installation procedures provide an overview
of the key steps required for mounting, wiring, and config-
uring the Eclipse Model 706 Guided Wave Radar level
transmitter. These procedures are intended for more experi-
enced installers of Eclipse transmitters (or other electronic
level measurement instruments).
Section 2.0, Complete Installation, offers more detailed
installation instructions for the first time user.
WARNING: Overfill-capable probes such as the Model 7yD, 7yG,
7yJ, 7yL, 7yP, or 7yT should be used for all Safety
Shutdown/Overfill applications.

The Model 706 transmitter, when used with an overfill


coaxial or caged probe, is capable of measuring true
liquid level all the way up to the face of the flange or NPT
connection. This is a very unique advantage as com-
pared to other Guided Wave Radar (GWR) devices that
may infer level at the top of the probe when signals are
lost or uncertain. Refer to Section 3.2.6 for additional
information on overfill capability.

Depending on the probe type, all other Eclipse probes


should be installed so the maximum overfill level is a
minimum of 6"-12" (150–300 mm) below the flange or
NPT connection. This may include utilizing a nozzle or
spool piece to raise the probe. Consult factory to ensure
proper installation and operation.

1.1 Getting Started

Have the proper equipment, tools, and information


available before beginning the QuickStart Installation
procedures.

1.1.1 Equipment and Tools


• Open-end wrenches (or adjustable wrench) to fit the process
connection size and type.
• Coaxial probe: 11⁄2" (38 mm)
• Single rod probe: 17⁄8" (47 mm)
• Transmitter 11⁄2" (38 mm).
• A torque wrench is highly desirable.
• Flat-blade screwdriver
• Cable cutter and 3⁄32" hex wrench (for flexible cable probes
only)
• Digital multimeter or digital volt/ammeter
• 24 VDC power supply, 23 mA minimum

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 5


1.1.2 Configuration Information
To utilize the QuickStart menu available on the
Eclipse Model 706, some key information is required
for configuration.
Gather the information and complete the following operating
parameters table before beginning configuration.

NOTES: The QuickStart menu is available for Level Only applications.


1. Refer to Section 2.6.5 for configuration menus for Interface,
Volume or Flow applications.
2. These configuration steps are not necessary if the transmitter
was pre-configured prior to shipment.
Display Question Answer

Level Units What units of measurement will be used?


(inches, millimeters, centimeters, feet
or meters) _____________
Probe Model What probe model is listed on the
model information?
(first three digits of probe model number) _____________
Probe Mount Is the probe mounted NPT, BSP,
or flange? (Refer to probe model.) _____________
Probe Length What probe length is listed on the
probe model information? (last three
digits of the probe model number) _____________
Level Offset The desired level reading when the
liquid is at the tip of the probe. (Refer
to Section 3.4 for more information.) _____________
Dielectric Range What is the dielectric constant range
of the process medium? _____________
4.0 mA What is the 0% reference point for the
Set Point (LRV) 4.0 mA value? _____________
(Does not apply for FounDation fieldbus™ or PRoFiBuS Pa)

20.0 mA What is the 100% reference point for


Set Point (LRV) the 20.0 mA value?
(Ensure that this value is outside of the
Blocking Distance when utilizing non-
overfill-capable probes.) _____________
(Does not apply for FounDation fieldbus™ or PRoFiBuS Pa)

Failure Alarm What output current is desired when


a Failure Indicator is present? _____________
(Does not apply for FounDation fieldbus™ or PRoFiBuS Pa)

1.2 QuickStart Mounting

Ensure that the configuration style and process connection


size/type of the Eclipse transmitter and probe matches the
requirements of the installation before continuing with the
QuickStart installation.

6 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


For optimal performance (and correlation to the Calibration
Certificate included with all units), confirm the model and
serial numbers shown on the nameplates of the Eclipse
probe and transmitter are identical.
NOTES: For applications using the Model 7yS Steam Probe, it is
mandatory to keep the transmitter and probe matched as a set.
(Refer to Section 3.2.5 for additional information regarding sat-
urated steam applications.)
To avoid moisture ingress in the housing, covers should be fully
tightened at all times. For same reason, conduit entries should
be properly sealed.

1.2.1 Probe
1. Carefully place the probe into the vessel. Align the probe
process connection with the threaded or flanged mounting
on the vessel.
2. Tighten the hex nut of the probe process connection or
flange bolts.
NOTES: Leave the plastic protective cap in place on the probe until you
are ready to install the transmitter. Do not use sealing com-
pound or TFE tape on probe connection to transmitter as this
connection is sealed with a Viton® o-ring.
If using a segmented probe or removable rod, ensure that all

pieces are assembled and connected before installation.

ƒ 1.2.2 Transmitter
3. Remove the protective plastic cap from the top of the probe
and store for future use. Make sure the top probe connector
➆ ≈
(male connection) is clean and dry. Clean with isopropyl
alcohol and cotton swabs if necessary.
¬ 4. Carefully place the transmitter onto the probe. Align the
universal connection at the base of the transmitter housing
¡ with the top of the probe. Only hand-tighten the connec-

¿
tion at this point in time.
5. Rotate the transmitter so that it is in the most convenient
position for wiring, configuring and viewing.
6. Using a 11⁄2" (38 mm) wrench, tighten the universal connec-
tion on the transmitter 1⁄4 to 1⁄2 turn beyond hand-tight. As
this is a critical connection, a torque wrench is highly
recommended to obtain 45 ft-lbs (60 Nm).
DO NOT LEAVE HAND-TIGHT.
NOTE: The Eclipse Model 706 transmitter can be supplied with a uni-
versal connector containing lock screws for applications with
significant vibration. Contact the factory for additional infor-
mation.
7. If available, install optional adapter (for use with Model 705
probes. As this is a critical connection, a torque wrench is
highly recommended to obtain 45 ft-lbs (60 Nm).

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 7


1.3 QuickStart Wiring

WARNING! Possible explosion hazard. Do not connect or discon-


nect equipment unless power has been switched off and
the area is known to be non-hazardous.

Black (-) Red (+) NOTE: Ensure that the electrical wiring to the Eclipse Model 706 trans-
mitter is complete and in compliance with all local regulations
and codes.
(+)
(-) 1. Remove the cover of the upper wiring compartment of the
Model 706 transmitter.
2. Attach a conduit fitting and mount the conduit plug in the
spare opening. Pull the power supply wire through the con-
duit fitting.
3. If present, connect cable shield to an earth ground at the
power supply.
4. Connect an earth ground to the nearest green ground screw.
(Not shown in illustration.)
5. Connect the positive supply wire to the (+) terminal and the
negative supply wire to the (-) terminal. For Explosion
Proof Installations, see Wiring, Section 2.5.3.
6. Replace and tighten the cover.

1.4 QuickStart Configuration

If requested, the Eclipse Model 706 transmitter is shipped


fully pre-configured for the application and can be installed
immediately. Otherwise it is shipped configured with
default values from the factory and can be easily
reconfigured in the shop.
Up Down Back Enter The minimum configuration instructions required for using
the QuickStart menu follow. Use the information from the
operating parameters table in Section 1.1.2 before proceeding
In or Cm
with the configuration.
Probe Mount

The QuickStart menu offers a very simple two screen


20 mA
(100% Point)
overview showing the basic parameters required for typical
“Level Only” operation.
Probe Model 1. Apply power to the transmitter.
Probe Length

Dielectric
The graphic LCD display can be programmed to change
of Medium every 2 seconds to show pertinent Measured Values on the
Home Screen. For example: Level, %Output, and Loop
4 mA Level
(0%-point) current can all be displayed on a rotating screen.
Level Offset
The LCD can also be programmed to always show just one
of the Measured Variables at all times. For example: Level
NOTE: A small transition zone (0–12") can be the only value displayed on the screen.
(0-300 mm) may exist at the top
and bottom of certain probes. 2. Remove the lower electronic compartment cover.

8 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3. The push buttons offer multiple forms of functionality for
menu navigation and data entry. (See Section 2.6 for com-
STEP 4 plete explanation).


UP moves up through the menu or increases a displayed
value.


DOWN moves down through the menu or decreases a
displayed value.

BACK exits a branch of the menu or exits without
accepting entered value.
➪ ENTER enters a branch of the menu or accepts a
displayed entry.

NOTE: Holding down ENTER when any menu or parameter is high-


lighted will show help text in reference to that item.
Up Down Back Enter
The default User Password = 0. (If a password is requested,
enter it at that time.)
STEP 5 The following configuration entries are the minimum
required for a QuickStart configuration. Refer to figures at
left.
4. Press any key at the Home Screen to access the Main Menu.
5. Press ➪ ENTER with the DEVICE SETUP menu item
highlighted.
6. Press ➪ ENTER with the QUICKSTART menu item
highlighted.
The QuickStart shows the basic parameters, with the
present value of the highlighted parameter shown at the
bottom of the screen.
One can now quickly and easily scroll through the
QuickStart configuration items, changing those parameters
as required:
STEP 6 • Scroll to the parameter to be changed.
• Press ➪ ENTER at the highlighted parameter.
• Scroll to the desired option, then press ➪ ENTER.

• Scroll to next parameter or press BACK when
finished to exit the QuickStart menu.
Section 1.4.1 lists and describes the nine parameters in the
QuickStart menu.
7. After making all of the necessary changes in the QuickStart
menu, press the BACK button three times to return to the
Home Screen.
8. The QuickStart configuration is complete. If properly con-
figured, the Model 706 transmitter is measuring level and is
ready for service.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 9


1.4.1 QuickStart Menu Options
Level Units Select the Units of measurement for the level readout:
• Inches • Feet • Millimeters • Centimeters • Meters
Adapter YES — Model 705 probe models appear below
NO — Model 706 probe models appear below
Probe Model Select the Probe Model to be used with Model 706:
(NOTE: All Probe Models may not be available depending on the firmware version.)
• 7YD Coaxial High Temperature High Pressure
• 7YF Single Rod for installation onto tanks
• 7YG Single Rod for installation into cages
• 7YH Single Hygienic (Future)
• 7YJ Single High Temperature High Pressure for cages
• 7YL Single Rod High Pressure for cages
• 7YM Single Rod High Pressure for tanks
• 7YN Single Rod High Temperature High Pressure for tanks
• 7YP Coaxial High Pressure
• 7YS Coaxial Steam
• 7YT Coaxial Standard
• 7YV Coax High Vibration (Future)
• 7Y1 Single Flexible Standard
• 7Y2 Single Flexible Bulk Solids
• 7Y3 Single Flexible Standard High Temperature High Pressure
• 7Y5 Twin Flexible Bulk Solids
• 7Y6 Single Flexible High Temperature High Pressure for Cages
• 7Y7 Twin Flexible with FEP Coating
Probe Mount Select the type of Probe Mounting to the vessel:
(NOTE: All Probe Mount options may not be available depending on the firmware version).
• NPT (National Pipe Thread)
• BSP (British Standard Pipe)
• Flange (ASME or DIN)
• NPT with Flushing Connection
• BSP with Flushing Connection
• Flange with Flushing Connection
• Hygienic
Probe Length Enter the exact Probe Length as printed on the probe nameplate. Probe Length is shown
as the last three digits of the Probe Model number. Range is 12 inches to 100 feet (30 cm
to 30 meters) probe dependent. Refer to Section 1.4.1.1.
Level Offset Enter the desired level reading when the liquid is at the end of the probe. Range is -25 feet
to 75 feet (-762 cm to 22 meters). Refer to Section 3.4 for further information. (With default
Level Offset = 0, all measurements are referenced from the bottom of the probe.)
Dielectric Range Enter the Dielectric Range for the material to be measured.
Below 1.7 (Light Hydrocarbons like Propane and Butane)
1.7 to 3.0 (Most typical hydrocarbons)
3.0 to 10 (Varying dielectric, for example: mixing tanks)
Above 10 (Water-based media)
4 mA Set Point Enter the level value (0%-point) for the 4 mA point. Lower Range Value (LRV).
(LRV) Refer to Section 1.4.1.1.
20 mA Set Point
HART Only

Enter the level value (100%-point) for the 20 mA point. Upper Range Value (URV).
(URV) Refer to Section 1.4.1.1.
Failure Alarm Enter the desired output state when a Failure Indicator is active.
• 22 mA
• 3.6 mA
• Hold (Hold last value is not recommended)

10 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


1.4.1.1 QuickStart Numerical Data Entry
To make numerical entry changes to Probe Length and
Level Offset:


UP moves up to the next highest digit (0,1,2,3,....,9 or
the decimal point).
If held down the digits scroll until the push button is
released.


DOWN moves up to the next lowest digit (0,1,2,3,....,9
or the decimal point). If held down the digits scroll until
the push button is released.

BACK moves the cursor to the left and deletes a digit.
If the cursor is already at the leftmost position, then the
screen is exited without changing the previously saved
value.
➪ ENTER Moves the cursor to the right. If the cursor is
located at a blank character position, the new value is
saved.
Scrolling further DOWN in the QuickStart menu results in
the remaining parameters appearing one by one, with the
present highlighted value shown at the bottom of the
screen.

BACK returns to the previous menu without changing
the original value, which is immediately redisplayed.
➪ ENTER accepts the displayed value and returns to the
previous menu.
Negative values can be entered by highlighting the “+” sign
shown prior to the number, then pressing UP to change it
to show “-”.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 11


2.0 Complete Installation
This section provides detailed procedures for properly
installing, wiring, and configuring the Eclipse Model 706
Guided Wave Radar Level Transmitter.

2.1 Unpacking

Unpack the instrument carefully. Make sure all components


have been removed from the packing material. Check all the
contents against the packing slip and report any discrepan-
cies to the factory.
Before proceeding with the installation, do the following:
• Inspect all components for damage. Report any damage to
the carrier within 24 hours.
• Make sure the nameplate model number on the probe and
transmitter agree with the packing slip and purchase order.
• Record the model and serial numbers for future reference
when ordering parts.

Model Number

Serial Number

For optimal performance (and correlation to the Calibration


Certificate included with all units), confirm the model and
serial numbers shown on the nameplates of the Eclipse
probe and transmitter are identical.
NOTES: For applications using the Model 7yS Steam Probe, it is
mandatory to keep the transmitter and probe matched as a set.
(Refer to section 3.2.5 for additional information regarding sat-
urated steam applications.)
To avoid moisture ingress in the housing, covers should be fully
tightened at all times. For same reason, conduit entries should
be properly sealed.

2.2 Electrostatic Discharge (ESD)


Handling Procedure

Magnetrol electronic instruments are manufactured to the


highest quality standards. These instruments use electronic
components that may be damaged by static electricity pre-
sent in most work environments.
The following steps are recommended to reduce the risk of
component failure due to electrostatic discharge.
• Ship and store circuit boards in anti-static bags. If an anti-
static bag is not available, wrap the board in aluminum
foil. Do not place boards on foam packing materials.

12 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


• Use a grounding wrist strap when installing and removing
circuit boards. A grounded workstation is recommended.
• Handle circuit boards only by the edges. Do not touch
components or connector pins.
• Make sure that all electrical connections are completely
made and none are partial or floating. Ground all equip-
ment to a good, earth ground.

2.3 Before You Begin


2.3.1 Site Preparation
Each Eclipse Model 706 transmitter/probe is built to match
the physical specifications of the required installation.
Ensure that the probe process connection is correct for the
threaded or flanged mounting on the vessel where the trans-
mitter will be placed. See Mounting, Section 2.4.
Ensure that all local, state, and federal regulations and
guidelines are observed. See Wiring, Section 2.5.
Ensure that the wiring between the power supply and
Eclipse transmitter is complete and correct for the type
of installation. See Specifications, Section 3.6.

2.3.2 Equipment and Tools


No special equipment or tools are required to install the
Eclipse transmitter. The following items are recommended:
• Open-end wrenches (or adjustable wrench) to fit the process
connection size and type.
• Coaxial probe: 11⁄2" (38 mm)
• Single Rod probe: 17⁄8" (47 mm)
• Transmitter 11⁄2" (38 mm)
A torque wrench is highly desirable.
• Flat-blade screwdriver
• Cable cutter and 3⁄32" hex wrench (for flexible cable probes
only)
• Digital multimeter or digital volt/ammeter
• 24 VDC power supply, 23 mA minimum

2.3.3 Operational Considerations


Operating specifications vary based on probe model
number. See Specifications, Section 3.6.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 13


2.4 Mounting
An Eclipse Model 706 GWR probe can be mounted on to a
tank using a variety of process connections. Generally, either
a threaded or flanged connection is used. For information
about the sizes and types of connections available, see Probe
Model Numbers, Section 3.7.2.
NOTE: Do not place insulating material around any part of the Eclipse
Model 706 transmitter as this may cause excessive heat buildup.
The figure at left shows an example of properly installed insula-
tion. Insulation is critical in high temperature applications where
Do Not Insulate condensation can occur at the top of the probe.
Above This Point

Insulation
Ensure that all mounting connections are properly in place
Region on the tank before installing the probe.
5" (125 mm)
Mounting
Flange Compare the nameplate on the probe and transmitter with
the product information to confirm that the Eclipse probe
is correct for the intended installation.
Model 7yS Probe WARNING! Overfill-capable probes such as the Model 7yD, 7yG,
7yJ, 7yL, 7yP, or 7yT should be used for all Safety
Shutdown/Overfill applications.
The Model 706 transmitter, when used with an overfill
coaxial or caged probe, is capable of measuring true
liquid level to within specification all the way up to the
face of the flange or NPT connection. This is a very
unique advantage as compared to other Guided Wave
Radar (GWR) devices that may infer level at the top of the
probe when signals are lost or uncertain. Refer to Section
3.2.6 for additional information on overfill capability.
All other Eclipse probes should be installed so the max-
imum overfill level is a minimum of 6" (150 mm) below
the flange or NPT connection. This may include utilizing
a nozzle or spool piece to raise the probe. Consult facto-
Remove transport screws ry to ensure proper installation and operation.
and/or cable ties, if applicable
WARNING! Do not disassemble probe when in service and under
pressure.

NOTE: Models 7yD, 7yJ, 7yL, 7yM, 7yN, 7yP and 7yS High
Temperature/High Pressure probes (containing a glass ceramic
alloy process seal) should be handled with extra care. Only
handle these probes by the flanges or NPT connections.
Remove transport hardware as shown at left.

2.4.1 Installing a Coaxial Probe


(Models 7yD, 7yP, 7yS, and 7yT)
Before installing, ensure that:
• The model and serial numbers shown on the nameplates of
the Eclipse probe and transmitter are identical. For optimal
performance (and correlation to the Calibration Certificate
included with all units), transmitters and probes should be
installed as a matched set.

14 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


NOTE: For applications using the Model 7yS Steam Probe, it is
mandatory to keep the transmitter and probe matched as a
set. Refer to Section 3.2.5 for additional information regarding
saturated steam applications.
• Probe has adequate room for installation and has unob-
① ④ structed entry to the bottom of the vessel.
② • Process temperature, pressure, dielectric, and viscosity are

within the probe specifications for the installation. See
Specifications, Section 3.6.

2.4.1.1 To install a coaxial probe:


1. Ensure that the process connection is the correct threaded
or flanged mounting.
2. Carefully place the probe into the vessel. Properly align the
gasket on flanged installations.
3. Align the probe process connection with the threaded or
flanged mounting on the vessel.
4. For threaded connections, tighten the hex nut of the probe
process connection. For flanged connections, tighten flange
bolts.

NOTE: If the transmitter is to be installed at a later time, do not remove


the protective cap from the probe.

NOTE: Do not use sealing compound or TFE tape on probe connec-


tion to transmitter as this connection is sealed by a Viton®
o-ring.

2.4.2 Installing a Segmented Coaxial Probe


1. 2. 1. Use the large installation plate with the 1.88" slot (provided
with the order) to hold the lower section of the outer tube.
Using two 2" wrenches, tighten couplings. Threads will be
self-locking.
Repeat for the second outer tube section.
2. Use the smaller installation plate to hold the lower section
of the extension shaft, resting one of the spacers on the
plate. Using two 1⁄2" wrenches, tighten extension shaft
coupling. Secure with set screws.
Repeat for the second extension shaft section.
3. 4.
3. Using two 1⁄2" wrenches, attach the middle extension shaft
segment to the top segment (built into the probe head).
The flange gasket should be in place before assembling this
joint. It may be taped to the probe flange to hold it out of
the way.
4. Remove the smaller installation plate from the extension
shaft and assemble the middle outer tube segment to the
coupling on the probe head. Remove the large installation
plate, and assemble the flanges.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 15


2.4.3 Installing a Caged Probe
Models 7yG, 7yL and 7yJ
Before installing, ensure that the:
• The model and serial numbers shown on the nameplates of
the Eclipse probe and transmitter are identical. For optimal
performance (and correlation to the Calibration Certificate
included with all units), transmitters and probes should be
installed as a matched set.
• Probe has adequate room for installation and has unob-
structed entry to the bottom of the vessel.
• Process temperature, pressure, dielectric, and viscosity are
within the probe specifications for the installation. See
Specifications, Section 3.6.

NOTES: Model 7yL and 7yJ probes (High Pressure/High Temperature


probes (containing a glass ceramic alloy process seal) should
be handled with extra care. Only handle these probes by the
flanges or NPT connection. Do not lift probes by the shaft.
If using a segmented caged probe, ensure that all pieces are
assembled and connected before installation.

2.4.3.1 To install a caged probe:


1. Ensure that the process connection is the correct flanged
mounting.
2. Carefully place the probe into the vessel. Properly align the
gasket on flanged installations.

NOTE: A metallic gasket must be used to ensure an adequate


electrical connection between the probe flange and the cage
(chamber). This connection is critical to obtain true overfill
performance.
3. Align the probe process connection flanged mounting on
the cage.
4. Tighten flange bolts.

NOTES: If the transmitter is to be installed at a later time, do not remove


the protective cap from the probe.
Do not use sealing compound or TFE tape on probe connec-
tion to transmitter as this connection is sealed by a Viton®
o-ring.

16 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.4.4 Installing a Single Rod Probe
Rigid Models 7yF, 7yG, 7yJ, 7yL, 7yM and 7yN
Flexible Models 7y1, 7y2, 7y3 and 7y6
Before installing, ensure that the:
• The model and serial numbers shown on the nameplates of
the Eclipse probe and transmitter are identical. For optimal
performance (and correlation to the Calibration Certificate
included with all units), transmitters and probes should be
installed as a matched set.
• Probe has adequate room for installation and has unob-
structed entry to the bottom of the vessel.
• Process temperature, pressure, dielectric, and viscosity are
within the probe specifications for the installation. See
Specifications, Section 3.6.
For standard Non-Overfill-Capable Single Rod probes
B
installed directly into a vessel:
A

NOTE: If using a removable rod, ensure that all pieces are assembled
and connected before installation.
1. Ensure that the nozzle does not restrict performance by
ensuring the following:
• Nozzle is > 2" (50mm) diameter.
• Ratio of Diameter: Length (A:B) is 1:1 or greater; any ratio
<1:1 (e.g., a 2"¥ 6" nozzle = 1:3) may require a Blocking
Distance and/or DIELECTRIC RANGE adjustment.
2. No pipe reducers (restrictions) are used.
3. Probe is kept away from conductive objects to ensure proper
performance.
• See Probe Clearance Table below. A lower gain (increase in
DIELECTRIC RANGE setting) may be necessary to ignore
certain objects
• This table is only a recommendation. These distances can
be improved by optimizing the transmitter configuration
with PACTware™.

Distance
Acceptable Objects
to Probe
Continuous, smooth, parallel conductive sur-
<6" (15 cm) face, for example a metal tank wall; important
that probe does not touch wall
<1" (25 mm) diameter pipe and beams,
>6" (15 cm)
ladder rungs
<3" (75 mm) diameter pipe and beams,
>12" (30 cm)
concrete walls

>18" (46 cm) All remaining objects

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 17


2.4.4.1 To install a rigid single rod probe:
1. Ensure that the process connection is at least 1" NPT or a
flanged mounting.
2. Carefully place the probe into the vessel. Align the gasket
on flanged installations.
➀ ➃
➁ ➂ 3. Align the probe process connection with the threaded or
flanged mounting on the vessel.
4. For threaded connections, tighten the hex nut of the probe
process connection. For flanged connections, tighten flange
bolts.
5. When mounted directly into vessels, the probe can be stabi-
lized by placing the tip of the probe into a non-metallic cup
or bracket at the bottom of the probe.

A bottom spacer option is offered for mounting into a
metallic cup or bracket or for centering within a pipe/cham-
ber. Refer to Replacement Parts, Section 3.8 for additional
information.

NOTE: If the transmitter is to be installed at a later time, do not remove


➀ ➃ the protective cap from the probe. Do not use sealing com-
➁ ➂ pound or TFE tape on probe connection to transmitter as this
connection is sealed by a Viton® O-ring.

2.4.4.2 To install a flexible single rod probe for liquids:


1. Make sure the process connection is at least 1" NPT or a
flanged mounting.
2. Carefully place the probe into the vessel. Align the gasket
on flanged installations.
3. Align the probe process connection with the threaded or
➅ flanged mounting on the vessel.
4. For threaded connections, tighten the hex nut of the probe
process connection. For flanged connections, tighten flange
➄ bolts.
5. Probe can be shortened in field:
1
a. Raise TFE weight (1) exposing securing device (2).
0.50" (13 mm) Ø
b. Loosen both #10–32 set screws (3) using 3⁄32" hex wrench
and remove securing device.
c. Cut and remove needed cable (4) length.
d. Reattach securing device and tighten screws.
e. Enter new probe length (in the appropriate units) into
2 the transmitter.
3
6. Probe can be attached to the tank bottom using the 0.50"
4 (13 mm) hole provided in the TFE weight. Cable tension
should not exceed 50 lbs (23 Kgs).

18 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.4.4.3 To install a flexible single rod probe for solids:
The Model 7y2 Single Flexible Bulk Solids probe is
designed for a 3000 lb. (1360 kg) pull-down force for use in
applications such as sand, plastic pellets and grains. It is
offered with a maximum 100 foot (30.5 meter) probe
length.
Model 7y2 Single Rod — dielectric ≥4 probe length depen-
dent.
Applications
• Salts: Dielectric constant 4.0–7.0
• Metallic powder, coal dust: Dielectric constant >7

NOTE: Contact the factory for those applications requiring additional


pull down forces such as cement, heavy gravel, etc.
Mounting recommendations
• To reduce forces, utilize the standard 5 lb. (2.3 kg) weight
at the bottom of the probe instead of securing the probe to
the vessel.
• Mount the probe at least 12 inches (30 cm) from the wall.
Ideal location is 1⁄4 to 1⁄6 the diameter to average the angle of
repose.
• A metal flange must be used when mounting on plastic
vessels.
1. Ensure the process connection is at least 2" NPT or a
flanged mounting.
2. Carefully place the probe into the vessel. Align the gasket
on flanged installations.
3. Align the probe process connection with the threaded or
flanged mounting on the vessel.
4. For threaded connections, tighten the hex nut of the probe
process connection. For flanged connections, tighten flange
bolts.
5. Probe can be shortened in field:
6. a. Loosen and remove the two cable clamps.
Probe
Length b. Slide the weight off of the probe.
c. Cut the cable to the required length plus 6.5 inches
(165 mm).
d. Slide the weight back on to the probe.
3" ± 1"
(75 mm ± 25 mm) e. Reinstall the two cable clamps and tighten.
f. Enter the new probe length (in the appropriate level
units) into the transmitter.
Model 7y2 Single Rod
Bulk Solids Probe

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 19


2.4.5 Installing the Eclipse Model 706 Transmitter
The transmitter can be ordered for installation in three con-
figurations;
1) As an Integral version, mounted directly on to the probe.
2) As a Remote version, with the transmitter separated from
the probe by a distance of 3 feet (84 cm).
3) As a Remote version, with the transmitter separated from
the probe by a distance of 12 feet (366 cm).
NOTE Due to their extra weight, remote mounted transmitter Model
Number 706-5xxx-x2x is recommended for:
• All applications utilizing the cast 316 SS enclosure
• Those applications having potential vibration

2.4.5.1 Integral Mount

¡
1. Remove the protective plastic cap from the top of the
probe. Store the cap in a safe place in case the transmitter
has to be removed later.

≈ √ 2. Place the transmitter on the probe. Do not allow the gold


pin in the high frequency connector or the gold socket on
the probe to get dirty.
ƒ
¿ 3. Align the universal connection at the base of the transmitter
housing with the top of the probe. Only hand-tighten the
¬
connection at this time.
4. Rotate the transmitter to face the most convenient direction
for wiring, configuration, and viewing.
5. When the transmitter is facing the desired direction, use a
11⁄2" wrench to tighten the universal connection on the
transmitter to 45 ft-lbs (60 Nm). A torque wrench is highly
recommended. This is a critical connection. DO NOT
LEAVE HAND-TIGHT.
6. If available, install optional adapter (for use with Model 705
probes. As this is a critical connection, a torque wrench is
highly recommended to obtain 45 ft-lbs (60 Nm).

2.4.5.2 Remote Mount


1. Mount the transmitter/remote bracket as an assembly within
33" or 144" (84 or 366 cm) of the probe. DO NOT
REMOVE TRANSMITTER OR REMOTE CABLE
FROM THE MOUNTING BRACKET.
2. Remove the protective plastic cap from the top of the
probe. Store the cap in a safe place in case the transmitter
has to be removed later.
3. Align the universal connection at the end of the remote
assembly with the top of the probe. Using a 11⁄2" wrench,
tighten the universal connection on the transmitter to 45 ft-
U-bolts not included
lbs (60 Nm). A torque wrench is highly recommended. This
is a critical connection. DO NOT LEAVE HAND-TIGHT.
20 57-606 Eclipse Model 706 Guided Wave Radar Transmitter
2.5 Wiring
Caution: HART versions of the Eclipse Model 706 transmitter oper-
ate at voltages of 11–36 VDC, FOUNDATION fieldbus ver-
sions operate at 9–17.5 VDC, and Modbus versions oper-
ate at 8–30 VDC. Higher voltages will damage the trans-
mitter.
Wiring connections between the power supply and the
Eclipse Model 706 transmitter should be made using 18–
22 AWG shielded twisted pair instrument cable.
Connections are made to the terminal strip and the
ground connections within the top enclosure compartment.
The directions for wiring the Eclipse transmitter depend
on the application:
• General Purpose or Non-Incendive (Cl I, Div. 2)
• Intrinsically Safe
• Explosion Proof
WARNING! Explosion hazard. Do not disconnect equipment unless
power has been switched off or the area is known to be
non-hazardous.

2.5.1 General Purpose or Non-Incendive (Cl I, Div. 2)


A general purpose installation does not have flammable
media present.
Areas rated Non-Incendive (Cl I, Div. 2) have flammable
Black (-) Red (+) media present only under abnormal conditions.
No special electrical connections are required.
(+)
(-)
Caution: If flammable media is contained in the vessel, the trans-
mitter must be installed per Class I, Div 1 standards of
area classification.
To install General Purpose or Non-Incendive wiring:
1. Remove the cover from the wiring compartment of the
transmitter. Install the conduit plug in the unused opening
and use PTFE tape/sealant to ensure a liquid-tight connec-
tion.
2. Install a conduit fitting and pull the supply wires.
Wiring Diagram
3. Connect shield to an earth ground at power supply.
4. Connect an earth ground wire to the nearest green ground
screw (not shown in illustration).
5. Connect the positive supply wire to the (+) terminal and
the negative supply wire to the (-) terminal. (The recom-
mended torque on terminal block screws is 7–10 in-lbs.)
6. Replace and tighten the cover to the transmitter wiring
compartment before applying power.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 21


2.5.2 Intrinsically Safe
An Intrinsically Safe (IS) installation potentially has flam-
mable media present. An approved IS barrier must be
installed in the non-hazardous (safe) area to limit the avail-
able energy out to the hazardous area.
See Agency Drawing – Intrinsically Safe Installation,
Section 3.5.3.
To install Intrinsically Safe wiring:
1. Ensure that the IS barrier is properly installed in the safe
area (refer to local plant or facility procedures). Complete
the wiring from the power supply to the barrier and from
the barrier to the Eclipse transmitter.
2. Remove the cover from the wiring compartment of the
transmitter. Install the conduit plug in the unused opening
and use PTFE tape/sealant to ensure a liquid-tight
connection.
3. Install a conduit fitting and pull the supply wires.
4. Connect shield to an earth ground at power supply.
5. Connect an earth ground wire to the nearest green ground
screw (not shown in illustration).
6. Connect the positive supply wire to the (+) terminal and
the negative supply wire to the (-) terminal. (The recom-
mended torque on terminal block screws is 7–10 in-lbs.
(0.8–1.1 Nm)).
7. Replace and tighten the cover to the wiring compartment
of the transmitter before applying power.

2.5.3 Explosion Proof


Explosion Proof (also referred to as XP or flameproof ) is
another method of designing equipment for installation
into hazardous areas. A hazardous location is an area in
which flammable gases or vapors are (or may be) present
in the air in quantities sufficient to produce explosive or
ignitable mixtures.
The wiring for the transmitter must be contained in
Explosion Proof conduit extending into the safe area.
• Due to the specialized design of the Eclipse transmitter, no
Explosion Proof conduit fitting (EY seal) is required with-
in 18" (46 cm) of the transmitter.
• An Explosion Proof conduit fitting (EY seal) is required
between the hazardous and safe areas. See Agency
Specifications, Section 3.5.

22 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


To install an Explosion Proof transmitter:
1. Install Explosion Proof conduit from the safe area to the
conduit connection of the Eclipse transmitter (refer to
local plant or facility procedures).
2. Remove the cover from the wiring compartment of the
transmitter.
3. Connect shield to an earth ground at the power supply.
4. Connect an earth ground wire to the nearest green ground
screw per local electrical code (not shown in illustration).
5. Connect the positive supply wire to the (+) terminal
and the negative supply wire to the (-) terminal. (The
recommended torque on terminal block screws is
7–10 in-lbs. (0.8–1.1 Nm)).
6. Replace and tighten the cover to the wiring compartment
of the transmitter before applying power.

2.6 Configuration

Although the Eclipse Model 706 transmitter can be deliv-


ered pre-configured from the factory, it can also be easily
reconfigured in the shop or at the installation using the
local LCD/Keypad or PACTware/DTM. Bench configura-
tion provides a convenient and efficient way to set up the
transmitter before going to the tank site to complete the
installation.
Before configuring any transmitter, collect all operating
parameters information (refer to Section 1.1.2).
Apply power to the transmitter and follow the step-by-step
procedures below for the menu-driven transmitter display.
Refer to Sections 2.6.2 and 2.6.4.
Information on configuring the transmitter using a HART
communicator is given in Section 2.7, Configuration
Using HART.
Refer to I/O manuals:
• 57-646 for information on FOUNDATION fieldbus output.
• 57-658 for information on PROFIBUS PA output.
• 41-621 for information on Modbus output.

2.6.1 Bench Configuration


The Eclipse Model 706 transmitter can be easily config-
ured at a test bench by connecting a standard 24 VDC
power supply directly to the transmitter terminals as
shown in the accompanying diagram. An optional digital
multimeter is shown in the event that mA current mea-
surements are desired.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 23


NOTE: Current measurements taken at these test points are an
approximate value. Accurate current readings should be
taken with the digital multimeter directly in series with the
loop.

NOTE: When using a HART communicator for configuration, a mini-


mum 250-ohm line load resistance is required. Refer to your
(-) negative
(+) positive
HART communicator manual for additional information.
+
Test

Current Meter NOTE: The transmitter can be configured without the probe.
Disregard the “No Probe” diagnostic indicator that will appear.
+
Power Supply
24 VDC 2.6.2 Menu Traversal and Data Entry

The four push buttons offer various forms of functionality
for navigation and data entry.
The Model 706 user interface is hierarchical in nature,
best described as a tree structure. Each level in the tree
G.P./I.S./Explosion Proof Model
contains one or more items. Items are either menu labels
or parameter names.
• Menu labels are presented in all capital letters
• Parameters are capital words

2.6.2.1 Navigating the Menu


UP moves to the previous item in the menu branch.


DOWN moves to the next item in the menu branch.



BACK moves back one level to the previous (higher)
branch item.
➪ ENTER enters into the lower level branch or switches
to the entry mode. Holding the ENTER down on any
highlighted menu name or parameter will show help
text for that item.

2.6.2.2 Data Selection


This method is used for selecting configuration data from
a specific list.

UP and DOWN to navigate the menu and high-


Up Down Back Enter light the item of interest.
➪ ENTER allows modification of that selection.

UP and DOWN to choose new data selection.


➪ ENTER to confirm selection.

Use BACK (Escape) key at any time to abort the pro-
cedure and escape to previous branch item.

24 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.6.2.3 Entering Numeric Data Using Digit Entry
This method is used to input numeric data, e.g., Probe
Length, set 4mA and set 20mA.
Push button Keystroke Action
Moves up to the next highest digit (0,1,2,3,....,9
Up or decimal point). If held down the digits scroll
until the push button is released.
Moves up to the next lowest digit (0,1,2,3,....,9 or
Down decimal point). If held down the digits scroll until
the push button is released.
Moves the cursor to the left and deletes a digit. If
the cursor is already at the leftmost position,
Back
then the screen is exited without changing the
previously saved value.
Moves the cursor to the right. If the cursor is
Enter located at a blank character position, the new
value is saved.

All numeric values are left-justified, and new values are


entered from left to right. A decimal point can be
entered after the first digit is entered, such that .9 is
entered as 0.9.
Some configuration parameters can have a negative
value. In this case, the leftmost position is reversed for
the sign (either "-" for a negative value, or "+" for a pos-
itive value).

2.6.2.4 Entering Numeric Data Using Increment/Decrement


Use this method to input the following data into para-
meters such as Damping and Failure Alarm.

Push button Keystroke Action


Increments the displayed value. If held down
the digits scroll until the push button is released.
Up Depending on which screen is being revised, the
increment amount may increase by a factor of 10
after the value has been incremented 10 times.
Decrements the displayed value. If held down the
digits scroll until the push button is released.
Depending on which screen is being revised, the
Down
decrement amount may increase by a factor of
10 after the value has been decremented 10
times.
Returns to the previous menu without changing
Back the original value, which is immediately redis-
played.
Accepts the displayed value and returns to the
Enter
previous menu.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 25


2.6.2.5 Entering Character Data
This method is used for parameters requiring alphanumeric
character entry, such as for entering tags, etc.
General Menu Notes:

Push button Keystroke Action


Moves to the previous character (Z...Y...X...W).
Up If held down, the characters scroll until the push
button is released.
Moves to the next item character (A...B...C...D).
Down If held down, the characters scroll until the push
button is released.
Moves the cursor back to the left. If the cursor is
already at the leftmost position, then the screen
Back
is exited without changing the original tag char-
acters.
Moves the cursor forward to the right. If the
Enter cursor is at the rightmost position, then the
new tag is saved.

2.6.3 Password Protection


The Eclipse Model 706 transmitter has three levels of pass-
word protection to restrict access to certain portions of the
menu structure that affect the operation of the system. The
user password can be changed to any numerical value up to
59999. When the transmitter is programmed for
password protection, a password is required whenever
configuration values are changed.
User Password
The User Password allows the customer to limit access to
the basic configuration parameters.
The default User Password installed in the transmitter at
the factory is 0. With a password of 0, the transmitter is no
longer password protected and any value in the basic user
menus can be adjusted without entering a confirming
password.

NOTE: If a User Password is not known or has been misplaced, the


menu item New Password in the DEVICE SETUP/ADVANCED
CONFIG menu displays an encrypted value representing the
present password. Contact Technical Support with this
encrypted password to retrieve the original User Password.

26 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


Advanced Password
Certain portions of the menu structure that contain more
advanced parameters are further protected by an Advanced
Password.
This password will be provided, when necessary, by Factory
technical support.
Factory Password
Calibration-related and other factory settings are further
protected by a Factory Password.

2.6.4 Model 706 Menu: Step-By-Step Procedure


The following tables provide a complete explanation of the
software menus displayed by the Eclipse transmitter. The
menu layout is similar between the local Keypad/LCD
interface, the DD, and the DTM.
Use these tables as a step-by-step guide to configure the
transmitter based on the desired measurement type from the
following selections:
• Level Only
• Interface & Level
• Interface & Volume
• Level & Volume
• Flow
HOME SCREEN
The Home Screen consists of a “slide show” sequence of
Measured Values screens which are rotated at 2-second
intervals. Each Home Measured Value screen can present up
to four information items:
• HART® Tag
• Measured Value
Label, Numerical Value, Units
• Status
Will be displayed as text or optionally with NAMUR NE
107 symbol
Up Down Back Enter • Primary Value Bar Graph (shown in %)
The Home Screen presentation can be customized by view-
ing or hiding some of these items. See DISPLAY CONFIG
under the DEVICE SETUP menu in Section 2.6.5 —
Configuration Menu.
At left is an example of a Home Screen for a Model 706
configured for a Level Only application.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 27


MAIN MENU
Pressing any key on the Home Screen will present the Main
Menu, consisting of three basic menu labels shown in all
capital letters.
• DEVICE SETUP
• DIAGNOSTICS
• MEASURED VALUES
As shown, the reverse video represents a cursor identifying
the selected item, which will appear in reverse video on the
LCD. The actions of the keys at this point are:
Push button Keystroke Action

Up
No action as the cursor is already at the first
item in the MAIN MENU
Down Moves the cursor to DIAGNOSTICS

Back
Moves back to HOME SCREEN, the level
above MAIN MENU
Enter Presents the selected item, DEVICE SETUP

NOTES: 1. Items and parameters that are shown in lower level menus
will depend on the Measurement Type chosen. Those para-
meter not applicable to the present Measurement Type will
be hidden.
2. Holding down the Enter key when the cursor is highlighted
over a parameter or menu will provide additional information
about that item.

DEVICE SETUP
Choosing DEVICE SETUP from the MAIN MENU will
result in an LCD presentation as shown at left.
The small down arrow shown at the right hand side of the
screen is the indication that more items are available below
and can be accessed by pressing the DOWN key.
Section 2.6.5 shows the entire tree menu for the Model 706
DEVICE SETUP Menu.

DIAGNOSTICS
Refer to Section 3.3.4

MEASURED VALUES
Allows the user to scroll through all of the available
measured values for the measurement type chosen.

28 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.6.5 Model 706 Configuration Menu — Device Setup
Home Screen

Main Menu

Device Setup Quick Start Level Units: Probe Length:


Identity Inches 12 inches to 100 feet
Basic Config Feet (30 cm to 30 m)
I/O Config Millimeters
Display Config Centimeters Level Offset:
Advanced Config Meters -25 feet to +75 feet
Factory Config (-7.6 m to 22.9 m)
705 Adapter:
Yes Dielectric Range:
No Below 1.7
1.7 to 3.0
Probe Model: 3.0 to 10
7YD Coax HTHP Above 10
7YF Sngl Rod Tanks
7YG Sngl Rod Cages Lower Range Value:
7YJ Sngl Rod Cages -25 to +175 feet
7YL Sngl Rod Cages ([Upr] Level, Ifc Level)
7YM Sngl Rod Tanks (-7.6 m to 53 m)
7YN Sngl Rod Tanks 2.0 inches to 100 feet
7YP Coax HP (Upr Thickness) (5 cm to 30 m)
7YS Coax Steam
0 to 9999999 gals (Volume)
7YT Coax Std
7Y1 Sngl Flex Std 0 to 9999999 cubic ft/min
7Y2 Sngl Flex Bulk (Flow)
7Y3 Sngl Flex HP
7Y5 Twin Flex Bulk Upper Range Value:
7Y6 Sngl Flx HTHP Cage -25 to +175 feet
7Y7 Twin Flex Clad ([Upr] Level, Ifc Level)
Home Screen (-7.6 m to 53 m)
Main Menu Probe Mount: 2.0 inches to 100 feet
NPT (Upr Thickness) (5 cm to 30 m)
Device Setup Quick Start BSP 0 to 9999999 cf (Volume)
Identity Product Name (read only) Flange 0 to 9999999 cfs (Flow)
Magnetrol S/N (read only) NPT/Flushing
Hardware Version (read only) BSP/Flushing Failure Alarm:
Firmware Version (read only) Flange/Flushing 22 mA
LongTag Hygienic 3.6 mA
Hold

Basic Config Measurement Type:


I/O Config Level Only Level Units: Probe Coating: (7yF only)
Display Config Interface and Level Inches None (Bare)
Advanced Config Interface and Volume Feet PFA Coated
Factory Config Volume and Level Millimeters
Flow Centimeters Probe Mount:
Meters NPT
BSP
705 Adapter: Flange
Yes NPT/Flushing
No BSP/Flushing
Flange/Flushing
Probe Model (Adapter=Yes): Hygienic
7XA
7XB Probe Length:
12 inches to 100 feet
Probe Model (Adapter=No): (30 cm to 30 m)
7YD Coax HTHP
7YF Sngl Rod Std Level Offset:
7YG Sngl Rod Std -25 feet to +75 feet
7YJ Sngl Rod HTHP (-7.6 m to 22.9 m)
7YL Sngl Rod HP
7YM Sngl Rod HP Dielectric Range:
7YN Sngl Rod HTHP Below 1.7
7YP Coax HP 1.7 to 3.0
7YS Coax Steam 3.0 to 10
7YT Coax Std Above 10
7Y1 Sngl Flex Std
7Y2 Sngl Flex Bulk
7Y3 Sngl Flex HP
7Y5 Twin Flex Bulk
7Y6 Sngl Flx HTHP Cage
7Y7 Twin Flex Clad

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 29


2.6.5 Model 706 Configuration Menu — Device Setup
Home Screen

Main Menu

Device Setup Quick Start


Identity
Basic Config Measurement Type:
I/O Config Level Only
Display Config Interface and Level Level Units: Probe Coating: (7yF only)
Advanced Config Interface and Volume Inches None (Bare)
Factory Config Volume and Level Feet PFA Coated
Flow Millimeters
Centimeters Probe Mount:
Meters NPT
BSP
705 Adapter: Flange
Yes NPT/Flushing
No BSP/Flushing
Flange/Flushing
Probe Model (Adapter=Yes): Hygienic
7XA
7XB Probe Length:
12 inches to 100 feet
Probe Model (Adapter=No): (30 cm to 30 m)
7YD Coax HTHP
7YF Sngl Rod Tanks Level Offset:
7YG Sngl Rod Cages -25 feet to +75 feet
7YJ Sngl Rod Cages (-7.6 m to 22.9 m)
7YL Sngl Rod Cages
7YM Sngl Rod Tanks Dielectric Range:
7YN Sngl Rod Tanks Below 1.7
Home Screen 7YP Coax HP 1.7 to 3.0
7YS Coax Steam 3.0 to 10
Main Menu 7YT Coax Std Above 10
7Y1 Sngl Flex Std
Device Setup Quick Start 7Y2 Sngl Flex Bulk Upr Dielectric:
7Y3 Sngl Flex HP 1.2 to 10
Identity Measurement Type:
Basic Config 7Y5 Twin Flex Bulk
Level Only
I/O Config 7Y6 Sngl Flx HTHP Cage
Interface and Level
Display Config 7Y7 Twin Flex Clad
Interface and Volume
Advanced Config Volume and Level
Factory Config Flow

Level Units: Probe Coating: (7yF only) Volume Units: Vessel Dimensions:
Inches None (Bare) Cubic Feet (not used with Custom Table)
Feet PFA Coated Cubic Inches Radius
Millimeters Cubic Meters Ellipse Depth
Centimeters Probe Mount: Gallons Conical Height
Meters NPT Milliliters Width
BSP Liters Length
705 Adapter: Barrels
Flange
Yes
NPT/Flushing Custom Table Setup:
No
BSP/Flushing Vessel Type: Custom Table Type:
Probe Model (Adapter=Yes): Flange/Flushing Rectangular Linear
7XA Hygienic Horizontal/Flat Spline
7XB Horizontal/Ellipse
Level Input Source:
Probe Length: Horizontal/Spherical
Probe Model (Adapter=No): 12 inches to 100 feet Spherical Keypad
7YD Coax HTHP Vertical/Flat Sensor
(30 cm to 30 m)
7YF Sngl Rod Std Vertical/Ellipse
CUSTOM TABLE VALUES:
7YG Sngl Rod Std Level Offset: Vertical/Spherical
7YJ Sngl Rod HTHP Vertical/Conical Up to 30 Pairs of
-25 feet to +75 feet
7YL Sngl Rod HP Custom Table Level/Volume Data
(-7.6 m to 22.9 m)
7YM Sngl Rod HP
7YN Sngl Rod HTHP Dielectric Range:
7YP Coax HP Below 1.7
7YS Coax Steam 1.7 to 3.0
7YT Coax Std 3.0 to 10
7Y1 Sngl Flex Std Above 10
7Y2 Sngl Flex Bulk
7Y3 Sngl Flex HP Volume Setup:
7Y5 Twin Flex Bulk
7Y6 Sngl Flx HTHP Cage
7Y7 Twin Flex Clad

30 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.6.5 Model 706 Configuration Menu — Device Setup
Home Screen

Main Menu

Device Setup Quick Start


Identity
Basic Config Measurement Type:
I/O Config Level Only
Display Config Interface and Level
Advanced Config Interface and Volume
Factory Config Volume and Level
Flow

Level Units: Probe Mount: Flow Units: V-notch Weir Maximum Flow
Inches NPT Cubic Ft/Second V-notch Weir Angle: (calculated, read only)
Feet BSP Cubic Ft/Minute 22.5°
Millimeters Flange Cubic Ft/Hour 30° Low Flow Cutoff:
Centimeters NPT/Flushing Gallons/Minute 45° 0 to 9999999 cubic
Meters BSP/Flushing Gallons/Hour 60° ft/min
Flange/Flushing Mil Gallons/Day 90°
705 Adapter: Hygienic Liters/Second 120° TOTALIZER SETUP:
Yes Liters/Minute Units:
No Probe Coating: Liters/Hour Rect Weir with Ends Cubic Feet
None (Bare) Cubic Meters/Hour 0 to 215.0 feet Gallons
Probe Model (Adapter=Yes): PFA Coated (0 to 65 m) Mil Gallons
7XA Flow Element: Liters
7XB Probe Length: Palmer-Bowlus Flume Rect Weir w/o Ends Mil Liters
12 inches to 100 feet Flume Channel Width: 0 to 215.0 feet Cubic Meters
Probe Model (Adapter=No): (30 cm to 30 m) 4 inches (0 to 65 m)
7YD Coax HTHP 6 inches NON-RESET
7YF Sngl Rod Std Level Offset: 8 inches Cipolletti Weir TOTALIZER:
7YG Sngl Rod Std -25 feet to +75 feet 10 inches 0 to 215.0 feet Multiplier:
7YJ Sngl Rod HTHP (-7.6 m to 22.9 m) 12 inches (0 to 65 m) 1
7YL Sngl Rod HP 15 inches 10
7YM Sngl Rod HP Dielectric Range: 18 inches Generic Equation 100
7YN Sngl Rod HTHP Below 1.7 21 inches K 1,000
7YP Coax HP 1.7 to 3.0 24 inches L 10,000
7YS Coax Steam 3.0 to 10 27 inches C 100,000
7YT Coax Std Above 10 30 inches n
7Y1 Sngl Flex Std Value (read only)
7Y2 Sngl Flex Bulk Flow Setup: Parshall Flume Custom Table RunTime (read only)
7Y3 Sngl Flex HP Flume Channel Width: Custom Table Type:
7Y5 Twin Flex Bulk 1 inch Linear RESETTABLE
7Y6 Sngl Flx HTHP Cage 2 inches Spline TOTALIZER:
7Y7 Twin Flex Clad 3 inches Mode:
6 inches CUSTOM TABLE Disabled
9 inches VALUES: Enabled
12 inches Up to 30 Pairs of
18 inches Head/Flow Data Multiplier:
24 inches 1
36 inches Reference Distance: 10
48 inches 11.8 inches to 100 feet 100
60 inches (30 cm to 30 m) 1,000
72 inches 10,000
96 inches Maximum Head 100,000
120 inches The Maximum Head
144 inches value can be revised Value (read only)
depending on the value RunTime (read only)
of the Reference
Distance, or for end user Reset
preference.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 31


2.6.5 Model 706 Configuration Menu — Device Setup
Home Screen

Main Menu

Device Setup Quick Start


Identity
Basic Config
I/O Config Primary Variable

Lower Range Value:


-25 to +175 feet ([Upr] Level, Ifc Level) (-7.6 m to 53 m)
2.0 inches to 100 feet (Upr Thickness) (5 cm to 30 m)
0 to 9999999 gals (Volume)
0 to 9999999 cubic ft/min (Flow)

Upper Range Value:


-25 to +175 feet ([Upr] Level, Ifc Level) (-7.6 m to 53 m)
2.0 inches to 100 feet (Upr Thickness) (5 cm to 30 m)
0 to 9999999 cf (Volume)
0 to 9999999 cfs (Flow)

Analog Alarm Selection:


22 mA
3.6 mA
Hold

Damping:
0 to 10 seconds

Variable Selection:
SV
TV
QV

Display Config Language: Volume: Upr Echo Strength:


Advanced Config English (Volume and Level mode only) (Interface and level mode only)
Factory Config French Hide Hide
German View View
Spanish
Russian Flow: Ifc Echo Strength:
Polish (Flow mode only) (Interface and level mode only)
Portuguese Hide Hide
View View
Status Symbol:
Hide Head: Elec Temp:
View (Flow mode only) Hide
Hide View
Long Tag: View
Hide Probe Buildup:
View Distance: (Buildup Detection = On)
Hide Hide
PV Bar Graph: View View
Hide
View % Output:
Hide
Level: View
Hide
View Analog Output:
Hide
Ifc Level: View
(Interface and Level mode only)
Hide NRTotalizer:
View (Flow mode only)
Hide
Upr Thickness: View
(Interface and Level mode only)
Hide R Totalizer:
View (Flow mode only)
Hide
View

32 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.6.5 Model 706 Configuration Menu — Device Setup
Home Screen

Main Menu

Device Setup Quick Start


Identity
Basic Config
I/O Config
Display Config
Advanced Config
Factory Config

Sensitivity: Auto Upper Limit: Max. Level Jump


0 to 100 echo strength units (used when Lvl Thresh Mode is
Auto Upper) HF Cable Length:
Blocking Distance: Integral
-7.5 to +100 feet Ifc Lvl Thresh Mode: 3 feet
(-2 m to 30 m) (Interface and Level only) 12 feet
Auto Largest
Safety Zone Alarm: Fixed Value Buildup Detection:
None Off
3.6 mA Ifc Lvl Thresh Value: On
22 mA (Interface and Level only)
Latched 3.6 mA 0 to 100 echo strength units LEVEL TABLE SETUP:
Latched 22 mA Level Table Mode:
EoP Thresh Mode: Disabled
Safety Zone Height: Auto Largest Enabled
(not used when Safety Alarm is Fixed Value
None) ANALOG OUTPUT:
2 inches to 100 feet EoP Thresh Value: HART Poll Address:
(5 cm to 30 m) 0 to 100 echo strength units 0 to 63

Reset SZ Alarm ENDofPROBE ANALYSIS: Analog Output Mode:


(used when Safety Alarm is Latch EoP Polarity: Disabled (Fixed)
3.6 mA or Latch 22 mA) Positive Enabled (PV)
Negative [Fixed Current Value]
Failure Alarm Delay: 4 to 20 mA
0 to 5 seconds EoP Analysis:
(not used with Interface and Level) ADJUST ANALOG
Level Trim: Off OUTPUT:
-2.00 to + 2.00 feet On Adjust 4mA
(-0.6 m to + 0.6 m) Adjust 20mA
EoP Dielectric:
THRESHOLD SETTINGS (not used with Interface and Level) New User Password:
Lvl Thresh Mode: 1.20 to 9.99 0 to 59,999
Auto Largest
(not used with Interface and Level) ECHO REJECTION: CONFIG CHANGED:
Fixed Value View Echo Curve Indicator Mode:
Auto Upper Disabled
Sloped REJECTION CONTROL: Enabled
Reject Curve State:
Lvl Thresh Value: Off Reset Config Chngd:
0 to 100 echo strength units Disabled Reset?
Sloped Start Value [Enabled] No
(used when Lvl Thresh Mode is Yes
Sloped) Reject Curve Mode:
0 to 100 echo strength units Level Reset Parameters:
Distance No
Sloped Start Value: Yes
(used when Lvl Thresh Mode is Saved Medium
Sloped)
NEW REJECT CURVE:
Sloped Start Distance: Actual Medium
(used when Lvl Thresh Mode is Save Reject Curve
Sloped)
Compensation:
Sloped End Dist: None
(used when Lvl Thresh Mode is Auto
Sloped) Manual
25 to 100 feet
(7 to 30 m) Vapor Dielectric:
1.00 to 2.00

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 33


2.6.5 Model 706 Configuration Menu — Device Setup
Home Screen

Main Menu

Device Setup Quick Start


Identity
Basic Config
I/O Config
Display Config
Advanced Config
Factory Config Fiducial Gain:
0 to 255 (read only)

Fid Threshold Value

SZ Hysteresis (Safe Zone Hysteresis):


(not used when Safe Zone Alarm is None)
0 to 100 feet
(0 to 30 m)

Ifc Boundary Offset

Seal to SRP Trim

NAP Value

Factory Reset

FACTORY CALIB
(Factory password required)
Elec Temp Offset
Window
Fiducial Ticks
Conversion Factor
Scale Offset

34 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.7 Configuration Using HART

A HART (Highway Addressable Remote Transducer)


remote unit, such as a HART communicator, can be used to
provide a communication link to the Eclipse Model 706
transmitter. When connected to the control loop, the same
system measurement readings shown on the transmitter are
also shown on the communicator. The communicator can
also be used to configure the transmitter.
The HART communicator may need to be updated to
include the Eclipse Model 706 software (Device
Junction
Descriptions). Refer to your HART Communicator Manual
for update instructions.
One can also access configuration parameters using
RL > 250 Ω
- + PACTware and the Model 706 DTM, or using the AMS
with EDDL.

2.7.1 Connections
Control
Room A HART communicator can be operated from a remote
Display
Power location by connecting it to a remote junction or by con-
Supply necting it directly to the terminal block in the wiring com-
partment of the Eclipse transmitter.
Current
Meter HART uses the Bell 202 frequency shift keying technique
of high-frequency digital signals. It operates on the 4–20
mA loop and requires 250 Ω load resistance. A typical con-
nection between a communicator and the Eclipse transmit-
ter is shown at left.

2.7.2 HART Communicator Display


A typical communicator display is an 8-line by 21-character
LCD. When connected, the top line of each menu displays
the model (Model 706) and its tag number or address. For
detailed operating information, refer to the instruction
manual provided with the HART communicator.

2.7.3 HART Revision Table


Model 706 1.x
HART Version HCF Release Date Compatible with 706 Software
Dev Rev 2, DD Rev 1 August 2019 Version 1.1d and later

2.7.4 HART Menu – Model 706


The Eclipse transmitter HART menu trees are shown in the
following pages. Open the menu by pressing the alphanu-
meric key 4, then Device Setup, to display the
second-level menu.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 35


2.7.4 HART Menu – Model 706
1 PV
2 PV Loop Current
3 PV % Range
4 Device Setup 1 Identity 1 Enter Password
5 Setup Wizard 2 Tag
6 Diagnostics 3 Long Tag
7 Measured Values 4 Descriptor
5 Date
1 Level 6 Message
2 Ifc Level 7 Date/Time/Initials
3 Upr Thickness 8 Factory Identity 1 Manufacturer
4 Volume 2 Product Name
5 Flow 2 Basic Config 1 Enter Password 3 Magnetrol S/N
6 Head 2 Level Units 4 Hardware Version
7 Distance 3 705 Adapter 5 Firmware Version
8 R Totalizer Value 4 Probe Model 6 ConfigChg Counter
9 NR Totalizer Value 5 Probe Coating 7 Final Assy Number
10 Echo Strength 6 Probe Mount 8 Device ID
11 Ifc Echo Strength 7 Probe Length 9 Universal Revision
12 Buildup 8 Measurement Type 10 Field Device Revision
13 Temperature 9 Level Offset 11 Software Revision
10 Dielectric Range 12 Num Preambles
11 Upper Dielectric
12 Basic Config Diagram

3 Volume Config 1 Enter Password


2 Volume Units
3 Vessel Type
4 Length
5 Width
6 Radius
7 Ellipse Depth
8 Conical Height
9 Table Type
10 Vessel Diagrams
11 Custom Table Type
12 Level Input Source 1 Enter Password
13 Custom Table Length 2 Flow Units
14 Custom Table 3 Flow Element
4 Flume Channel Width
4 Flow Config
5 V-Notch Angle
6 Crest Length
7 Custom Table Type
8 Reference Distance
9 Maximum Head
10 Maximum Flow
11 Low Flow Cutoff
12 General Equation
Factors 1 K
1 Enter Password 13 Flow Diagrams 2 L
5 I/O Config
2 PV is 14 Custom Table 3 C
3 Upper Range Value 15 Totalizer Setup 4 n
6 Local Display Config
7 Advanced Config 4 Lower Range Value
5 Analog Alarm Selection 1 Totalizer Units
8 Factory Config
6 Damping 2 NR Mult
7 I/O Config Diagram 3 NR Totalizer Value
8 Variable Selection 1 SV is 4 NR Totalizer RunTime
9 Graph Ranges 2 TV is 5 R Totalizer Mode
3 QV is 6 R Totalizer Mult
7 R Totalizer Value
8 R Totalizer RunTime
1 Lvl 4mA Set Point 9 Totalizer
2 Lvl 20mA Set Point
3 Ifc 4mA Set Point
4 Ifc 20mA Set Point
5 Thk 4mA Set Point
6 Thk 20mA Set Point
7 Vol 4mA Set Point
8 Vol 20mA Set Point
9 Flo 4mA Set Point
10 Flo 20mA Set Point

36 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.7.4 HART Menu – Model 706
1 Identity
2 Basic Config
3 Volume Config
4 Flow Config
5 I/O Config

6 Local Display
Config 1 Enter Password
1 Safety Zone Alarm
2 Language
2 Safety Zone Height
3 Status Symbol
3 Reset SZ Alarm
4 Long Tag
5 PV Bar Graph
6 Display Setup Diagram
1 Level Threshold Mode
7 Measured Values
2 Level Threshold Value
3 Sloped Start Value
4 Sloped Start Distance
5 Sloped End Distance
6 Interface Level Threshold Mode
7 Interface Level Threshold Value
7 Advanced Config 1 Enter Password
8 EOP Threshold Mode
2 Sensitivity
9 EOP Threshold Value
3 Blocking Distance
4 Safety Zone Settings
5 Failure Alarm Delay 1 Reject Curve State
6 Level Trim 2 Reject Curve Mode
7 Adv Config Diagram 3 Saved Media Location
8 Threshold Settings 4 New Rejection Curve
9 Echo Rejection
10 End-of-Probe Settings
11 Compensation
12 Max Level Jump 1 EOP Polarity
13 HF Cable Length 2 EOP Analysis
14 Buildup Detection 3 EOP Dielectric
15 Level Table Setup
16 Analog Output
17 New User Password 1 Compensation Mode
18 Reset Paramaters 2 Vapor Dielectric

1 Poll Address
2 Loop Current
3 Fixed Loop Current
4 Adjust Analog Output
5 4mA Trim Value
6 20mA Trim Value
7 Fdbk 4mA Trim Value
8 Fdbk 20mA Trim Value

8 Factory Config 1 Enter Password


2 Fiducial Gain
3 Fid Thresh Value
4 Seal to SRP Trim
5 Probe Target 1 Probe Target Mode
6 Ifc Boundary Offset 2 Target Calib Dist
7 NAPValue 3 Target Calib Ticks
8 Factory Reset 4 Target Ticks
9 Factory Param 3 5 Auto Target Calib
10 Factory Param 4
11 Factory Param 6
12 Factory Calib 1 Elec Temp Offset
2 Window
3 Fiducial Ticks
4 Conversion Factor
5 Scale Offset
6 Magnetrol Serial Number

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 37


2.7.4 HART Menu – Model 706
1 PV
2 PV Loop Current
3 PV % Range
4 Device Setup
5 Setup Wizard
6 Diagnostics 1 Present Status 1 NE107 Category
7 Measured Values 2 NE107 Highest Active Indicator
3 Add’l Device Status 1 Status 0
4 Reset Config Changed 2 Status 1
5 NAMUR NE 107 Setup 3 Status 2
6 NE 107 Simulation Mode 4 Status 3
7 Enter Password 5 Status 4
6 Status 5

1 NE 107 Mapping
2 Reset NE 107 Mapping

2 Event History 1 Event Log


2 Refresh History
3 Reset History
4 Set Clock

3 Advanced 1 Internal Values 1 Fiducial Ticks


Diagnostics 2 Elec Temperatures 2 Fiducial Strength
3 Transmitter Tests 3 Level Ticks
4 Echo Curves 4 Probe Buildup 4 Echo Strength
5 Echo History 5 Distance
6 Trend Data 6 Ifc Ticks
7 Ifc Echo Strength
8 Ifc Boundary
9 Ifc Medium
10 Targ Calib Ticks
11 Target Ticks
12 Target Strength
13 Vapor Measured Diel
14 EoP Ticks
15 EoP Strength
16 EoP Distance
17 EoP Apparent Diel
18 Fdbk Current

1 Present Temperature
2 Max Temperature
3 Min Temperature
4 Reset Min/Max Temps

1 Analog OutputTest

1 Percent of Level Threshold


2 Buildup Location
3 Buildup Rate
4 Check

38 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


2.7.4 HART Menu – Model 706
1 PV
2 PV Loop Current
3 PV % Range
4 Device Setup
5 Setup Wizard
6 Diagnostics 1 Present Status
7 Measured Values 2 Event History
3 Advanced
Diagnostics
4 Echo Curves 1 Echo Graph
2 Curve 1
3 Curve 2
4 Refresh Graph
5 Zoom
6 Save Ref Echo Curve
7 New Rejection Curve
8 Parameters 1 Enter Password
2 Dielectric Range
3 Sensitivity
4 Blocking Distance
5 Lvl Thresh Mode
6 Sloped Start Value
7 Lvl Thresh Value
8 Sloped End Distance
9 Ifc Lvl Thresh Value
10 EoP Thresh Value

5 Echo History 1 Echo Graph


2 Curve 1
3 Curve 2
4 Refresh Graph
5 Zoom
6 Echo History Log
7 Refresh History
8 History Setup 1 Echo History Mode
9 Delete History 2 Trigger Events
10 Set Clock 3 Time Triggers
4 Set Clock
5 Enter Password

6 Trend Data 1 Trend Data


2 Level
3 Ifc Level
4 Upr Thickness
5 Volume
6 Flow
7 Loop
8 Range
9 Analog Output
10 % Output
11 Echo Strength
12 Ifc Echo Strength
13 Data Log Setup 1 Trending Variables
2 Time Setup
3 Set Clock
4 Enter Password

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 39


3.0 Reference Information
This section presents an overview of the operation of the
Eclipse Model 706 Guided Wave Radar Level Transmitter,
information on troubleshooting common problems, listings
of agency approvals, lists of replacement and recommended
spare parts, and detailed physical, functional, and perfor-
mance specifications.

3.1 Transmitter Description

The Eclipse Model 706 is a loop-powered two-wire,


24 VDC, level transmitter based on the concept of Guided
Wave Radar.
The Eclipse Model 706 electronics are housed in an
ergonomic housing comprised of two tandem compartments
angled at a 45-degree angle for ease of wiring and calibra-
tion. These two compartments connect via a watertight
feedthrough.

3.2 Theory of Operation


3.2.1 Guided Wave Radar
24 VDC, 4-20 mA
Loop Powered
Guided Wave Radar (GWR) combines Time Domain
Reflectometry (TDR), Equivalent Time Sampling (ETS)
and modern low power circuitry. This synthesis of technolo-
gies brings to the level market a high-speed radar circuit
Transmit Pulse (speed of light transmission). The electromagnetic pulses are
propagated via a waveguide that yields a system many times
A reflection is
developed off the
liquid surface
more efficient than through-air radar.
Air εr = 1
3.2.2 Time Domain Reflectometry (TDR)
TDR uses pulses of electromagnetic (EM) energy to mea-
Media ε r > 1.4
A small amount of energy
sure distances or levels. When a pulse reaches a dielectric
continues down the probe
in a low dielectric fluid, discontinuity (created by the surface of a process medium),
e.g. hydrocarbon
part of the energy is reflected. The larger the dielectric
discontinuity, the larger the amplitude (strength) of the
reflection.
Although TDR is relatively new to the industrial level mea-
surement industry, it has been used for decades in the tele-
phone, computer, and power transmission industries. In
these industries, TDR is used to successfully find wire or
cable breaks and shorts. An EM pulse is sent through the
wire, traveling unimpeded until it finds line damage due
to a break or short. A reflection is then returned from the
damaged area of the wire, enabling a timing circuit to
pinpoint the location.

40 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


In the Eclipse transmitter, a waveguide with a characteristic
impedance in air is used as a probe. When part of the probe
is immersed in a material other than air, there is lower
impedance due to the fact that a liquid will have a higher
dielectric constant than air. When an EM pulse is sent
down the probe and meets the dielectric discontinuity that
occurs at the air/liquid surface, a reflection is generated.

3.2.3 Equivalent Time Sampling (ETS)


ETS (Equivalent Time Sampling) is used to measure the
high speed, low power EM energy. ETS is a critical key in
the application of TDR to vessel level measurement tech-
nology. The high speed EM energy (1000 ft/s (305 m/s)) is
difficult to measure over short distances and at the resolu-
tion required in the process industry. ETS captures the EM
signals in real time (nanoseconds) and reconstructs them in
equivalent time (milliseconds), which is much easier to
measure with today’s technology.
ETS is accomplished by scanning the waveguide to collect
thousands of samples. Approximately five scans are taken
per second; each scan gathers more than 50,000 samples.

3.2.4 Interface Detection


The Eclipse Model 706, when used with the appropriate
probes, is a transmitter capable of measuring both an upper
level and an interface level. It is required that the upper
liquid have a dielectric constant between 1.4 and 10 and the
Reference two liquids have a difference in dielectric constants greater
Signal
than 10. A typical application would be oil over water, with
the upper layer of oil being non-conductive with a dielectric
Air
(ε = 1)
constant of approximately 2 and the lower layer of water
being very conductive with a dielectric constant of approxi-
mately 80. This interface measurement can only be accom-
Upper Level
Low Dielectric plished when the dielectric constant of the upper medium is
Medium
Signal
(e.g. oil, ε = 2)
lower than the dielectric constant of the lower medium.
Interface
Level Emulsion Layer
As mentioned above Eclipse Guided Wave Radar is based
Signal
upon the technology of TDR, which utilizes pulses of elec-
High Dielectric
Medium
tromagnetic energy transmitted down a wave guide (probe).
(e.g. water, ε = 80) When the transmitted pulse reaches a liquid surface that has
Time a higher dielectric constant than the air (dielectric constant
of 1) in which it is traveling, the pulse is reflected and ultra
Interface Detection
high speed timing circuitry provides an accurate measure of
liquid level. Even after some of the pulse is reflected from
the upper surface, energy continues down the length of the
probe through the upper liquid. The pulse is again reflected
when it reaches the higher dielectric lower liquid (refer to
figure at left). Since the propagation speed of the signal
through the upper liquid is dependent on the dielectric

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 41


constant of the medium in which it is traveling, the dielectric
constant of the upper liquid must be known to accurately
determine the interface level.
The thickness of the upper layer can be determined by
knowing the time between the first and second reflections
as well as the upper layer dielectric constant.
In order to properly process the reflected signals, the
Model 706 is specified for those applications where the
thickness of the upper layer is greater than 2 inches (5 cm).
The maximum upper layer is typically limited to the length
of the probe.
Emulsion Layers
As emulsion (rag) layers can decrease the strength of the
reflected signal, GWR offers best performance in applica-
tions having clean, distinct layers. However, the Eclipse
Model 706 transmitter will operate in most emulsions and
tend to read the top of the emulsion layer. Contact the
factory for application assistance and questions regarding
emulsion layers.

3.2.5 Saturated Steam Applications


(Boilers, Feedwater Heaters, etc.)
As the temperature of a saturated steam application
increases, the dielectric constant of the steam vapor space
also increases. This increase in vapor space dielectric causes
a delay in the GWR signal propagation as it travels down
the probe, causing the liquid level to appear lower than
actual.

NOTE: The measurement error associated with this propagation delay


does depend on temperature and is a function of the square
root of the vapor space dielectric constant. For example, with
no compensation, a +450 °F (+230 °C) application would show
a level error of about 5.5%, while a +600 °F (+315 °C) applica-
tion would show an error approaching 20%!

The Eclipse Model 706 transmitter and Model 7yS Coaxial


Steam probe provide a unique solution to this application.
The effects of the changing steam conditions can be com-
pensated for by utilizing a mechanical steam
target placed inside and near the top of the Model 7yS
coaxial probe.
Knowing exactly where the target is located at room tem-
perature, and then continuously monitoring its apparent
location, the vapor space dielectric can be back-calculated.
Knowing the vapor space dielectric, accurate compensation
of the actual liquid level reading is accomplished.

42 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


This is a patented technique with two US Patents
(US 6642801 and US 6867729) issued for both the
mechanical target concept and the associated software
algorithm.
Contact the factory for additional information relating to
saturated steam applications.

3.2.6 Overfill Capability


Although agencies like WHG or VLAREM certify Overfill
proof protection, defined as the tested, reliable operation
when the transmitter is used as overfill alarm, it is assumed
in their analysis that the installation is designed in such a
way that the vessel or side mounted cage cannot physically
overfill.
However, there are practical applications where a GWR
probe can be completely flooded with level all the way up
to the process connection (face of the flange). Although the
affected areas are application dependent, typical GWR
probes have a transition zone (or possibly dead zone) at the
top of the probe where interacting signals can either affect
the linearity of the measurement or, more dramatically,
result in a complete loss of signal.
While some manufacturers of GWR transmitters may use
special algorithms to “infer” level measurement when this
undesirable signal interaction occurs and the actual level
signal is lost, the Eclipse Model 706 offers a unique solution
by utilizing a concept called Overfill-Safe Operation.
An Overfill-safe probe is defined by the fact that it has a
predictable and uniform characteristic impedance all the
way down the entire length of the waveguide (probe). These
probes allow the Eclipse Model 706 to measure accurate lev-
els up to the process flange without any non-measurable
zone at the top of the GWR probe.
Overfill-safe GWR probes are unique to Eclipse GWR, and
coaxial probes can be installed at any location on the vessel.
Overfill-safe probes are offered in a variety of coaxial and
caged designs.

3.3 Troubleshooting and Diagnostics

The Eclipse Model 706 transmitter is designed and engi-


neered for trouble-free operation over a wide range of oper-
ating conditions. The transmitter continuously runs a series
of internal self-tests and displays helpful messages on the
large graphic liquid crystal display (LCD) when attention is
required.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 43


The combination of these internal tests and diagnostics
messages offer a valuable proactive method of troubleshoot-
ing. The device not only tells the user what wrong, but also,
and more importantly, offers suggestions on how to solve
the problem.
All of this information can be obtained directly from the
transmitter on the LCD, or remotely by using a HART
communicator or PACTware and the Eclipse Model 706
DTM.
PACTware™ PC Program
The Eclipse Model 706 offers the ability to perform more
advanced diagnostics such as Trending and Echo Curve
analysis using a PACTware DTM. This is a powerful trou-
bleshooting tool that can aid in the resolution of any diag-
nostic indicators that may appear.
Refer to section 4.0 “Advanced Configuration/
Troubleshooting Techniques” for additional information.

3.3.1 Diagnostics (Namur NE 107)


The Eclipse Model 706 transmitter includes an exhaustive
list of Diagnostic Indicators which follow the NAMUR NE
107 guidelines.
NAMUR is an international user association of automation
technology in process industries, whose goal is to promote
the interest of the process industry by pooling experiences
among its member companies. In doing so, this group
promotes international standards for devices, systems, and
technologies.
The objective of NAMUR NE 107 was essentially to make
Red Orange maintenance more efficient by standardizing diagnostics
information from field devices. This was initially integrated
via FOUNDATION fieldbus, but the concept applies regardless
of the communication protocol.
According to the NAMUR NE107 recommendation, "Self
Monitoring and Diagnosis of Field Devices," fieldbus diag-
nostic results should be reliable and viewed in the context of
a given application. The document recommends categorizing
internal diagnostics into four standard status signals:
• Failure
• Function Check
Yellow Blue • Out of Specification
• Maintenance required
These categories are shown by both symbols and colors,
depending on the display capability.

44 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


In essence, this approach ensures that the right diagnostic
information is available to the right person-at the right
time. In addition, it allows diagnostics to be applied, as
most appropriate, for a particular plant application (such as
process control engineering or asset management mainte-
nance). Customer specific mapping of diagnostics to these
categories allows for flexible configuration depending on the
user's requirements.
From an external Model 706 transmitter perspective, diag-
nostic information includes measurement of process condi-
tions, in addition to detection of internal device or system
anomalies.
As mentioned above, the indicators can be assignable (via
the DTM or host system) by the user to any (or none) of
the NAMUR recommended Status Signal categories:
Failure, Function Check, Out of Specification, and
Maintenance Required.
The FOUNDATION fieldbus transmitter version of the
Model 706 was implemented according to the Field
Analog Output Error Diagnostics Profile, which is consistent with the objectives
Failure
of NE 107.
In the FOUNDATION fieldbus version, diagnostic indicators
Function
can be mapped to multiple categories, an example is shown
Check in the diagram at left.

Dry
Echo Lost
Out of
In this example, “Calibration Required” is mapped to both
High
Temperature
Probe Specification the Out of Specification and Maintenance Required status
signals, and the diagnostic indicator named “High
Calibration
Required
Temperature” is mapped to none of the signals.
Maintenance
Required Indicators that are mapped to the Failure category will nor-
mally result in a current loop alarm output. The alarm state
for HART transmitters is configurable as high (22 mA),
Diagnostic Indicators NE-107
Status Signals Low (3.6 mA), or Hold (last value).
Users will not have the ability to unassign certain indicators
from the Failure signal category as the Model 706 user
interfaces will prohibit or reject such re-assignment entries).
This is to ensure that current loop alarms are asserted in situ-
ations where the device is not able to provide measurements
due to critical failures. (For example, if the alarm selection
has not been set to Hold, or a fixed current mode is in
effect.)
A default mapping of all diagnostic indicators will be applied
initially, and can be re-applied through use of a reset function.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 45


Refer to the table below for a complete listing of the
Model 706 diagnostic indicators, along with their explana-
tions, default categories, and recommended remedies.

NOTES: 1) The remedies shown in this table can also be seen on


the transmitter LCD by viewing the present status
screen when the device is in a diagnostic condition.
2) Those indicators showing failure as the default result
in an alarm condition.

3.3.2 Diagnostic Indication Simulation


The DD and DTM allow for the ability to manipulate
diagnostic indicators. Intended as a means to verify the
configuration of the diagnostic parameters and connected
equipment, a user can manually change any indicator to
and from the active state.

3.3.3 Diagnostic Indicator Table


Below is a listing of the Model 706 diagnostic indicators,
showing their priority, explanations and recommended
remedies. (Priority 1 is highest priority.)

Default
Priority Indicator Name Explanation Remedy (Context Sensitive Help)
Category

Software Error
Unrecoverable error occurred in stored
1 Failure
program.
2 RAM Error Failure RAM (read/write) memory failing.

3 ADC Error Failure Analog-to-digital converter failure. Contact Magnetrol Technical Support.

4 EEPROM Error Failure Non-volatile parameter storage failing.

5 Analog Board Error Failure Unrecoverable hardware failure.

Analog Output
Actual loop current deviates from com-
Error
Perform Adjust Analog Output mainte-
6 Failure manded value. Analog output is inaccu-
nance procedure.
rate.
7 Spare Indicator 1 OK Reserved for future use.
Default
Parameters
Saved parameters are set to default val-
8 Perform complete Device Configuration.
ues.
Attach a probe.
Torque HF nut.

No Probe
Clean gold pin on transmitter and socket
9 Failure No Probe Connected. on probe.
Ensure Model 705 adapter is properly
secured.
Contact Magnetrol Technical Support.
Torque HF nut.
Clean gold pin on transmitter and socket
on probe.

No Fiducial
Check settings:
10 Failure Reference signal too weak to detect. Fiducial Gain
HF Cable Length
Window
Increase Fid Gain.
Contact MagnetrolTechnical Support.

46 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.3.3 Diagnostic Indicator Table
Default
Priority Indicator Name Explanation Remedy
Category
Check settings:
Dielectric Range

No Echoes
Sensitivity
11 Failure No signal detected anywhere on probe. EoP Thresh Value
Increase Sensitivity.
Lower EoP Thresh.
View Echo Curve.
Check settings:
Upper Dielectric,

Upr Echo Lost


Blocking Distance,
Signal from upper liquid too weak to
12 Failure Sensitivity
detect.
Ensure Upr Level is below blocking
distance.
View Echo Curve.
13 Spare Indicator 2 OK Reserved for future use.
Check settings:
EoP Above
Probe Length
ProbeEnd
End of Probe appears above Probe
14 Failure Decrease Sensitivity
Length
Increase Blocking Distance
View Echo Curve.
Check settings:

Lvl Below
Probe Model,
Level signal appears beyond Probe
ProbeEnd
Probe Length,
15 Failure Length.
Level Threshold = Fixed
(Possible water bottom situation)
Increase Sensitivity
View Echo Curve.
Check settings:
EoP Below
Probe Length
ProbeEnd
End of Probe appears beyond Probe
16 Failure Dielectric Range
Length.
Sensitivity
View Echo Curve.

Safety Zone Alarm


Risk of echo loss if liquid rises above Ensure that liquid cannot reach
17 Failure
Blocking Distance. Blocking Distance.

Config Conflict
Measurement type and primary variable Confirm proper configuration.
18 Failure
selection parameters are inconsistent. Check Measurement Type.

High Volume Alarm


Volume calculated from Level reading Check settings:
19 Failure exceeds capacity of vessel or custom Vessel Dimensions,
table. Custom Table entries
Check settings:

High Flow Alarm


Flow calculated from Distance reading Flow Element
20 Failure exceeds capacity of flow element or Reference Distance
custom table. Gen Eqn Factors
Custom Table entries
21 Spare Indicator 3 OK Reserved for future use

Initializing
Function Distance measurement is inaccurate Standard start-up message. Wait for up
22
Check while internal filters are settling. to 10 seconds.

Analog Output
Loop current not following PV. May be If unexpected, check Loop Current
Fixed
Function
23 caused by existing alarm condition, Mode. Ensure device is not in Loop
Check
ongoing Loop Test or Trim Loop operations. Test.

Config Changed
Function A parameter has been modified from the If desired, reset Config Changed indica-
24
Check User Interface. tor in ADVANCED CONFIG menu.
25 Spare Indicator 4 OK Reserved for future use.
26 Spare Indicator 5 OK Reserved for future use.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 47


3.3.3 Diagnostic Indicator Table

Default
Priority Indicator Name Explanation Remedy
Category
27 Spare Indicator 6 OK Reserved for future use.

Ramp Interval
Internal signal timing out of limits Check accuracy of Level
Error
28 Out of Spec causing inaccurate distance reading.Replace transmitter electronics.
measurement. Contact Magnetrol Technical Support.

High Elec Temp


Electronics too hot. May compromise Shield transmitter from heat source or
29 Out of Spec level measurement or damage increase air circulation. Locate
instrument. transmitter remotely in a cooler area.

Low Elec Temp


Electronics too cold. May compromise Insulate transmitter.
30 Out of Spec level measurement or damage Locate transmitter remotely in a warmer
instrument. area.

Calibration Req’d Out of Spec Measurement accuracy may be


Factory calibration has been lost.
Return transmitter to factory for
31
recalibration.
diminished.

Echo Reject
Echo Rejection inoperative. May report
Invalid
32 Out of Spec erroneous Level readings. Upr Echo Save a fresh Echo Rejection Curve.
may be lost near top of probe.
33 Spare Indicator 7 OK Reserved for future use.

Inferred Level
Distance measurement calculated Verify Level reading. If incorrect,
34 Out of Spec indirectly from probe elongation. Level compare Dielectric Range against EoP
reading is only approximate. Dielectric reading.

Adjust Analog Out Out of Spec Loop current is inaccurate.


Perform Adust Analog Output
35
maintenance procedure.
Totalizer Data
Lost
Non-volatile Totalizer Data storage
36 Out of Spec Contact Magnetrol Technical Support.
failing.

No Probe Target
Check settings:
37 Out of Spec Not actively compensating Probe Model
Target Ticks
Low Supply
Voltage
Loop current may be incorrect at high- Verify loop resistance.
38 Out of Spec
er values. Analog output is inaccurate. Replace loop power supply.

Dry Probe
No liquid is contacting probe. Level at If unexpected, verify proper probe
39 OK
unknown distance beyond probe. length for application.

Bad Target Location


Maintenance
40 Incorrect steam target location Contact Magnetrol Tech Support
Required
Check settings:
Low Echo Strength
Maintenance Dielectric Range
41 Risk of Echo Lost due to weak signal.
Required Sensitivity
View Echo Curve.
Check settings:
Low Ifc Echo Str
Maintenance Risk of Interface Echo Lost due to Dielectric Range
42
Required weak signal. Sensitivity
View Ifc Echo Curve.
Check settings:
Max Jump Exceeded
Transmitter has jumped to an echo at
Maintenance Dielectric Range
43 location that exceeds “Max Level
Required Sensitivity
Jump” from previous echo location.
View Echo Curve.
Spare Indicator
10
44 OK Reserved for future use.

Sequence Record
A Sequence Record number has been If desired, report Sequence Record
45 OK
stored in Event Log. number to factory.
The ECLIPSE Model 706 offers the ability to do Trending and Echo Curve analysis via the local graphical LCD or by using PACTware and the Model 706 DTM.
The Model 706 DTM is a power troubleshooting tool that can aid in the resolution of some of the Diagnostic Indicators shown above.

48 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.3.4 Diagnostic Help
Selecting DIAGNOSTICS from the MAIN MENU
presents a list of five ITEMS from the top level of the
DIAGNOSTICS tree.
When Present Status is highlighted, the highest Magnetrol
priority active diagnostic indicator (numerically lowest in
Table 3.3.3) is displayed on the bottom LCD line, which is
“OK” as shown at left. Pressing the ENTER key moves the
active diagnostic indicator to the top line outdented and
presents in the lower area of the LCD a brief explanation of
and possible remedies for the indicated condition. A blank
line separates the explanation from the remedies. Additional
active diagnostic indicators, if any, appear with their expla-
nations in descending priority order. Each additional active
indicator name-explanation pair is separated by a blank line
from the one above.
If the explanation and remedy text (and additional name-


explanation pairs) exceeds the available space, a appears
in the rightmost column of the last line indicating more text
below. In this situation, the DN key scrolls text up one line
at a time. Similarly, while text exists above the upper line of


the text field, a appears in the rightmost column of the
top (text) line. In this situation, the UP key scrolls the text
down one line at a time. Otherwise the DN and UP keys
are inoperative. In all cases the ENT or DEL key reverts to
the previous screen.
When the transmitter is operating normally and the high-
light cursor is positioned on Present Status, the bottom
LCD line displays “OK” because no diagnostic indicators
are active.
EVENT HISTORY – This menu displays the parameters
related to diagnostic event logging.
ADVANCED DIAGNOSTICS – This menu displays para-
meters related to some of the advanced diagnostics available
within the Model 706.
INTERNAL VALUES – Displays read-only internal
parameters.
ELEC TEMPERATURES – Displays temperature
information as measured in the potted module in
degrees F or C.
TRANSMITTER TESTS – Allows the user to
manually set the output current to a constant value.
This is a method for the user to verify operation of the
other equipment in the loop.
ECHO CURVES – This menu allows the user to display
the various Echo Curves on the LCD.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 49


ECHO HISTORY SETUP – The Model 706 contains the
unique and powerful feature that allows waveforms to be
automatically captured based on Diagnostic Events, Time or
both. This menu contains those parameters that configure
that feature.
Eleven (11) waveforms can be saved directly into the trans-
mitter.
• Nine (9) Troubleshooting Curves
• One (1) Echo Rejection Curve
• One (1) Reference Curve
TREND DATA – A 15-minute trend of the PV can be
displayed on the LCD.

3.3.5 Troubleshooting Application Issues


There can be numerous reasons for application-related
issues. Media buildup on the probe is covered here.
Media buildup on the probe is typically not a problem in
most cases—Eclipse circuitry works very effectively. Media
buildup should be viewed as two types:
• Continuous Film Coating
• Bridging

Film 3.3.5.1 Model 706 (Dual Element Coaxial or Twin Flexible


Coating
probe)
Continuous Film Coating
One type of potential application problem is when the
media forms a continuous coating on the probe. Although
the Eclipse Model 706 will continue to measure effectively,
some small inaccuracies may occur as the signal propagation
is affected by the thickness, length, and dielectric constant
of the coating.
It is a very rare case where filming causes a noticeable per-
formance degradation.
Bridging
A more common coating problem occurs when the process
Bridging
medium is viscous or solid enough to actually clog, or
bridge, between the elements. This bridging can cause a
noticeable degradation in performance. For example, high
dielectric media (e.g., water-based) can be detected as level
at the location of the bridging.
Similarly, a problem can develop if the product begins to
build up on the spacers that separate the coaxial probe ele-
ments. High dielectric media (e.g., water-based) will cause
the greatest error.

50 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


Single rod GWR probes are typically the best probes for
applications with potential buildup, but other factors in the
application must be considered (such as mounting, sensitivi-
ty, etc). For this reason, the Eclipse Model 706 is offered
with a variety of coaxial, single rod, and twin flexible probes
so the correct probe can be used for the given
application.
Refer to Section 3.6.4 for viscosity specifications on the
various Eclipse probes.
Contact the factory for any questions regarding
applications with potential coating and buildup.

3.3.5.2 Model 706 (Single Rod Probe)


¡ The Model 706 and Single Rod probe were designed to
operate effectively in the presence of media building up.
¬
Coating
Buildup
Some expected error may be generated based upon the
following factors:
1. Dielectric of the media that created the coating
¿ 2. Thickness of the coating
3. Amount (length) of the coating above the present level
Although more immune to thick, viscous, buildup, perfor-
mance of Single Rod GWR probes is always dependent on
the installation and application. The electromagnetic field
surrounding a single rod probe makes it more vulnerable to
Process Seal is
Fully Transparent influence from objects in the vicinity of the probe.

NOTE: It is important to note that this influence from the


installation/application also depends on the configuration of
the transmitter. Those devices configured with lower gain will
be less affected by external objects.

Nozzles
Due to the impedance mismatch that takes place at the end
Coaxial Probe of a nozzle, they can create false echoes that can cause diag-
nostic indicators and/or errors in measurement.
As mentioned above, by virtue of the pure physics of the
technology, all single rod GWR probes are influenced by
the application and installation. Mismatches in impedance
Large Impedance along the length of the probe, whether they be expected
Mismatch
(liquid level) or unexpected (metal in close proximity), will
result in reflections.
To better illustrate this, a comparison between a coaxial
probe and single rod probe mounted in the same application
is shown at left.

Standard Single Rod Probe

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 51


Since the outer tube of the coaxial probe is grounded, there
are no proximity affects and there is no influence from the
Mismatch Depends
nozzle. The only reflections along the length of the probe
on Mounting are expected. Those being the fiducial (reference signal) and
the return signal from the process.
On the other hand, a single rod probe mounted in the exact
same nozzle will have additional (unwanted) reflections
where the probe enters and exits the nozzle. These reflec-
tions are a result of the impedance changes that occur at
those points:
Single Rod Probe in a Stillwell
• The large reflection is due to the impedance developed
between the rod and nozzle ID as compared to the imped-
ance developed between the rod and the tank ID. (The larg-
er the nozzle ID, the smaller the reflection).
One way to eliminate the reflection at the bottom of the
nozzle is to use a continuous stillwell in conjunction with a
caged GWR probe. In doing so, there will be no impedance
changes all the way down the probe.
Refer to Section 3.2.6 for a discussion on overfill-capable
probes for suggestions on how to eliminate these unwanted
single rod reflections. Magnetrol is unique in the fact that
we offer a special caged probe that, when installed properly,
Caged Probe
(waveform is similar to that of a coaxial probe) has no unwanted reflections.
Obstructions
Nozzles
• 2" Diameter minimum
Metallic obstructions in the vicinity of a single rod probe
• Ratio of Diameter: can also affect the performance. If the level reading repeat-
Length should be >1:1
• Do not use Pipe Reducers (restriction) edly locks on to a specific level higher than the actual level,
it may be caused by a metallic obstruction. Obstructions in
the vessel (e.g., pipes, ladders) that are located close to the
probe may cause the instrument to show them as level.
Obstruction
Refer to the Probe Clearance Table for recommended clear-
ance distances. The distances shown in this table can be dra-
matically reduced by utilizing the Echo Rejection feature
(within the transmitter or) in PACTware and the Eclipse
Model 706 DTM.
NOTE: Use caution when rejecting large positive going signals as the
negative going level signal can be lost when passing through
them.

PROBE CLEARANCE TABLE


Distance Acceptable Objects
to Probe
Continuous, smooth, parallel conductive surface, for example a metal tank wall;
<6" (15 cm)
important that probe does not touch wall
>6" (15 cm) <1" (25mm) diameter pipe and beams, ladder rungs

>12" (30 cm) <3" (75mm) diameter pipe and beams, concrete walls

>18" (46 cm) All remaining objects

52 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.4 Configuration Information

This section is intended to offer additional configuration-


related details with respect to some of the parameters
shown in the Menu in Section 2.6.

3.4.1 Level Offset Description


The parameter referred to as Level Offset in the Eclipse
Model 706 DEVICE SETUP/BASIC CONFIG menu is
defined as the desired level reading when liquid surface is
at the tip of the probe.
The Eclipse Model 706 transmitter is shipped from the fac-
tory with Level Offset set to 0. With this configuration, all
measurements are referenced from the bottom of the probe.
See Example 1.
Level Units = inches
Example 1 (Level Offset = 0 as shipped from factory):
Probe Model = 7YT Application calls for a 72-inch Model 7yT coaxial probe
with an NPT process connection. The process medium is
Probe Mount = NPT
water with the bottom of the probe 10 inches above the
20 mA
Probe Length = 72 in
bottom of the tank.

Level Offset = 0 in
The user wants the 4 mA Set Point (LRV) at 24 inches
60"
and the 20 mA Set Point (URV) at 60 inches as
Dielectric Range =
Above 10 referenced from the bottom of the probe.
4 mA

24" 4 mA = 24 in In those applications in which it is desired to reference all


10"
measurements from the bottom of the vessel, the value of
20 mA = 60 in
Level Offset should be changed to the distance between the
Example 1 bottom of the probe and the bottom of the vessel as shown
in Example 2.
Example 2:
Application calls for a 72-inch Model 7yT coaxial probe
Level Units = inches
with an NPT process connection. The process medium is
Probe Model = 7YT
water with the bottom of the probe 10 inches above the
bottom of the tank.
Probe Mount = NPT
The user wants the 4 mA Set Point (LRV) at 24 inches
20 mA Probe Length = 72 in and the 20 mA Set Point (URV) at 60 inches as
referenced from the bottom of the tank.
Level Offset = 10 in
When the Eclipse transmitter is mounted in a chamber/bri-
Dielectric Range =
60"
Above 10 dle, it is usually desirable to configure the unit with the 4
4 mA
4 mA = 24 in
mA Set Point (LRV) at the lower process connection and
24" the 20 mA Set Point (URV) at the upper process
10"
20 mA = 60 in connection. The measuring range then becomes the center-
to-center dimension. In this case, a negative Level Offset
Example 2
needs to be entered. In doing so, all measurements are then
referenced at a point up on the probe, as shown in
Example 3.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 53


Example 3:
Level Units = inches Application calls for a 48-inch Model 7yG caged-coaxial
flanged probe measuring water in a chamber with the
Probe Model = 7YG
bottom of the probe extending six inches below the lower
Probe Mount = Flange
process connection. The user wants the 4 mA point to
be 0 inches at the bottom process connection and the
20 mA
Probe Length = 48 in 20 mA point to be 30 inches at the top process connection.
Level Offset =-6.0 in
30"
3.4.2 End-of-Probe Analysis
Dielectric Range =
Above 10 A new addition to the Model 706 Eclipse transmitter is a
4 mA 4 mA = 0in
feature called End-of-Probe Analysis (EoPA).
6"

Located in the DEVICE SETUP/ADVANCED CONFIG


20 mA = 30 in
Menu, this feature is patterned after the “Tank-Bottom
Example 3 Following” algorithms of the early Non-Contact radar
transmitters. When the return signal from the level is lost,
this feature allows the Model 706 transmitter to infer level
measurement based on the apparent location of the end-of-
probe (EoP) signal.
Due to the fact that the propagation of the GWR signal is
affected by the dielectric constant of the medium in which
it is traveling, signals along the probe are delayed in propor-
tion to the dielectric constant. By monitoring the location
of the (delayed) EoP signal and knowing the dielectric con-
stant of the medium, the level signal can be back-calculated,
or inferred.
The End-of-Probe Analysis feature is located in the
Advanced Config menu and requires an Advanced Password
to activate. Several additional parameters will need to be
configured for optimum performance.

NOTE: The accuracy of this level measurement mode is not that of


detecting true product level, and can vary depending on the
process. Magnetrol recommends that this feature be used only
as last resort for measuring levels in those rare applications in
which the level signals are inadequate, even after the common
troubleshooting techniques of gain increase and threshold
adjustment are implemented.

Refer to section 4.0 “Advanced Configuration/


Troubleshooting Techniques” or contact Magnetrol
Technical Support for additional instructions.

54 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.4.3 Echo Rejection
Due to the fact that GWR transmitters are less susceptible
to obstructions in a vessel (as compared with Non-Contact
Radar transmitters) , early versions of the Eclipse Model
705 transmitters did not have Echo Rejection capability.
However, due to our vast experience in the field, we have
found that there are (albeit rare) occasions when it is desir-
able to have the ability to “ignore” unwanted signals along
the probe.
The Model 706 transmitter Echo Rejection feature is
located in the DEVICE SETUP/ADVANCED CONFIG
menu, and requires an Advanced Password to activate. It is
highly recommended that this feature be used with the
waveform capture capability of the Model 706 DTM and
PACTware™.
Refer to Section 4 “Advanced Configuration/
Troubleshooting Techniques” or contact Magnetrol
Technical Support for additional instructions.

3.4.4 Volumetric Capability


Selecting Measurement Type = Volume and Level allows the
Model 706 transmitter to measure volume as the Primary
Measured Value.

3.4.4.1 Configuration using built-in Vessel Types


The following table provides an explanation of each of the
System Configuration parameters required for volume
applications that use one of the nine Vessel Types.

Configuration Parameter Explanation

A selection of Gallons (factory default Volume Unit), Milliliters, Liters, Cubic Feet, or Cubic
Volume Units
Inches, is provided.

Select either Vertical/Flat (factory default Vessel Type), Vertical/Elliptical, Vertical/Spherical,


Vertical/Conical, Custom Table, Rectangular, Horizontal/Flat, Horizontal/Elliptical,
Vessel Type Horizontal/Spherical, or Spherical.
Note: Vessel Dims is the next screen only if a specific Vessel Type was selected. If Custom Table
was selected. Refer to page 61 to select the Cust Table Type and Cust Table Vals.

Vessel Dims See the vessel drawings on the following page for relevant measuring areas.

Radius Used for all Vessel Types with the exception of Rectangular.

Ellipse Depth Used for Horizontal and Vertical/Elliptical vessels.

Conical Height Used for Vertical/Conical vessels.

Width Used for Rectangular vessels.

Length Used for Rectangular and Horizontal vessels.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 55


Vessel Types

HORIZONTAL/SPHERICAL

SPHERICAL

HORIZONTAL/ELLIPTICAL

VERTICAL/ELLIPTICAL VERTICAL/SPHERICAL

RECTANGULAR

VERTICAL/FLAT VERTICAL/CONICAL

HORIZONTAL/FLAT

56 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.4.4.2 Configuration using Custom Table
If none of the nine Vessel Types shown can be used, a
Custom Table can be created. A maximum of 30 points can
be used to establish the level to volume relationship. The
following table provides an explanation of each of the
System Configuration parameters for volume applications
where a Custom Table is needed.

Configuration Parameter Explanation (Custom Volumetric Table)

A selection of Gallons (factory default Volume unit), Milliliters, Liters, Cubic


Volume Units
Feet, or Cubic Inches, is provided.

Vessel Type Select Custom Table if none of the nine Vessel types can be used.
The Custom table points can be a Linear (straight line between adjacent points) or
Cust Table Type Spline (can be a curved line between points) relationship. See below drawing for
more information.
A maximum of 30 points can be used in building the Custom table. Each pair of
values will have a level (height) in the units chosen in the Level units screen, and
the associated volume for that level point. The values must be monotonic, i.e.
Cust Table Vals
each pair of values must be greater than the previous level/volume pair. The last
pair of values should have the highest level value and volume value associated
with the level in the vessel.

P9
P8
P2

Transition P7
point P6
P5

P4

P3
P1 P2
Use where walls are not perpendicular to base.
P1
Concentrate at least two points at beginning (P1) and end (P9);
and three points at either side of transition points.

LINEAR SPLINE

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 57


3.4.5 Open Channel Flow Capability
Selecting Measurement Type = Flow allows the Model 706
transmitter to measure flow as the Primary Measured Value.
Model 706 Open channel flow is performed by using the Eclipse Model
Flow
706 to measure the Head in a hydraulic structure. The
hydraulic structure is the primary measuring element, of
which the two most common types are weirs and flumes.
Since the primary element has a defined shape and dimen-
sions, the rate of flow through the flume or over the weir is
related to the Head at a specified measurement location.
Parshall
Flume
The Eclipse Model 706 is the secondary measuring device,
which measures the Head of the liquid in the flume or weir.
Open channel flow equations stored in the transmitter
firmware convert the measured Head into units of flow
(volume/time).
Open Channel Flow Measurement
Parshall Flume
NOTE: Proper positioning of the Model 706 should be per the recom-
mendation of the flume or weir manufacturer.

Model
706

Blocking Distance
10" (250 mm) min.
Reference
Distance

Water Surface
Throat Section

Head
Flow

Flume (side view)

Model
706
10" (250 mm)
minimum
Distance
Blocking

Reference
Distance
Water Surface Crest

Head

Weir Plate

Channel Floor

Weir (side view)

58 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.4.5.1 Configuration using Flume/Weir Equations
The following table provides an explanation of each of the
System Configuration parameters required for open channel
flow applications using one of the Flow Elements that are
stored in the firmware.

Configuration Parameter Explanation


A selection of Gallons/Minute (factory default Flow unit), Gallons/Hour, Mil
Flow Units Gallons/Day, Liters/Second, Liters/Minute, Liters/Hour, Cubic Meter/Hour,
Cubic Ft/Second, Cubic Ft/Minute, and Cubic Ft/Hour are provided.

Select one of the following primary Flow Elements that are stored in the firmware:
Parshall flume sizes of 1", 2", 3", 6", 9", 12", 18", 24", 36", 48", 60", 72", 96",
120" and 144". Palmer-Bwls (Palmer-Bowlus) flume sizes of 4", 6", 8", 10", 12",
15", 18", 21", 24", 27" and 30". V-notch weir sizes of 22.5O, 30O, 45O, 60O, 90O and
Flow Element 120O. Rect with Ends (Rectangular Weir with End Contractions), Rect w/o Ends
(Rectangular Weir without End Contractions), and Cipoletti weir. Custom Table (see
page 64 can be selected if none of the stored Flow Elements can be used. The
table can be built with a maximum of 30 points. The Model 706 also has the capa-
bility of using a Generic Equation (see page 60) for flow calculation.

The Weir Crest Length screen only appears when the chosen Flow Element is
Weir Crest Length Cipoletti or one of the Rectangular weirs. Input this length in the user-selected
level units.

Flume Channel Width Allows for entry of the width of the palmer bowlus flume.

Only appears when flow element is V-Notch weir. It allows for the entry of angle of
V-Notch Weir Angle
the V-Notch weir.
The Reference Distance is measured from the sensor reference point to the point
Reference Dist of zero flow in the weir or flume. This must be measured very accurately in the
user-selected level units.
Maximum Head is the highest liquid level (Head) value in the flume or weir before
the flow equation is no longer valid. The Maximum Head is expressed in the user-
Maximum Head selected Level units. The Model 706 will default to the largest Maximum Head value
that is allowed for any given flume or weir. The Maximum Head value can be revised
depending on the value of the Reference Distance, or for end user preference.
Maximum Flow is a read-only value that represents the flow value corresponding
Maximum Flow
to the Maximum Head value for the flume or weir.
The Low Flow Cutoff (in user-selected level units) will force the calculated flow
Low Flow Cutoff value to zero whenever the Head is below this point. This parameter will have a
default and minimum value of zero.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 59


3.4.5.2 Configuration using Generic Equation
The following table provides an explanation of each of the
System Configuration parameters for Open channel flow
applications using the Generic Equation.
Configuration Parameter Explanation (Open Channel Flow — using the Generic Equation)
A selection of Gallons/Minute (factory default Flow unit), Gallons/Hour,
Flow Units Mil Gallons/Day, Liters/Second, Liters/Minute, Liters/Hour, Cubic Meter/Hour,
Cubic Ft/Second, Cubic Ft/Minute, and Cubic Ft/Hour are provided.
Select one of the following primary Flow Elements that are stored in the firmware:
Parshall flume sizes of 1", 2", 3", 6", 9", 12", 18", 24", 36", 48", 60", 72", 96",
120" and 144". Palmer-Bwls (Palmer-Bowlus) flume sizes of 4", 6", 8", 10", 12",
15", 18", 21", 24", 27" and 30". V-notch weir sizes of 22.5O, 30O, 45O, 60O, 90O and
Flow Element 120O. Rect with Ends (Rectangular Weir with End Contractions), Rect w/o Ends
(Rectangular Weir without End Contractions), and Cipoletti weir. Custom Table (see
page 61 can be selected if none of the stored Flow Elements can be used. The
table can be built with a maximum of 30 points. The Model 706 also has the capa-
bility of using a Generic Equation for flow calculation. See example below.
Generic Equation is a discharge flow equation in the form of Q = K(L-CH)Hn, where
Q = flow (Cu Ft/Second), H = Head (Feet), K = a constant, and L, C and n are user
input factors that depend on which Flow Element is being used. Make sure the flow
equation is in the form of Q = K(L-CH)Hn, and proceed to enter the values of K,L,C,H
Generic Eqn Factors
and n. See example below.
NOTE: The Generic Equation parameters must be entered in Cu Ft/Second
units. The resultant flow is converted by the Model 706 into whatever Flow Units
are selected above. See example below.
The Reference Distance is measured from the sensor reference point to the point
Reference Dist of zero flow in the weir or flume. This must be measured very accurately in the
user-selected level units.
Maximum Head is the highest liquid level (Head) value in the flume or weir before
the flow equation is no longer valid. The Maximum Head is expressed in the user-
Maximum Head selected level units. The Model 706 will default to the largest Maximum Head value
that is allowed for any given flume or weir. The Maximum Head value can be revised
depending on the value of the Reference Distance, or for end user preference.
Maximum Flow is a read-only value that represents the flow value corresponding
Maximum Flow
to the Maximum Head value for the flume or weir.
The Low Flow Cutoff (in user-selected level units) will force the calculated flow
Low Flow Cutoff value to zero whenever the Head is below this point. This parameter will have a
default and minimum value of zero.

Generic Equation Example (using equation for an 8' rectangular weir w/ end contractions)
Q = Cubic Ft/Second flow rate L = 8' (weir crest length in feet) H = Head value
K = 3.33 for Cubic Ft/Second units C = 0.2 (constant) n = 1.5 as an exponent

Using the factors above the equation becomes:


Q = 3.33 (8-0.2H) H1.5
n
Q = K(L-CH)H The discharge flow value for a Head value of three feet
becomes 128.04 Cubic Ft/Second. If GPM was selected for
the Flow Units, the Model 706 Measured Values screen would
display this value converted to 57,490 GPM.
60 57-606 Eclipse Model 706 Guided Wave Radar Transmitter
3.4.5.3 Configuration using Custom Table
Concentrate points as follows:
A. At least two points at beginning (P1 and P2); The following table provides an explanation of each of the
B. At least two points at end (P9 and P10);
C. Three points at approximate average flow rate (for
System Configuration parameters for open channel flow
example, P3, P4, P5); and at transition point (P7) applications using the Custom Table.
and points on either side (P6, P8).

Transition P10
point

P9

P7
P8
P6 P5
P5
P4 Average flow rate
P3
P4

P2
P1 P3
SPLINE OR LINEAR
P2
SPLINE Concentrate points along curve P1

Configuration Parameter Explanation (Open Channel Flow — Custom Table)


A selection of Gallons/Minute (factory default Flow unit), Gallons/Hour,
Flow Units Mil Gallons/Day, Liters/Second, Liters/Minute, Liters/Hour, Cubic Meters/Hour,
Cubic Ft/Second, Cubic Ft/Minute, and Cubic Ft/Hour are provided.
Select one of the following primary Flow Elements that are stored in the firmware:
Parshall flume sizes of 1", 2", 3", 6", 9", 12", 18", 24", 36", 48", 60", 72", 96",
120" and 144". Palmer-Bwls (Palmer-Bowlus) flume sizes of 4", 6", 8", 10", 12",
15", 18", 21", 24", 27" and 30". V-notch weir sizes of 22.5O, 30O, 45O, 60O, 90O and
Flow Element 120O. Rect with Ends (Rectangular Weir with End Contractions), Rect w/o Ends
(Rectangular Weir without End Contractions), and Cipoletti weir. Custom Table (see
page 61 can be selected if none of the stored Flow Elements can be used. The
table can be built with a maximum of 30 points. The Model 706 also has the capa-
bility of using a Generic Equation (see page 60) for flow calculation.
The Custom table points can be a Linear (straight line between adjacent points) or
Custom Table Spline (can be a curved line between points) relationship. Refer to the drawing
above for more information.
A maximum of 30 points can be used in building the Custom table. Each pair of val-
ues will have a Head (height) in the units chosen in the Level units screen, and the
associated flow for that Head value. The values must be monotonic, i.e., each pair
Cust Table Vals
of values must be greater than the previous Head/flow pair. The last pair of values
should have the highest Head value (usually the Maximum Head value) and the flow
associated with that Head value.
The Reference Distance is measured from the sensor reference point to the point
Reference Dist of zero flow in the weir or flume. This must be measured very accurately in the
user-selected level units.
Maximum Head is the highest liquid level (Head) value in the flume or weir before
the flow equation is no longer valid. The Maximum Head is expressed in the user-
Maximum Head selected Level units. The Model 706 will default to the largest Maximum Head value
that is allowed for any given flume or weir. The Maximum Head value can be revised
depending on the value of the Reference Distance, or for end user preference.
Maximum Flow is a read-only value that represents the flow value corresponding
Maximum Flow
to the Maximum Head value for the flume or weir.
The Low Flow Cutoff (in user-selected level units) will force the calculated flow
Low Flow Cutoff value to zero whenever the Head is below this point. This parameter will have a
default and minimum value of zero.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 61


3.4.6 Reset Function
A parameter labeled “Reset Parameter” is located at the end
of the DEVICE SETUP/ADVANCED CONFIG menu.
In the event a user gets confused during configuration or
advanced troubleshooting, this parameter gives the user the
ability to reset the Model 706 transmitter configuration.
Unique to the Model 706 transmitter is the ability for
Magnetrol to fully “pre-configure” devices to customer
requests. For that reason, the Reset function will return the
device back to the state at which it left the factory.
It is recommended that Magnetrol Technical Support be
contacted as the Advanced User password will be required
for this reset.

3.4.7 Additional Diagnostic/Troubleshooting Capabilities

3.4.7.1 Event History


As a means for improved troubleshooting capability, a
record of significant diagnostic events is stored with time
and date stamps. A real time on board clock (which must be
set by the operator), will maintain the current time.

3.4.7.2 Context-sensitive Help


Descriptive information relevant to the highlighted parameter
in the menu will be accessible via the local display and
remote host interfaces. This will most often be a parameter-
related screen, but could also be information about menus,
actions (for example, Loop [Analog Output] Test, resets of
various types), diagnostic indicators, etc.
For example: Dielectric Range — Selects the range bounding
the dielectric constant of the medium in vessel. For interface
measurement mode, it selects the range bounding the
dielectric constant of the lower liquid medium. Some ranges
may not be selectable depending on the probe model.

3.4.7.3 Trend Data


Another new feature to the Model 706 is the ability to log
several measured values (selectable from any of the
primary, secondary, or supplemental measured values) at a
configurable rate (for example, once every five minutes) for
a period ranging from several hours to a number of days
(depending on the configured sample rate and number of
values to be recorded). The data will be stored in non-
volatile memory in the transmitter with date and time
information for subsequent retrieval and visualization using
the associated Model 706 DTM.

62 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.5 Agency Approvals

AVERTISSEMENT! Danger d’explosion


éventuel. Ne brancher ou débrancher des
These units are in compliance with the EMC-directive 2014/30/EU, équipements que si l’alimentation électrique a été
the PED-directive 2014/68/EU and the ATEX directive 2014/34/EU. coupée ou si la zone est réputée non dangereuse.

Explosion Proof (with intrinsically Safe Probe) Non- Incendive


US/Canada: US/Canada:
Class I, Div 1, Group B, C and D, T4 US: Class I, II, III, Division 2, Group A, B, C, D, E, F, G, T4
Class I, Zone 1 AEx db/ia [ia IIC Ga] IIB + H2 T4 Gb/Ga Canada: Class I, Division 2, Group A, B, C, D
Class I, Zone 1 Ex db/ia [ia IIC Ga] IIB + H2 T4 Gb/Ga Class I, Zone 2 AEx ec [ia Ga] IIC T4 Gc
Ta = -40ºC to +70ºC Class I, Zone 2 Ex ec [ia Ga] IIC T4 Gc
Type 4X Ta = -40ºC to +70ºC
Type 4X
Flame Proof
ATEX – FM14ATEX0041X/FM22UKEX0048X: ATEX – FM14ATEX0042X:
II 2/1 G Ex db/ia [ia IIC Ga] IIB + H2 T6 to T1 Gb/Ga II 3 (1) G Ex ec [ia Ga] IIC T4 Gc
Ta = -40ºC to +70ºC Ta = -15ºC to +70ºC
IEC- IECEx FMG 14.0018X: ATEX – FM22ATEX0003X
Ex db/ia [ia IIC Ga] IIB + H2 T6 to T1 Gb/Ga II 3 G Ex ic IIC T4 Gc
Ta = -40ºC to +70ºC Ta = -40ºC to +70ºC
IEC – IECEx FMG 14.00018X:
Ex ec [ia Ga] IIC T4 Ga/Gc
Ta = -15ºC to + 70ºC

Intrinsically Safe Dust Ignition Proof


US/Canada: US/Canada:
Class I, II, III, Div 1, Group A, B, C, D, E, F, G, T4, Class II, III, Division 1, Group E, F and G, T4
Class I, Zone 0 AEx ia IIC T4 Ga Ta = -40ºC to +70ºC
Class I, Zone 0 Ex ia IIC T4 Ga Type 4X
Class I, Zone 2 AEx ic IIC T4 Gc
ATEX – FM14ATEX0041X/FM22UKEX0048X:
Class I, Zone 2 Ex ic IIC T4 Gc
II 1/2 D Ex ia/tb [ia Da] IIIC T85ºC to T450ºC Da/Db
Ta =-40ºC to + 70ºC
Ta = -15ºC to +70ºC
Type 4X
IEC – IECEx FMG 14.0018X:
ATEX – FM14ATEX0041X/FM22UKEX0048X:
Ex ia tb [ia Da] IIIC T85ºC to T450ºC Db
II 1 G Ex ia IIC T4 Ga
Ex ia IIIC T85ºC to T450ºC Da
Ta = -40ºC to +70ºC
Ta = -15ºC to +70ºC
ATEX – FM22ATEX0003X:
II 3 G Ex ic IIC T4 Gc
Ta = -40ºC to +70ºC INMETRO Certification
Brazil:
IEC – IECEx FMG 14.0018X:
InMetro -TUV 13.1484X:
Ex ia IIC T4 Ga
BR-Ex ia IIC T4 Ga -40 C < Ta < +70 C
Ex ic IIC T4 Gc
BR-Ex ec [ia GA] IIC T4 Gc -15 C < Ta < +70 C
Ta = -40ºC to +70ºC
BR-Ex db/ia [ia IIC Ga] IIB + H2 T6…
T1 Ga/Gb -40 C < Ta < +70 C
BR-Ex ia tb [ia Da] IIIC T85 C…T450 C -15 C < Ta < +70 C
BR-Ex db [ia] IIC T6…T1 Ga/Gb -40 C < Ta < +70 C
BR-Ex tb [ia] IIIC T85C…T450C Da/Db -15 C < Ta < +70 C
BR-Ex ic IIC T4 Gc -40 C < Ta < +70 C

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 63


3.5.1 Special Conditions of Use
1. The enclosure contains aluminum and is considered to present a potential risk of ignition by impact or
friction. Care must be taken during installation and use to prevent impact or friction.
2. The risk of electrostatic discharge shall be minimized at installation, following the directions given in the
instructions.
3. Contact the original manufacturer for information on the dimensions of the flameproof joints.
4. For installation with ambient temperature of +70 °C, refer to the manufacturer’s instructions for guidance
on proper selection of conductors.
5. WARNING—Explosion Hazard: Do not disconnect equipment when flammable or combustible atmoshpere
is present.
6. For IEC and ATEX: To maintain the T1 to T6 temperature codes, care shall be taken to ensure the enclo-
sure temperature does not exceed +75 °C.
7. For U.S. and Canada: To maintain the T4 temperature code, care shall be taken to ensure the enclosure
temperature does not exceed +70 °C.
8. Temperature codes for the ratings Ex db/ia [ia IIC] IIB+H2 and Ex ia/tb [ia] IIIC are defined by the following
table:
Temperature Code-TCG Temperature Code-TCD
Process Temperature (PT) (GAS) (Dust)

Up to 75 °C T6 TCD= PT+10K=85 °C

From 75 to 90 °C T5 TCD= PT+10K=100 °C

From 90 to 120 °C T4 TCD= PT+15K=135 °C

From 125 to 185 °C T3 TCD= PT+15K=200 °C

From 185 to 285 °C T2 TCD= PT+15K=300 °C

From 285 to 435 °C T1 TCD= PT+15K=450 °C

9. Flameproof joints are not intended to be repaired.


10. To maintain FM approval, the Model 706 transmitter with adapter shall only be used on Model 705
assemblies approved by FM Global. (Includes FM, CSA, ATEX and IEC).
11. Provisions shall be made to provide transient over-voltage protection to a level not to exceed 119Vdc.

3.5.2 Agency Specifications – Explosion Proof Installation


Factory Sealed: This product has been approved by Factory Mutual Research (FM) as a Factory Sealed device.
NOTE: Factory Sealed: No Explosion Proof conduit fitting (EY seal) is required within 18" of the transmitter. However, an
Explosion Proof conduit fitting (EY seal) is required between the hazardous and safe areas.

64 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.5.3 Agency Specifications – FM/CSA Intrinsically Safe Installation

+$=$5'286/2&$7,21 121+$=$5'286/2&$7,21
02'(//(9(/75$160,77(5 /,0,7,1*9$/8(6
,175,16,&$//<6$)()25 9RF9&D!Q)
,VFP$/D!—+
&/$66,,,,,,',9,*52836$%&'()* 7
&/$66,=21($([?([LD,,&7*D 7+(92/7$*( 9PD[ $1'&855(17 ,PD[ :+,&+7+(
&/$66,=21($([?([LF,,&7*F 75$160,77(5&$15(&(,9(0867%((48$/7225
7D ƒ&72ƒ& *5($7(57+$17+(0$;,08023(1&,5&8,792/7$*(
(17,7<
9RF259 $1'7+(0$;,0806+257&,5&8,7&855(17
8L 9
75$160,77(5 ,L P$ ,VF25,( :+,&+&$1%('(/,9(5('%<7+(6285&(
,167580(17
3L : '(9,&(,1$'',7,217+(0$;,080&$3$&,7$1&( &L 
&L Q) $1',1'8&7$1&( /L 2)7+(/2$'$1'7+(
&$3$&,7$1&($1',1'8&7$1&(2)7+(
7%

-
/L —+
&855(17/223 ,17(5&211(&7,1*:,5,1*0867%((48$/72/(66
6((127( 7+$17+(&$3$&,7$1&( &D 257+(,1'8&7$1&( /D 
:+,&+&$1%('5,9(1%<7+(6285&('(9,&(

,1675,16,&$//<
6$)(%$55,(5

 
 

+$=$5'286$5($ 6$)($5($
7(50,1$/6 7(50,1$/6

6((127(

02'(/;;;;;

63(&,$/&21',7,2162)86(
 7+((1&/2685(&217$,16$/80,180$1',6&216,'(5('7235(6(17$327(17,$/5,6.2),*1,7,21%<,03$&725)5,&7,21&$5(0867%(
7$.(1'85,1*,167$//$7,21$1'86(7235(9(17,03$&725)5,&,721
 7+(5,6.2)(/(&75267$7,&',6&+$5*(6+$//%(0,1,0,=('$7,167$//$7,21)2//2:,1*7+(',5(&7,216*,9(1,17+(,16758&7,216
 )25,(&$1'$7(;720$,17$,17+(77277(03(5$785(&2'(6&$5(6+$//%(7$.(172(1685(7+((1&/2685(7(03(5$785('2(6
127(;&(('ž&
 )2586$1'&$1$'$720$,17$,17+(77(03(5$785(&2'(&$5(6+$//%(7$.(172(1685(7+((1&/2685(7(03(5$785('2(6127
(;&(('ž&
 3529,6,2166+$//%(0$'(723529,'(75$16,(1729(592/7$*(3527(&7,2172$/(9(/127(;&((',1*9GF
 7+(02'(/75$160,77(5:,7+$'$37256+$//%(86('21/<21)0$33529('02'(/$66(0%/,(6

127(6
 )25(;3/26,213522)25'867,*1,7,213522),167$//$7,2167+(,6*5281'7(50,1$/6+$//%(&211(&7('72$335235,$7(
,175,16,&$//<6$)(*5281',1$&&25'$1&(:,7+7+(&$1$',$1(/(&75,&$/&2'(>&(&@>)25&6$@257+(1$7,21$/(/(&75,1&$/&2'(
>1(&$16,1)3$@>)25)05&@)25,175,16,&$//<6$)(,167$//$7,2167+(,6*5281'7(50,1$/'2(61275(48,5(*5281',1*
 0$18)$&785(5 6,167$//$7,21,16758&7,2166833/,(':,7+7+(3527(&7,9(%$55,(5$1'7+(&(&>)25&6$@257+(1(&$1'
$16,,6$53>)25)05&@0867%()2//2:(':+(1,167$//,1*7+,6(48,30(17%$55,(50867%(&6$&(57,),(')25&$1$',$1
,167$//$7,216 )0$33529(')2586,167$//$7,21
 &21752/(48,30(17&211(&7('723527(&7,9(%$55,(56086712786(25*(1(5$7(025(7+$19'&259506
 157//,67(''8677,*+76($/60867%(86(':+(175$160,77(5,6,167$//(',1&/$66,, ,,,(19,5210(176
 125(9,6,216727+,6'5$:,1*:,7+287&6$$1')05&$33529$/
 )25&6$(;,$,175,16,&$//<6$)(6(&85,7(,175,16(48(
 )25&6$:$51,1*(;3/26,21+$=$5'68%67,787,212)&20321(1760$<,03$,568,7$%/,7<)25+$=$5'286/2&$7,216
 )256833/<&211(&7,21686(:,5(68,7$%/()257+(23(5$7,1*7(03(5$785()25ž&$0%,(1786(:,5(:,7+$0,1,080
7(03(5$785(5$7,1*2)ž&
 7+(75$160,77(5&$1$/62%(,167$//(',1
&/$66,',9,6,21*52836$%& '
&/$66,,',9,6,21*52836() * ) *21/<)25)05&
&/$66,,,',9,6,21+$=$5'286/2&$7,216$1''2(61275(48,5(&211(&7,2172$3527(&7,9(%$55,(5:+(1,167$//('3(5
7+(&(& )25&6$ 257+(1(& )25)05& $1':+(1&211(&7('72$32:(56285&(127(;&((',1*9'&
 )0$33529('$1'&6$&(57,),('%$55,(56:,7+/,1($5287387&+$5$&7(5,67,&60867%(86('

/
6+((72)

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 65


3.5.4 Agency Specifications – FM/CSA Intrinsically Safe FOUNDATION™ fieldbus Installation

+$=$5'286 &/$66,),(' /2&$7,21 81&/$66,),('/2&$7,21


&ODVV,'LYLVLRQ*URXSV$%&'
&ODVV,,'LYLVLRQ*URXSV()*
&ODVV,,,'LYLVLRQ
&ODVV,=RQH$([LD,,&*D
&ODVV,=RQH$([LF,,&7*F
&ODVV,=RQH([LF7*F

$Q\)0$SSURYHG
(FOLSVH/HYHO7UDQVPLWWHU ,QWULQVLFDOO\6DIH
0RGHO;;;;),6&2),(/''(9,&( $VVRFLDWHG$SSDUDWXVZLWK(QWLW\
0RGHO;;;;)1,&2),(/''(9,&( 3DUDPHWHUVVXLWDEOHIRUWKH
0RGHO;;;;;352),%86 ),6&2&RQFHSW
8L 9PD[  9
,L ,PD[  P$ 7KH(FOLSVH/HYHO7UDQVPLWWHU
3L : 0RGHO;;;;LVVXLWDEOHIRUXVHLQD),6&2V\VWHP
&L Q) 0RGHO;;;;LVVXLWDEOHIRUXVHLQD)1,&2V\VWHP
/L —+ ,QDFFRUGDQFHZLWK$16,,6$
/HDNDJHFXUUHQW—$

),6&2&RQFHSW
(FOLSVH/HYHO7UDQVPLWWHU 7KH),6&2FRQFHSWDOORZVLQWHUFRQQHFWLRQRILQWULQVLFDOO\VDIH
0RGHO;;;;),6&2),(/''(9,&( DSSDUDWXVWRDVVRFLDWHGDSSDUDWXVQRWVSHFLILFDOO\H[DPLQHGLQ
0RGHO;;;;)1,&2),(/''(9,&( VXFKFRPELQDWLRQ7KHFULWHULDIRUWKHLQWHUFRQQHFWLRQLVWKDWWKH
0RGHO;;;;;352),%86 YROWDJH 8LRU9PD[ WKHFXUUHQW ,LRU,PD[ DQGWKHSRZHU 3L 
ZKLFKLQWULQVLFDOO\VDIHDSSDUDWXVFDQUHFHLYHDQGUHPDLQ
8L 9PD[  9 LQWULQVLFDOO\VDIHFRQVLGHULQJIDXOWVPXVWEHHTXDORUJUHDWHUWKDQ
,L ,PD[  P$ WKHYROWDJH 8RRU9RFRU9W WKHFXUUHQW ,RRU,VFRU,W DQGWKH
3L : SRZHU 3RRU3W OHYHOVZKLFKFDQEHGHOLYHUHGE\WKHDVVRFLDWHG
&L Q) DSSDUDWXVFRQVLGHULQJIDXOWVDQGDSSOLFDEOHIDFWRUV,QDGGLWLRQ
/L —+ WKHPD[LPXPXQSURWHFWHGFDSDFLWDQFH &L DQG /L RIHDFK
/HDNDJHFXUUHQW—$ DSSDUDWXV RWKHUWKDQWKHWHUPLQDWLRQ FRQQHFWHGWRWKHILHOGEXV
PXVWEHOHVVWKDQRUHTXDOWRQ)DQG—+UHVSHFWLYHO\
,QHDFKVHJPHQWRQO\RQHDFWLYHGHYLFHQRUPDOO\WKHDVVRFLDWHG
DSSDUDWXVLVDOORZHGWRSURYLGHWKHQHFHVVDU\HQHUJ\IRUWKH
ILHOGEXVV\VWHP7KHYROWDJH 8RRU9RFRU9W RIWKHDVVRFLDWHG
DSSDUDWXVKDVWREHOLPLWHGWRWKHUDQJHRI9WR9GF$OO
RWKHUHTXLSPHQWFRQQHFWHGWRWKHEXVFDEOHKDVWREHSDVVLYH
PHDQLQJWKDWWKH\DUHQRWDOORZHGWRSURYLGHHQHUJ\WRWKH
V\VWHPH[FHSWWRDOHDNDJHFXUUHQWRI—$IRUHDFKFRQQHFWHG
GHYLFH6HSDUDWHO\SRZHUHGHTXLSPHQWQHHGVDJDOYDQLFLVRODWLRQ
WRDVVXUHWKDWWKHLQWULQVLFDOO\VDIHILHOGEXVFLUFXLWUHPDLQV
SDVVLYH

7KHFDEOHXVHGWRLQWHUFRQQHFWWKHGHYLFHVQHHGVWRKDYHWKH
SDUDPHWHUVLQWKHIROORZLQJUDQJH
/RRSUHVLVWDQFH5¶«:NP
,QGXFWDQFHSHUXQLWOHQJWK/¶«P+NP
&DSDFLWDQFHSHUXQLWOHQJWK&¶«Q)NP
$Q\)0&6$$SSURYHG &¶ &¶OLQHOLQH&¶OLQHVFUHHQLIERWKOLQHVDUHIORDWLQJRU
,QWULQVLFDOO\6DIH &¶ &¶OLQHOLQH&¶OLQHVFUHHQLIVFUHHQLVFRQQHFWHGWRRQH
$VVRFLDWHG$SSDUDWXVZLWK OLQH
3DUDPHWHUVVXLWDEOHIRUWKH /HQJWKRIVSOLFHP 7ER[PXVWRQO\FRQWDLQWHUPLQDO
FRQQHFWLRQVZLWKQRHQHUJ\VWRUDJHFDSDELOLW\
),6&2&RQFHSW /HQJWKRIVSXUFDEOHP
/HQJWKRIWUXQNFDEOHNP
$WHDFKHQGRIWKHWUXQNFDEOHDQDSSURYHGLQIDOOLEOHWHUPLQDWLRQ
ZLWKWKHIROORZLQJSDUDPHWHUVLVVXLWDEOH
5 «:DQG& «—)
7KHQXPEHURISDVVLYHGHYLFHVFRQQHFWHGWRWKHEXVVHJPHQWLV
QRWOLPLWHGIRU,6UHDVRQV,IWKHDERYHUXOHVDUHIROORZHGXSWR
$33529(' DWRWDOOHQJWKRIP VXPRIWKHOHQJWKRIWKHWUXQNFDEOHDQG
7(50,1$725 DOOVSXUFDEOHV WKHLQGXFWDQFHDQGFDSDFLWDQFHRIWKHFDEOHZLOO
QRWLPSDLUWKHLQWULQVLFVDIHW\RIWKHLQVWDOODWLRQ
8L 9PD[  9 5
,L ,PD[  P$ &
3L :
RU
$Q\DSSURYHGWHUPLQDWLRQRQZLWK
5 :
& —)

/
6+((72)

66 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.6 Specifications
3.6.1 Functional/Physical
System Design
Measurement Principle Guided Wave Radar based on Time Domain Reflectometry (TDR)
Input
Measured Variable Level, as determined by GWR time of flight
Span 6 inches to 100 feet (15 cm to 30 m); Model 7yS Probe 20 feet (610 cm) max.
Output
Type 4 to 20 mA with HART: 3.8 mA to 20.5 mA useable (per NAMUR NE43)
FOUNDATION fieldbus™: H1 (ITK Ver. 6.2.0)
PROFIBUS PA
Modbus
Resolution Analog: .003 mA
Digital Display: 1 mm
Loop Resistance 591 ohms @ 24 VDC and 22 mA
Diagnostic Alarm Selectable: 3.6 mA, 22 mA (meets requirements of NAMUR NE 43), or HOLD last output
Diagnostic Indication Meets requirements of NAMUR NE107
Damping Adjustable 0 –10 seconds
User Interface
Keypad 4-button menu-driven data entry
Display Graphic liquid crystal display
Digital Communication/Systems HART Version 7—with Field Communicator, AMS, or FDT
DTM (PACTware™), EDDL
FOUNDATION fieldbus, PROFIBUS PA or Modbus
Menu Languages Transmitter LCD: English, French, German, Spanish, Russian, Polish
HART DD: English, French, German, Spanish, Russian, Chinese, Portuguese, Polish
FOUNDATION fieldbus, PROFIBUS PA and Modbus Host System: English
Power (at transmitter terminals) HART: General Purpose (Weatherproof)/Intrinsically Safe/Explosion-proof:
16 to 36 VDC
11 VDC minimum under certain conditions
FOUNDATION fieldbus and PROFIBUS PA: 9 to 17.5 VDC
FISCO ia / FNICO ic, Explosion Proof, General Purpose and Weatherproof
Modbus: 8 to 30 VDC
Explosion Proof, General Purpose, and Weatherproof
Housing
Material IP66/IP67/die-cast aluminum A413 (<0.4% copper); optional stainless steel
Net/Gross Weight Aluminum: 4.5 lbs. (2.0 kg)
Stainless Steel: 10.0 lbs. (4.50 kg)
Overall Dimensions H 8.34" (212 mm) x W 4.03" (102 mm) x D 7.56" (192 mm)
Cable Entry ⁄2" NPT or M20
1

SIL 2/3 Capable (Certified) Safe Failure Fraction = 93% (HART only)
Functional Safety to SIL 2/3 in accordance with IEC 61508

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 67


3.6.1 Functional/Physical
Environment
Operating Temperature -40 to +175 °F (-40 to +80 °C); LCD viewable -5 to +160 °F (-20 to +70 °C)
Storage Temperature -50 to +185 °F (-45 to +85 °C)
Humidity 0 to 99%, non-condensing
Electromagnetic Compatibility Meets CE requirement (EN 61326) and NAMUR NE 21 ¿
Surge Protection Meets CE EN 61326 (1000V)
Shock/Vibration ANSI/ISA-S71.03 Class SA1 (Shock); ANSI/ISA-S71.03 Class VC2 (Vibration)
Performance
Reference Conditions ¡ Reflection from liquid, with dielectric constant in center of selected range,
with a 72" (1.8 m) coaxial probe at +70 °F (+20 °C), in Auto Threshold Mode
Linearity¬ Coaxial/Caged/Single Rod (rigid or cable): <0.1% of probe length or 0.1 inch (2.5 mm), whichever is greater
Twin Cable: <0.3% of probe length or 0.3 inch (7.5 mm), whichever is greater
Accuracy√ Coaxial/Caged/Single Rod (rigid or cable): ±0.1% of probe length or ±0.1 inch (2.5 mm), whichever is greater
Twin Cable: ±0.5% of probe length or ±0.5 inch (13 mm), whichever is greater
Interface Operation: ±1 inch (25 mm) for an interface thickness greater than 2 inches (50 mm)
Twin Flexible probes: ±2 inch (50 mm) for an interface thickness greater than
8 inches (200 mm)
Resolution ±0.1 inch or 1 mm
Repeatability <0.1 inch (2.5 mm)
Hysteresis <0.1 inch (2.5 mm)
Response Time Approximately 1 second
Initialization Time Less than 10 seconds
Ambient Temperature Effect Approx. ±0.02% of probe length/degree C (for probes greater than 8 feet (2.5 m))
Process Dielectric <0.3 inch (7.5 mm) within selected range
FOUNDATION fieldbus™
ITK Version 6.2.0
H1 Device Class Link Master (LAS) — selectable ON/OFF
Function Blocks (8) Al, (3) Transducer, (1) Resource, (1) Arithmetic, (1) Input Selector,
(1) Signal Characterizer, (2) PID, (1) Integrator
Quiescent Current 15 mA
Execution Time 15 ms (40 ms PID Block)
Device Revision 02
DD Version 0x01
PROFIBUS PA
Device Revision 0x101A
Digital Communication Protocol Version 3.02 MBP (31.25 kbits/sec)
Function Blocks (1) ¥ Physical Block, (8) ¥ AI Blocks, (3) ¥ Transducer Block
Quiescent Current 15 mA
Execution Time 15 ms
Modbus
¿ Single rod and twin cable probes must
Power Consumption <0.5W be used in metallic vessel or stillwell to
maintain CE noise immunity
Signal Wiring Two-wire half duplex RS-485 Modbus ¡ Specifications will degrade in Fixed
Threshold mode.
¬ Linearity in top 18 inches (46 cm) of
Ground (common mode) Voltage ±7V
Bus Termination Per EIA-485 twin cable and single rod probes in
tanks will be application dependent.
√ Accuracy may degrade when using
manual or automatic compensation.

68 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.6.2 O-ring (Seal) Selection Chart

O-Ring/Seal Max. Process Min. Process Max. Process Not Recommended For
Code Recommended for Applications
Material Temperature Temperature Pressure Applications

Ketones (MEK, acetone),


skydrol fluids, amines,
1000 psi 70 °F anhydrous ammonia, low
400 °F @ 230 psi -40 °F
0 Viton® GFLT (70 bar @ molecular weight esters and General purpose, ethylene
(200 °C @ 16 bar) (-40 °C)
20 °C) ethers, hot hydrofluoric or
chlorosulfuric acids,
sour HCs
1000 psi 70 °F Petroleum oils, di-ester base
250 °F @ 200 psi -60 °F
1 EPDM (70 bar @ Acetone, MEK, skydrol fluids
(120 °C @14 bar) (-50 °C) lubricant, steam
20 °C)
Inorganic and organic acids (including
1000 psi 70 °F Hot water/steam, hot
400 °F @ 232 psi -40 °F hydro fluids and nitric), aldehydes,
2 Kalrez 4079
®
(70 bar @ aliphatic amines, ethylene
(200 °C @ 16 bar) (-40 °C) ethylene, organic oils, glycols, silicone
20 °C) oxide, propylene oxide
oils, vinegar, sour HCs

Halogenated HCs, nitro HCs,


HSN phosphate ester hydraulic
1000 psi 70 °F
275 °F @ 320 psi -4 °F fluids, ketones (MEK,
3 (Highly Saturated (135 °C @ 22 bar) (70 bar @ NACE applications
(-20 °C) acetone), strong acids,
Nitrile) 20 °C)
ozone, automotive brake
fluid, steam

Halogenated HCs, nitro HCs,


General purpose sealing,
phosphate ester hydraulic
1000 psi 70 °F petroleum oils and fluids, cold
275 °F @ 320 psi -4 °F fluids, ketones (MEK,
4 Buna-N (70 bar @ water, silicone greases and oils,
(135 °C @ 22 bar) (-20 °C) acetone), strong acids,
20 °C) di-ester base lubricants, ethylene
ozone, automotive brake
glycol base fluids
fluid

1000 psi 70 °F Refrigerants, high anline point


250 °F @ 290 psi -65 °F Phosphate ester fluids,
5 Neoprene® (70 bar @ petroleum oils, silicate ester
(120 °C @ 20 bar) (-55 °C) ketones (MEK, acetone)
20 °C) lubricants
Acetaldehyde, ammonia +
1000 psi 70 °F lithium metal solution, Inorganic and organic acids,
400 °F @ 200 psi -20 °F
6 Chemraz® 505 (70 bar @ butyraldehyde, di-water, alkalines, ketones, esters,
(200 °C @ 14 bar) (-30 °C)
20 °C) freon, ethylene oxide, liquors, aldehydes, fuels
isobutyraldehyde
1000 psi 70 °F
200 °F @ 420 psi -65 °F Acids, Ketones, Hydraulic systems, petroleum oils,
7 Polyurethane (70 bar @
(95 °C @29 bar) (-55 °C) chlorinated HCs, HC fuel, oxygen, ozone
20 °C)
Inorganic and organic acids
Simriz SZ485 Black liquor, freon 43, (including hydro fluids and nitric),
(formerly 1000 psi 70 °F
400 °F @ 232 psi 20 °F freon 75, galden, KEL-F aldehydes, ethylene, organic oils,
8 (70 bar @
Aegis PF128) (200 °C @ 16 bar) (-7 °C)
¿
liquid, molten potassium, glycols, silicone oils, vinegar, sour
20 °C)
molten sodium HCs, steam, amines, ethylene oxide,
propylene oxide, NACE applications

1000 psi 70 °F Hot water/steam, hot


400 °F @ 232 psi -40 °F
A or B Kalrez® 6375 (70 bar @ aliphatic amines, ethylene Hydrofluoric Acid
(200 °C @ 16 bar) (-40 °C)
20 °C) oxide, propylene oxide

Hot alkaline solutions HF acid, General high temperature/high


6250 psi 70 °F
D or Glass Ceramic 850 °F @ 3600 psi -320 °F media with ph>12, pressure applications,
(431 bar @
N Alloy (450 °C @ 248 bar) (-195 °C) direct exposure to hydrocarbons, full vacuum
20 °C)
saturated steam (hermetic), ammonia, chlorine

¿ Maximum +300 °F (+150 °C) for use on steam.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 69


3.6.3 Probe Selection Guide
COAXIAL/CAGED GWR PROBE SINGLE ROD/CABLE PROBE

signal propagation signal propagation

Launch

end view

Vacuum ƒ
GWR Dielectric end view Max.
Temperature Overfill Viscosity
Range ¡¬ Range √
Description Application Installation
Probe¿ Pressure Safe cP (mPa.s)
Coaxial GWR Probes— Liquids
Standard Level/Interface Tank/Chamber ε 1.4 –100 -40 to +400 °F 1000 psi
7yT r Yes Yes 500/2000
Temperature (-40 to +200 °C) (70 bar)
High -320 to +400 °F
ε 1.4 –100 (-196 6250 psi
7yP Pressure Level/Interface Tank/Chamber r Full Yes 500/2000
to +200 °C) (431 bar)
High Temp./ Level/Interface Tank/Chamber ε 1.4 –100 -320 to +850 °F 6250 psi
7yD r Full Yes 500/2000
High Press. (-196 to +450 °C) (431 bar)
7yS Steam Saturated Tank/Chamber εr 10 –100 -40 to +800 °F ≈ 3000 psi Full No ➆ 500
Probe Steam (-40 to +425 °C) (207 bar)

Caged GWR Probes— Liquids


Standard -40 to +400 °F
εr 1.4 –100 (-40 1000 psi
7yG Temperature Level/Interface Chamber Yes Yes 10000
to +200 °C) (70 bar)
High εr 1.4 –100 (-196 toto +200
-320 +400 °F 6250 psi
7yL Pressure Level/Interface Chamber Full Yes 10000
°C) (431 bar)
High Temp./ Level/Interface -320 to +850 °F
εr 1.4 –100 (-196 to +450 °C) 6250 psi
7yJ Chamber Full Yes 10000
High Press. (431 bar)

Single Rod Rigid GWR Probes— Liquids


7yF Standard -40 to +400 °F
εr 1.7–100 (-40 1000 psi No «
Temperature Level/Interface Tank Yes 10000
to +200 °C) (70 bar)
7yM High Level Tank -320 to +400 °F 6250 psi
εr 1.7–100 (-196 Full No « 10000
Pressure to +200 °C) (431 bar)
7yN High Temp./ Level Tank +850 °F 6250 psi
εr 1.7–100 (-196 toto +450
-320 Full No « 10000
High Press. °C) (431 bar)

Single Cable Flexible GWR Probes— Liquids


7y1 Standard -40 to +400 °F
εr 1.7–100 (-40 1000 psi No «
Temperature Level/Interface Tank Yes 10000
to +200 °C) (70 bar)
7y3 High Level Tank -320 to +400 °F 6250 psi
εr 1.7–100 (-196 Full No « 10000
Pressure to +200 °C) (431 bar)
7y4 Standard -40 to +400 °F
εr 1.4 –100 (-40 to +200 1000 psi No «
Temperature Level/Interface Chamber Yes 10000
°C) (70 bar)
7y6 High Temp./ Level/Interface Chamber -320 to +850 °F 6250 psi
εr 1.4 –100 (-196 Full No « 10000
High Press to +450 °C) (431 bar)

Single Cable Flexible GWR Probes— Solids


7y2 Bulk Solids Level Tank -40 to +150 °F
εr 1.7–100 (-40 Atmos. No No « 10000
Probe to +65 °C)
¿ 2nd digit A=English, C=Metric ≈ When installed in side-mounted chamber.
¡ Minimum εr 1.2 with end of probe analysis enabled. ➆ Consult factory for overfill applications
¬ Single rod probes mounted directly into the vessel must be within 3 – 6 inches « Overfill capability can be achieved with software.
ε
of metal tank wall to obtain minimum dielectric of 1.4, otherwise r min = 1.7.
√ Depends on the probe spacer material. Refer to Model Selection for spacer
options.
ƒ Eclipse probes containing o-rings can be used for vacuum (negative pressure)
service, but only those probes with glass seals are hermetically sealed
to <10-8 cc/sec @ 1 atmosphere helium.

70 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.6.4 Probe Specifications

Dual-element Probes
Coaxial / Cage HP Coaxial/Cage HTHP Coaxial/Cage Steam
(7yL, 7yP) ¿ (7yD, 7yJ) ¿ (7yS) ¿
Model
(7yG, 7yT)
316/316L SS (Hastelloy 316/316L SS, 316/316L SS,
316/316L SS,
C and Monel opt.) Glass Ceramic Alloy, Glass Ceramic Alloy,
Materials Peek™, Inconel
TFE spacers, Inconel Inconel
Aegis PF 128 O-ring
Viton® O-rings TFE spacers TFE or Peek™ spacers

Small Coaxial: .3125" (8 mm) diameter rod, .875" (10 mm) diameter tube .875" (10 mm) +575 °F

Diameter Enlarged Coaxial: .6" (15 mm) dia. rod, 1.75" (44 mm) dia. tube 1.62 (42 mm) +800 °F

Caged: 0.5" – 1.50" (13 – 38 mm) dia. rod N/A

Process 3
⁄4" NPT, 1" BSP 3
⁄4" NPT, 1" BSP 3
⁄4" NPT, 1" BSP
Connection ASME or EN flanges ASME or EN flanges ASME or EN flanges

Transition Zone 8" (200 mm) @


None
(Top) εr = 80

Transition Zone 6" (150 mm) @ εr = 1.4 6" (150 mm) @ εr = 1.4
1" (25 mm)@ εr = 80
(Bottom) 1" (25 mm) @ εr = 80.0 1" (25 mm) @ εr = 80.0

Pull Force/Tension N/A

NOTE: Transition Zone is dielectric dependent; εr = dielectric permittivity. The transmitter still operates but
level reading may become nonlinear in Transition Zone.

Single Rod Probes

Model 7yF 7yM, 7yN ¿ 7y1 Flexible 7y3, 7y6 Flexible ¿ 7y2 Flexible

316/316L SS 316/316L SS, Inconel


316/316L SS, 316/316L SS,
(Hastelloy® C and (Hastelloy® C and 316/316L SS,
Materials Viton® O-rings Inconel,
Monel optional) Monel optional) Viton® O-rings
(optional PFA coating) Viton® O-rings
Viton®/PEEK™ O-rings Viton®/PEEK™ O-rings

Diameter 0.5" (13 mm) 0.25" (6 mm)

Blocking Distance - Top 0–36" (0–91 cm)–Installation dependent (adjustable)

Process 1" NPT (7yF) 2" NPT


Connection ASME or EN flange ASME or EN flange
Transition Zone
Application Dependent
(Top)
Transition Zone 6" (150 mm) @ εr = 1.4
12" (305 mm) minimum
(Bottom) 2" (50 mm) @ εr >10

Pull Force/Tension N/A 20 lbs. (9 Kg) 3000 lbs. (1360 Kg)

Not more than 3" (7.6 cm) deflection at


Side Load Cable not to exceed 5° from vertical
end of 120" (305 cm) probe

¿ Probes of Hastelloy C contain an Inconel 625 to Hastelloy C seal weld.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 71


Temperature/Pressure Charts
7yL, 7yM and 7yP (high pressure probes) 7yD, 7yJ, 7yN, 7y3 and 7y6 (high temp./high pressure probes)
Temperature/Pressure Ratings Temperature/Pressure Ratings
6500 6500

6000 6000
Maximum Pressure (PSI)

Maximum Pressure (PSI)


5500 5500

5000 5000

4500 4500

4000 4000

3500 3500

3000 3000
0 100 200 300 400 500 0 200 400 600 800 1000
Temperature (°F) Temperature (°F)
316/316L SST 316/316L SST
Hastelloy C276 Hastelloy C276
Monel 400 Monel 400
NOTES: High Pressure Probes Low Pressure High Pressure Probes Low Pressure

• 7yS steam probes are rated to 3000 psi (207 bar) up to +800 °F (+425 °C) Temp. SST Hastelloy Monel All Materials Temp. SST Hastelloy Monel All Materials
when installed in side-mounted chamber. -40 6000 6250 5000 750 +600 3760 5040 3940 —
• 7y3, 7y6 flexible probes: Pressure is limited by the chamber. +70 6000 6250 5000 1000 +650 3680 4905 3940 —
• 7y2, 7y5 bulk solids probes: 50 psi (3.45 bar) to +150 °F (+65 °C) +100 6000 6250 5000 1000 +700 3620 4730 3920 —
+200 5160 6250 4380 650 +750 3560 4430 3880 —
+300 4660 6070 4080 400 +800 3520 4230 3820 —
+400 4280 5820 3940 270 +850 3480 4060 3145 —
+500 3980 5540 3940 —
3.6.5 Physical Specifications – Transmitter
inches (mm)
3.38 4.18
(86) (106)

3.77
3.38 4.18 8.34
(96)
(86) (106) (212)
5.09
9.30 (129)
(236) 3.77
(96)

4.03
45° (102)
2 cable
entries
2 cable Eclipse® Housing
Integral Electronics entries (45° View)
2.75
Eclipse® Housing (70) 45° 33 or 144
(45° View) (838 or 3650)
3.00 3.75
2.00 (76) (95)
(51)

3.50 2 Holes
(89) .38 (10) Dia. 5.00
(125)

Eclipse® Remote Configurations

72 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.6.6 Physical Specifications – Coaxial Probes
inches (mm)
3.38 4.18 3.38 4.18 3.38 4.18
(86) (106) (86) (106) (86) (106)

3.77 3.77 3.77


(96) (96) (96)

9.30 9.30 9.30


(236) (236) (236)
2 cable
entries

Optional 45° 2 cable 45° 2 cable 45°


Flushing Port entries entries
1/4" NPT

4.46
(113) Optional
3.0 Flushing Port Optional
(76 mm) 1/4" NPT 7.76 Flushing Port
(197) 1/4" NPT
10.45
Mounting (265)
Flange 4.41 (112 mm)
typical
4.17 (106 mm)
Probe typical
Mounting
Insertion
Flange
Length
Probe
Insertion Mounting
Length Flange Probe
Insertion
Length

Model 7yT Model 7yP Model 7yD


with flanged connection with flanged connection with flanged connection

3.38 4.18
(86) (106)

3.77 A
(96)
C
9.30
(236) B E

2 cable 45°
F
entries
Coaxial GWR Probe, D
End View Coaxial Probe Slots

11.55 Inches (mm)


(293)
Dim. Small Diameter Large Diameter Enlarged (standard)
1.75 (45) - SST
A 0.88 (22.5) 1.62 (41.1)
1.92 (49) - HC and Monel
B 0.31 (8) 0.50 (13) max. 0.63 (16) maximum
Mounting
Flange C 4.08 (100) 6.05 (153) 6.05 (153)
D 0.15 (4) 0.30 (8) 0.30 (8)
Probe
Insertion E 3.78 (96) 5.45 (138) 5.45 (138)
Length
F 1.25 (31.75) — —

Model 7yS
with flanged connection

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 73


3.6.7 Physical Specifications – Caged Probes
inches (mm) 3.38 4.18
(86) (106)

3.38 4.18
(86) (106) 3.77
3.38 4.18
(96)
(86) (106)

3.77
9.30
3.77 (96)
(236)
(96)
9.30
9.30 (236)
(236) 45°
2 cable
entries

2 cable 45°
2 cable 45° entries
entries

10.45
4.70 6.39
(265)
(119) (162)

Mounting
Flange
Mounting
Flange
Mounting
Flange
Probe
Insertion Probe
Length Insertion Probe
Length Insertion
Length

Model 7yG Model 7yL Model 7yJ


with flanged connection with flanged connection with flanged connection

Cage Size Probe Rod Diameter (D) Spacer Length (L)

2" 0.5 to 0.75" (13 to 19 mm) 1.82" (46 mm)

3" 0.75 to 1.13" (19 to 29 mm) 2.64" (67 mm)

4" 1.05 to 1.50" (27 to 38 mm) 3.60" (91 mm)

3.6.8 Physical Specifications – Model 705/706 Adapter (032–6923-001)


inches (mm)

3.15 (80)

Model 706
Transmitter

Model 705
Transmitter
4.80
(122)
705–706
Adapter

705 Series 705 Series


Probe Probe

∅ 1.75
(44.5)

74 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.6.9 Physical Specifications – Single Cable Flexible Probes
inches (mm) 3.38 4.18 3.38 4.18
(86) (106) (86) (106)
3.38 4.18
(86) (106)
3.77 3.77
(96) (96)
3.77
(96)
9.30 9.30
(236) (236)
9.30
(236)

2 cable 45° 2 cable 45°


entries entries
2 cable 45°
entries

4.53
(115)
8.35 10.45
Mounting (212) (265)
Flange

Mounting
Flange Mounting
Flange
Probe
Insertion
Length
⌀ 2.0 (51)
Consult ⌀ 2.0 (51)
⌀ 0.5 (0.19) 3.88
(99)
Factory
Probe Probe
Insertion Insertion
Length Length
0.75 (19) Model 7y3 Consult
Model 7y6 6.0
with flanged Factory with flanged (152)
Model 7y1 connection connection
with flanged connection

3.38 4.18
(86) (106)

3.77
(96)

9.30
(236)

6
2 cable 45° (152)
entries
Ø2
(51)

5.46
(139)

Mounting
Flange

⌀ 2.0 (51) 7y2: SST Weight


5 lbs (2.25 kg)
Probe order code: 004-8778-001
Insertion
(2) 010-1731-001
Model 7y2 Length
with flanged 6.0
(152)
connection

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 75


3.6.10 Physical Specifications – Single Rod Rigid Probes
3.38 4.18
inches (mm) (86) (106)
3.38 4.18
3.38 4.18 (86) (106)
(86) (106) 3.77
(96)
3.77
3.77 (96)
9.30
(96) (236)
9.30
9.30 (236)
(236)

2 cable 45°
entries
2 cable 45°
2 cable 45° entries
entries

4.53
(115) 10.45
8.38 (265)
Mounting (213)
Flange

Mounting
Flange Mounting
Probe Flange
Insertion
Length
⌀ .38 ⌀ .38 ⌀ .50
Probe Probe
Insertion Insertion
(9.6) (9.6) Length (13)
Length

Model 7yF Model 7yM Model 7yN


with flanged connection with flanged connection with flanged connection

76 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.6.11 Power Supply Requirements

3.6.11.1 Safe Operating Area

Safe Operating Area

R Loop

591
Ω
Typical HART
4-20 mA
Digital Solar Mode Operating Area

0 11 V 16.25 V 24 V 36 V

Vsupply

3.6.11.2 Supply Voltage

Operational Mode Current Consumption Vmin Vmax

HART

4mA 16.25V 36V


General Purpose
20mA 11V 36V

4mA 16.25V 28.6V


Intrinsically Safe
20mA 11V 28.6V

4mA 16.25V 36V


Explosion Proof
20mA 11V 36V

Fixed Current-Solar Power Operation (PV transmitter via HART)

General Purpose 10mA¿ 11V 36V

Intrinsically Safe 10mA¿ 11V 28.6V

HART Multi-Drop Mode (Fixed Current)

Standard 4mA¿ 16.25V 36V

Intrinsically Safe 4mA¿ 16.25V 28.6V

FOUNDATION fieldbus™ / PROFIBUS PA

Supply Voltage 9V to 17.5V 9V to 17.5V 9V to 17.5V

¿ Start-up current 12 mA minimum.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 77


3.7 Model Number
3.7.1 Transmitter
1 2 3 | BASIC MODEL NUMBER
706 Eclipse 4th Generation Guided Wave Radar (GWR) Level Transmitter

4 | POWER
5 24 VDC, Two-Wire

5 | SIGNAL OUTPUT
1 4 –20 mA with HART
2 FOUNDATION fieldbus™ Communication
3 PROFIBUS PA Communication
4 Modbus Communication (8th Digit = 0 or 3 only)

6 | SAFETY OPTIONS
0 None (FOUNDATION fieldbus, PROFIBUS PA or Modbus) (5th digit = 2, 3 or 4)
2 SIL 2/3 Certified - HART only (5th digit = 1)

7 | ACCESSORIES/MOUNTING
0 No Digital Display or Keypad – Integral
A Digital Display and Keypad – Integral
B Digital Display and Keypad – 3-foot (1 meter) remote
C Digital Display and Keypad – 12-foot (3.6 meter) remote

8 | CLASSIFICATION
0 General Purpose, Weatherproof (IP 67)
Intrinsically Safe (FM & CSA CL 1 Div 1, Grps A, B, C, D)
1
(5th digit = 1, 2 or 3)
Explosion-proof (FM & CSA CL 1 Div 1, Grps B, C, D)
3
(5th digit = 1, 2 or 3)
A Intrinsically Safe (ATEX/IEC Ex ia IIC T4) (5th digit = 1, 2 or 3)
B Flame-proof (ATEX/IEC Ex d ia IIC T6) (5th digit = 1, 2 or 3)
Non-sparking (ATEX Ex n IIC T6) /
C
Non-incendive (FM & CSA, CL 1 Div 2) (5th digit = 1, 2 or 3)
D Dust Ex (ATEX II) (5th digit = 1, 2 or 3)

9 | HOUSING
1 Die-cast Aluminum, Dual-compartment, 45-degree
2 Investment Cast, Stainless Steel, Dual-compartment, 45-degree
Die-cast Aluminum, Dual-compartment, 45-degree with
705/706 adapter ¿
A
Investment Cast, Stainless Steel, Dual-compartment, 45-degree
with 705/706 adapter ¿
B

¿ Not available with 5th digit = 3.

10 | CONDUIT CONNECTION
1
0 ⁄ " NPT
2

1 M20 x 1.5
1
2 ⁄ " NPT with sunshade
2

3 M20 x 1.5 with sunshade

7 0 6 5
1 2 3 4 5 6 7 8 9 10

78 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.7.2 Enlarged Coaxial Probe
1 | TECHNOLOGY
7 Eclipse GWR Probes - Model 706

2 | MEASUREMENT SYSTEM
A English (inches)
C Metric (centimeters)

3 | CONFIGURATION/STYLE (RIGID)
D Enlarged Coaxial, High Temp/High Pressure: Overfill w/Glass Seal (+850 °F/+450 °C) — Only available with 10th digit N or D
P Enlarged Coaxial, High Pressure: Overfill w/Glass Seal (+400 °F/+200 °C) — Only available with 10th digit N or D
T Enlarged Coaxial, Overfill Standard O-Ring Seal (+400 °F/+200 °C) — NOT available with 10th digit N or D

4 5 | PROCESS CONNECTION – SIZE/TYPE (consult factory for other process connections)


Threaded
41 2" NPT Thread ¿ 42 2" BSP (G1) Thread ¿
52 3" BSP (G1) Thread ¡
ASME Flanges
43 2" 150# ASME RF ¿ 5M 3" 1500# ASME RTJ
44 2" 300# ASME RF ¿ 5N 3" 2500# ASME RTJ
45 2" 600# ASME RF ¿ 63 4" 150# ASME RF
4K 2" 600# ASME RTJ ¿ 64 4" 300# ASME RF
53 3" 150# ASME RF 65 4" 600# ASME RF
54 3" 300# ASME RF 66 4" 900# ASME RF
55 3" 600# ASME RF 67 4" 1500# ASME RF
56 3" 900# ASME RF 68 4" 2500# ASME RF
57 3" 1500# ASME RF 6K 4" 600# ASME RTJ
58 3" 2500# ASME RF 6L 4" 900# ASME RTJ
5K 3" 600# ASME RTJ 6M 4" 1500# ASME RTJ
5L 3" 900# ASME RTJ 6N 4" 2500# ASME RTJ
EN Flanges
DA DN 50, PN 16 EN 1092-1 TYPE A ¿ EH DN 80, PN 320 EN 1092-1 TYPE B2
DB DN 50, PN 25/40 EN 1092-1 TYPE A ¿ EJ DN 80, PN 400 EN 1092-1 TYPE B2
DD DN 50, PN 63 EN 1092-1 TYPE B2 ¿ FA DN 100, PN 16 EN 1092-1 TYPE A
DE DN 50, PN 100 EN 1092-1 TYPE B2 ¿ FB DN 100, PN 25/40 EN 1092-1 TYPE A
EA DN 80, PN 16 EN 1092-1 TYPE A FD DN 100, PN 63 EN 1092-1 TYPE B2
EB DN 80, PN 25/40 EN 1092-1 TYPE A FE DN 100, PN 100 EN 1092-1 TYPE B2
ED DN 80, PN 63 EN 1092-1 TYPE B2 FF DN 100, PN 160 EN 1092-1 TYPE B2
EE DN 80, PN 100 EN 1092-1 TYPE B2 FG DN 100, PN 250 EN 1092-1 TYPE B2
EF DN 80, PN 160 EN 1092-1 TYPE B2 FH DN 100, PN 320 EN 1092-1 TYPE B2
EG DN 80, PN 250 EN 1092-1 TYPE B2 FJ DN 100, PN 400 EN 1092-1 TYPE B2
Torque Tube Mating Flanges ¬
TT 600# Fisher (249B/259B) in carbon steel
TU 600# Fisher (249C) in stainless steel
UT 600# Masoneilan flange in carbon steel
UU 600# Masoneilan flange in stainless steel
¿ Confirm mounting conditions/nozzle diameter to ensure sufficient clearance.
¡ Only available with 3rd digit = T.
¡ Always check dimensions if ANSI/EN flanges are not used.

7
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 79


3.7.2 Enlarged Coaxial Probe continued

6 | CONSTRUCTION CODES
0 Industrial
K ASME B31.1
L ASME B31.3
M ASME B31.3 & NACE MR0175/MR0103
N NACE MR0175/MR0103

7 | FLANGE OPTIONS — Offset flanges are only available with small coaxial probes
0 None

8 | MATERIAL OF CONSTRUCTION - FLANGE/NUT/ROD/INSULATION


A 316 SS/316L SS (Probe O.D. 1.75” (45mm))
B Hastelloy C (Probe O.D. 1.93” (49mm))
C Monel (Probe O.D. 1.93” (49mm))
R 316 SS/316L SS with Carbon Steel Flange (Probe O.D. 1.75” (45 mm))
S Hastelloy C with Carbon Steel Flange (Probe O.D. 1.93” (49mm))
T Monel with Carbon Steel Flange (Probe O.D. 1.93” (49mm))

9 | SPACER MATERIAL
1 TFE (+400 °F/+200 °C) — Only available with 3rd digit P or T — εr ≥ 1.4
2 PEEK HT — Only available with 3rd digit D (+650 °F/+345 °C) — εr ≥ 1.4
3 Ceramic (High Temp. >+800 °F/+425 °C) — Only available with 3rd digit D — εr ≥ 2.0
4 Duratron® CU60 PBI (+800 °F/+425 °C) — Only available with 3rd digit D — εr ≥ 1.4
5 None - with metal shorting rod — εr ≥ 1.4 — Future

10 | O-RING MATERIALS/SEAL OPTIONS


0 Viton® GFLT — Only available with 3rd digit T
2 Kalrez 4079 — Only available with 3rd digit T
8 Aegis PF 128 (NACE) — Only available with 3rd digit T
A Kalrez 6375 — Only available with 3rd digit T
B HF Acid Probe — Only available with 3rd digit T and 8th digit C
None/Glass Ceramic Alloy (Dual Seal Design with annunciator fitting)
D
Only available with 3rd digit D or P
N None/Glass Ceramic Alloy — Only available with 3rd digit D or P

11 | PROBE SIZE/ELEMENT TYPE/FLUSHING CONNECTION


0 Standard Enlarged Coaxial Probe
1 Standard Enlarged Coaxial Probe with Flushing Port

12 | SPECIAL OPTIONS — See page 89


0 Single Length Probe (Non-Segmented)
1 1-piece Enlarged Segmented Probe OD=2.5”(64mm)
2 2-piece Enlarged Segmented Probe OD=2.5”(64mm)
3 3-piece Enlarged Segmented Probe OD=2.5”(64mm)
4 4-piece Enlarged Segmented Probe OD=2.5”(64mm)
5 5-piece Enlarged Segmented Probe OD=2.5"(64mm)
6 6-piece Enlarged Segmented Probe OD=2.5"(64mm)

13 14 15 | INSERTION LENGTH
See page 89
inches (012 – 396)
XXX cm (030 – 999)
unit of measure determined by
2nd digit of model number

7 0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

80 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.7.3 Small Coaxial Probe
1 | TECHNOLOGY
7 Eclipse GWR Probes - Model 706

2 | MEASUREMENT SYSTEM
A English (inches)
C Metric (centimeters)

3 | CONFIGURATION/STYLE (RIGID)
D Small Coaxial, High Temp/High Pressure: Overfill w/Glass Seal (+850 °F/+450 °C) — Available only with 10th digit N or D
P Small Coaxial, High Pressure: Overfill w/Glass Seal (+400 °F/+200 °C) — Available only with 10th digit N or D
S Coaxial, Saturated Steam (up to +800 °F/+425 °C) — Available only with 10th digit N, 9th digit 2, 3 or 5
T Small Coaxial, Overfill Standard O-Ring Seal (+400 °F/+200 °C) — NOT available with 10th digit N or D

4 5 | PROCESS CONNECTION – SIZE/TYPE (consult factory for other process connections)


Threaded
4⁄ " NPT Thread ¬ 1" BSP (G1) Thread ¬
3
11 22
41 2" NPT Thread — Available only with 3rd digit D 42 2" BSP (G1) Thread — Available only with 3rd digit D
52 3" BSP (G1) Thread ƒ
ASME Flanges
23 1" 150# ASME RF ¿ √ 38 11⁄2" 2500# ASME RF √ 53 3" 150# ASME RF 63 4" 150# ASME RF
24 1" 300# ASME RF ¿ √ 3N 11⁄2" 2500# ASME RTJ √ 54 3" 300# ASME RF 64 4" 300# ASME RF
25 1" 600# ASME RF ¿ √ 43 2" 150# ASME RF 55 3" 600# ASME RF 65 4" 600# ASME RF
2K 1" 600# ASME RTJ ¿ √ 44 2" 300# ASME RF 56 3" 900# ASME RF 66 4" 900# ASME RF
33 11⁄2" 150# ASME RF √ 45 2" 600# ASME RF 57 3" 1500# ASME RF 67 4" 1500# ASME RF
34 11⁄2" 300# ASME RF √ 47 2" 900/1500# ASME RF 58 3" 2500# ASME RF 68 4" 2500# ASME RF
35 11⁄2" 600# ASME RF √ 48 2" 2500# ASME RF 5K 3" 600# ASME RTJ 6K 4" 600# ASME RTJ
3K 11⁄2" 600# ASME RTJ √ 4K 2" 600# ASME RTJ 5L 3" 900# ASME RTJ 6L 4" 900# ASME RTJ
37 11⁄2" 900/1500# ASME RF√ 4M 2" 900/1500# ASME RTJ 5M 3" 1500# ASME RTJ 6M 4" 1500# ASME RTJ
3M 11⁄2" 900/1500# ASME RTJ√ 4N 2" 2500# ASME RTJ 5N 3" 2500# ASME RTJ 6N 4" 2500# ASME RTJ
EN Flanges
BB DN 25, PN 16/25/40 EN 1092-1 TYPE A ¿ ¬ EA DN 80, PN 16 EN 1092-1 TYPE A
BC DN 25, PN 63/100 EN 1092-1 TYPE B2 ¿ ¬ EB DN 80, PN 25/40 EN 1092-1 TYPE A
CB DN 40, PN 16/25/40 EN 1092-1 TYPE A ¬ ED DN 80, PN 63 EN 1092-1 TYPE B2
CC DN 40, PN 63/100 EN 1092-1 TYPE B2 ¬ EE DN 80, PN 100 EN 1092-1 TYPE B2
CF DN 40, PN 160 EN 1092-1 TYPE B2 ¬ EF DN 80, PN 160 EN 1092-1 TYPE B2
CG DN 40, PN 250 EN 1092-1 TYPE B2 ¬ EG DN 80, PN 250 EN 1092-1 TYPE B2
CH DN 40, PN 320 EN 1092-1 TYPE B2 ¬ EH DN 80, PN 320 EN 1092-1 TYPE B2
CJ DN 40, PN 400 EN 1092-1 TYPE B2 ¬ E J DN 80, PN 400 EN 1092-1 TYPE B2
DA DN 50, PN 16 EN 1092-1 TYPE A FA DN 100, PN 16 EN 1092-1 TYPE A
DB DN 50, PN 25/40 EN 1092-1 TYPE A FB DN 100, PN 25/40 EN 1092-1 TYPE A
DD DN 50, PN 63 EN 1092-1 TYPE B2 FD DN 100, PN 63 EN 1092-1 TYPE B2
DE DN 50, PN 100 EN 1092-1 TYPE B2 FE DN 100, PN 100 EN 1092-1 TYPE B2
DF DN 50, PN 160 EN 1092-1 TYPE B2 FF DN 100, PN 160 EN 1092-1 TYPE B2
DG DN 50, PN 250 EN 1092-1 TYPE B2 FG DN 100, PN 250 EN 1092-1 TYPE B2
DH DN 50, PN 320 EN 1092-1 TYPE B2 FH DN 100, PN 320 EN 1092-1 TYPE B2
DJ DN 50, PN 400 EN 1092-1 TYPE B2 FJ DN 100, PN 400 EN 1092-1 TYPE B2
Torque Tube Mating Flanges ¡
TT 600# Fisher (249B/259B) in carbon steel
TU 600# Fisher (249C) in stainless steel
UT 600# Masoneilan flange in carbon steel
UU 600# Masoneilan flange in stainless steel
¿ Confirm mounting conditions/nozzle diameter to ensure suffi- ¬ Not available with 3rd digit ‘D’
cient clearance. √ Not available with 3rd Digit D or P
¡ Always check dimensions if ASME/EN flanges are not used. ƒ Only available with 3rd digit = T

7
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 81


3.7.3 Small Coaxial Probe continued

6 | CONSTRUCTION CODES
0 Industrial
K ASME B31.1 — NOT available with 4th digits T or U
L ASME B31.3
M ASME B31.3 & NACE MR0175/MR0103 — NOT available with carbon steel flange
N NACE MR0175/MR0103 — NOT available with carbon steel flange

7 | FLANGE OPTIONS — Offset flanges are available only with small coaxial probes
0 None
1 Offset (For use with AURORA)
2 Offset with 1⁄2" NPT Vent (For use with AURORA)
3 Offset with 3⁄4" NPT Vent (For use with AURORA)

8 | MATERIAL OF CONSTRUCTION - FLANGE/NUT/ROD/INSULATION


A 316 SS/316L SS
B Hastelloy C — NOT available with 3rd digit S
C Monel — NOT available with 3rd digit S
R 316 SS/316L SS with Carbon Steel Flange
S Hastelloy C with Carbon Steel Flange
T Monel with Carbon Steel Flange — NOT available with 3rd digit S

9 | SPACER MATERIAL
1 TFE (+400 °F/+200 °C) — Available only with 3rd digit P or T — εr ≥ 1.4
2 PEEK HT — Available only with 3rd digit D — εr ≥ 1.4 (+650 °F/+345 °C) or S (+575 °F/+300 °C)
3 Ceramic (Temp. +800 °F/+425 °C) — Available only with 3rd digit D with εr ≥ 2.0 or with 3rd digit S*
5 None - Single bottom metal spacer — Available only with 3rd digit S* and 11th digit B*
* Not available with 5th digit 1 or 2.

10 | O-RING MATERIALS/SEAL OPTIONS


0 Viton® GFLT — Available only with 3rd digit T
2 Kalrez® 4079 — Available only with 3rd digit T
8 Aegis PF 128 (NACE) — Available only with 3rd digit T
A Kalrez 6375 — Available only with 3rd digit T
B HF Acid Probe — Available only with 3rd digit T and 8th digit C
D None/Glass Ceramic Alloy (dual-seal design with annunciator fitting)—Available only with 3rd digit D or P
N None/Glass Ceramic Alloy — Available only with 3rd digit D, P or S

11 | PROBE SIZE/ELEMENT TYPE/FLUSHING CONNECTION


2 Small Coaxial (0.875 inches/22 mm)
B Large Coaxial (1.62 inches/42 mm) ≈
≈ 120 inches (305 cm) maximum length

12 | SPECIAL OPTIONS
0 Single Length Probe (Non-Segmented)

13 14 15 | INSERTION LENGTH
inches (012 – 240)
XXX cm (030 – 610)
unit of measure determined by
2nd digit of model number

7 0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

82 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.7.4 Caged Probe
1 | TECHNOLOGY
7 Eclipse GWR Probes - Model 706

2 | MEASUREMENT SYSTEM
A English (inches)
C Metric (centimeters)

3 | CONFIGURATION/STYLE (RIGID)
G Overfill Caged Rigid Probe for use in chambers +400 °F (+200 °C) — Available only with 2", 3" and 4" flanges
Overfill Caged High Temp/High Pressure Probe with Glass Seal for use in chambers +850 °F (+450 °C)
J
Only available with 2", 3" and 4" flanges
Overfill Caged High Pressure Probe with Glass Seal for use in chambers +400 °F (+200 °C)
L
Only available with 2", 3" and 4" flanges

4 5 | PROCESS CONNECTION – SIZE/TYPE (consult factory for other process connections) ¿


ASME Flanges
43 2" 150# ASME RF 54 3" 300# ASME RF 63 4" 150# ASME RF
44 2" 300# ASME RF 55 3" 600# ASME RF 64 4" 300# ASME RF
45 2" 600# ASME RF 56 3" 900# ASME RF 65 4" 600# ASME RF
47 2" 900/1500# ASME RF 57 3" 1500# ASME RF 66 4" 900# ASME RF
48 2" 2500# ASME RF 58 3" 2500# ASME RF 67 4" 1500# ASME RF
4K 2" 600# ASME RTJ 5K 3" 600# ASME RTJ 68 4" 2500# ASME RF
4M 2" 900/1500# ASME RTJ 5L 3" 900# ASME RTJ 6K 4" 600# ASME RTJ
4N 2" 2500# ASME RTJ 5M 3" 1500# ASME RTJ 6L 4" 900# ASME RTJ
53 3" 150# ASME RF 5N 3" 2500# ASME RTJ 6M 4" 1500# ASME RTJ
6N 4" 2500# ASME RTJ
EN Flanges
DA DN 50, PN 16 EN 1092-1 TYPE A EF DN 80, PN 160 EN 1092-1 TYPE B2
DB DN 50, PN 25/40 EN 1092-1 TYPE A EG DN 80, PN 250 EN 1092-1 TYPE B2
DD DN 50, PN 63 EN 1092-1 TYPE B2 EH DN 80, PN 320 EN 1092-1 TYPE B2
DE DN 50, PN 100 EN 1092-1 TYPE B2 E J DN 80, PN 400 EN 1092-1 TYPE B2
DF DN 50, PN 160 EN 1092-1 TYPE B2 FA DN 100, PN 16 EN 1092-1 TYPE A
DG DN 50, PN 250 EN 1092-1 TYPE B2 FB DN 100, PN 25/40 EN 1092-1 TYPE A
DH DN 50, PN 320 EN 1092-1 TYPE B2 FD DN 100, PN 63 EN 1092-1 TYPE B2
DJ DN 50, PN 400 EN 1092-1 TYPE B2 FE DN 100, PN 100 EN 1092-1 TYPE B2
EA DN 80, PN 16 EN 1092-1 TYPE A FF DN 100, PN 160 EN 1092-1 TYPE B2
EB DN 80, PN 25/40 EN 1092-1 TYPE A FG DN 100, PN 250 EN 1092-1 TYPE B2
ED DN 80, PN 63 EN 1092-1 TYPE B2 FH DN 100, PN 320 EN 1092-1 TYPE B2
EE DN 80, PN 100 EN 1092-1 TYPE B2 FJ DN 100, PN 400 EN 1092-1 TYPE B2

Torque Tube Mating Flanges ¡


TT 600# Fisher (249B/259B) in carbon steel
UT 600# Masoneilan flange in carbon steel
UU 600# Masoneilan flange in stainless steel
¿ Confirm mounting conditions/nozzle diameter to ensure sufficient clearance.
¡ Always check dimensions if ASME/EN flanges are not used.

7
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 83


3.7.4 Caged Probe continued

6 | CONSTRUCTION CODES
0 Industrial
K ASME B31.1
L ASME B31.3
M ASME B31.3 & NACE MR0175/MR0103 — Not available with carbon steel flange
N NACE MR0175/MR0103 — Not available with carbon steel flange

7 | FLANGE OPTIONS
0 None
1 Offset (For use with AURORA) – 4" available only with 3rd digit G and J and 4th digit 6
2 Offset with 12⁄ " NPT Vent (For use with AURORA)–4" available only with 3rd digit G and J and 4th digit 6
3 Offset with 34⁄ " NPT Vent (For use with AURORA)–4" available only with 3rd digit G and J and 4th digit 6

8 | MATERIAL OF CONSTRUCTION - MFG/NUT/ROD/INSULATION


A 316 SS/316L SS
B Hastelloy C
C Monel
R 316 SS/316L SS with Carbon Steel Flange
S Hastelloy C with Carbon Steel Flange
T Monel with Carbon Steel Flange

9 | SPACER MATERIAL
2 PEEK HT (+650 °F/+345 °C)
3 Ceramic (High Temp.>+800 °F/+425 °C) — Available only with 3rd digit J
4 Duratron® CU60 PBI (+800 °F/+425 °C) — Available only with 3rd digit J

10 | O-RING MATERIALS/SEAL OPTIONS


0 Viton® GFLT — NOT available with 3rd digit J or L
2 Kalrez 4079 — NOT available with 3rd digit J or L
8 Aegis PF 128 (NACE) — NOT available with 3rd digit J or L
A Kalrez 6375 — NOT available with 3rd digit J or L
B HF Acid Probe — Available only with 3rd digit G and 8th digit C
None/Glass Ceramic Alloy (Dual Seal Design with annunciator
D
fitting) — NOT available with 3rd digit G
N None/Glass Ceramic Alloy — NOT available with 3rd digit G

11 | PROBE SIZE/ELEMENT TYPE/FLUSHING CONNECTION


0 None

12 | SPECIAL OPTIONS — See page 89


1 Single Length Removable Probe
2 2-piece Segmented Probe
3 3-piece Segmented Probe
4 4-piece Segmented Probe

13 14 15 | INSERTION LENGTH
See page 89
inches (012 – 288)
XXX cm (030 – 732)
unit of measure determined by
2nd digit of model number

7 0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

84 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.7.5 Single Rod Rigid Probe
1 | TECHNOLOGY
7 Eclipse GWR Probes - Model 706

2 | MEASUREMENT SYSTEM
A English (inches)
C Metric (centimeters)

3 | CONFIGURATION/STYLE (RIGID)
F Single Rod, Standard (+400 °F/200 °C) for in-tank applications NOT available with 10th digit N or D
M Single Rod, High Pressure Probe with glass seal (+400 °F/+200 °C), for in-tank applications. Available only with 10th digit N or D
N Single Rod, High Temp/High Pressure with glass seal (+850 °F/+450 °C), for in-tank applications. Available only with 10th digit N or D

4 5 | PROCESS CONNECTION – SIZE/TYPE (consult factory for other process connections) ¿


Threaded
4⁄ " NPT Thread ¡ 1" BSP (G1) Thread ¡
3
11 22
21 1" NPT Thread ¡ 42 2" BSP (G1) Thread
41 2" NPT Thread

ASME Flanges
33 112⁄ " 150# ASME RF ¿ ¬ 4N 2" 2500# ASME RTJ 5N 3" 2500# ASME RTJ
34 112⁄ " 300# ASME RF ¿ ¬ 53 3" 150# ASME RF 63 4" 150# ASME RF
35 112⁄ " 600# ASME RF ¿ ¬ 54 3" 300# ASME RF 64 4" 300# ASME RF
43 2" 150# ASME RF ¿ 55 3" 600# ASME RF 65 4" 600# ASME RF √
44 2" 300# ASME RF ¿ 56 3" 900# ASME RF 66 4" 900# ASME RF √
45 2" 600# ASME RF ¿ 57 3" 1500# ASME RF 67 4" 1500# ASME RF √
47 2" 900/1500# ASME RF 58 3" 2500# ASME RF 68 4" 2500# ASME RF √
48 2" 2500# ASME RF 5K 3" 600# ASME RTJ 6K 4" 600# ASME RTJ √
4K 2" 600# ASME RTJ 5L 3" 900# ASME RTJ 6L 4" 900# ASME RTJ √
4M 2" 900/1500# ASME RTJ 5M 3" 1500# ASME RTJ 6M 4" 1500# ASME RTJ √
6N 4" 2500# ASME RTJ √
EN Flanges
CB DN 40, PN 16/25/40 EN 1092-1 TYPE A ED DN 80, PN 63 EN 1092-1 TYPE B2
CC DN 40, PN 63/100 EN 1092-1 TYPE B2 EE DN 80, PN 100 EN 1092-1 TYPE B2
CF DN 40, PN 160 EN 1092-1 TYPE B2 EF DN 80, PN 160 EN 1092-1 TYPE B2 √
CG DN 40, PN 250 EN 1092-1 TYPE B2 EG DN 80, PN 250 EN 1092-1 TYPE B2 √
DA DN 50, PN 16 EN 1092-1 TYPE A ¿ EH DN 80, PN 320 EN 1092-1 TYPE B2 √
DB DN 50, PN 25/40 EN 1092-1 TYPE A ¿ E J DN 80, PN 400 EN 1092-1 TYPE B2 √
DD DN 50, PN 63 EN 1092-1 TYPE B2 ¿ FA DN 100, PN 16 EN 1092-1 TYPE A
DE DN 50, PN 100 EN 1092-1 TYPE B2 ¿ FB DN 100, PN 25/40 EN 1092-1 TYPE A
DF DN 50, PN 160 EN 1092-1 TYPE B2 √ FD DN 100, PN 63 EN 1092-1 TYPE B2
DG DN 50, PN 250 EN 1092-1 TYPE B2 √ FE DN 100, PN 100 EN 1092-1 TYPE B2
DH DN 50, PN 320 EN 1092-1 TYPE B2 √ FF DN 100, PN 160 EN 1092-1 TYPE B2 √
DJ DN 50, PN 400 EN 1092-1 TYPE B2 √ FG DN 100, PN 250 EN 1092-1 TYPE B2 √
EA DN 80, PN 16 EN 1092-1 TYPE A ¿ FH DN 100, PN 320 EN 1092-1 TYPE B2 √
EB DN 80, PN 25/40 EN 1092-1 TYPE A FJ DN 100, PN 400 EN 1092-1 TYPE B2 √
¿ Confirm mounting conditions/nozzle diameter to ensure sufficient clearance.
¡ Not available with 3rd Digit N or 8th Digit P
¬ Not available with 3rd Digit M or N
√ Available only with 3rd Digit M or N

7
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 85


3.7.5 Single Rigid Rod Probe continued

6 | CONSTRUCTION CODES
0 Industrial
K ASME B31.1
L ASME B31.3
M ASME B31.3 & NACE MR0175/MR0103 – NOT available with Carbon Steel Flange
N NACE MR0175/MR0103 – NOT available with Carbon Steel Flange

7 | FLANGE OPTIONS
0 None

8 | MATERIAL OF CONSTRUCTION - MFG/NUT/ROD/INSULATION


A 316 SS/316L SS
B Hastelloy C
C Monel
F Faced Flange, PFA coated wetted surfaces — Available only with Digit 3rd digit F
P PFA coated rod — Available only with Digit 3rd digit F
R 316 SS/316L SS with Carbon Steel Flange
S Hastelloy C with Carbon Steel Flange
T Monel with Carbon Steel Flange

9 | SPACER MATERIAL
0 None – NOT available with 3rd Digit N
2 PEEK HT (+650 °F/+345 °C) — Available only with 3rd digit N
3 Ceramic (High Temp.>+800 °F/+425 °C) — Available only with 3rd digit N
4 Duratron® CU60 PBI (+800 °F/+425 °C) — Available only with 3rd digit N

10 | O-RING MATERIALS/SEAL OPTIONS


0 Viton® GFLT — NOT available with 3rd digit M or N
2 Kalrez 4079 — NOT available with 3rd digit M or N
8 Aegis PF 128 (NACE) — NOT available with 3rd digit M or N
A Kalrez 6375 — NOT available with 3rd digit M or N
None/Glass Ceramic Alloy Dual Seal with annunciator
D
fitting — NOT available with 3rd digit F
N None/Glass Ceramic Alloy Dual Seal — NOT available with 3rd digit F

11 | PROBE SIZE/ELEMENT TYPE/FLUSHING CONNECTION


0 Standard Single Rod

12 | SPECIAL OPTIONS
Non-Removable Rod
0
Available only with PFA Coated Probes(8th digit F or P)
Removable Rod
1
NOT available with PFA Coated Probes(8th Digit F or P)
2 Two-piece segmented probe
3 Three-piece segmented probe
4 Four-piece segmented probe
5 Five-piece segmented probe
6 Six-piece segmented probe

13 14 15 | INSERTION LENGTH
inches (012 – 288)
cm (030 – 732)
XXX
maximum 240 inches (610 cm)
when 8th digit = F or P
unit of measure determined by
2nd digit of model number

7 0 0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

86 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.7.6 Single Cable Flexible Probe
1 | TECHNOLOGY
7 Eclipse GWR Probes - Model 706

2 | MEASUREMENT SYSTEM
A English (inches)
C Metric (centimeters)

3 | SPECIALTY FLEXIBLE PROBES


1 Single Cable Flexible standard for in-tank applications (+400 °F/+200 °C)
2 Single Cable Flexible Light Duty Bulk Solids
3 Single Cable Flexible HTHP for in-tank applications (+850 °F/+450 °C)
6 Single Cable Flexible HTHP for chamber applications (+850 °F/+450 °C)

4 5 | PROCESS CONNECTION – SIZE/TYPE (consult factory for other process connections)


Threaded
41 2" NPT Thread (not available with the 7y6) 42 2" BSP (G1) Thread (not available with the 7y6)

ASME Flanges
43 2" 150# ASME RF ¿ 53 3" 150# ASME RF 63 4" 150# ASME RF
44 2" 300# ASME RF ¿ 54 3" 300# ASME RF 64 4" 300# ASME RF
45 2" 600# ASME RF ¿ 55 3" 600# ASME RF 65 4" 600# ASME RF
47 2" 900/1500# ASME RF 56 3" 900# ASME RF 66 4" 900# ASME RF ¡
48 2" 2500# ASME RF 57 3" 1500# ASME RF 67 4" 1500# ASME RF ¡
4K 2" 600# ASME RTJ 58 3" 2500# ASME RF 68 4" 2500# ASME RF ¡
4M 2" 900/1500# ASME RTJ 5K 3" 600# ASME RTJ 6K 4" 600# ASME RTJ ¡
4N 2" 2500# ASME RTJ 5L 3" 900# ASME RTJ 6L 4" 900# ASME RTJ ¡
5M 3" 1500# ASME RTJ 6M 4" 1500# ASME RTJ ¡
5N 3" 2500# ASME RTJ 6N 4" 2500# ASME RTJ ¡
EN Flanges
DA DN 50, PN 16 EN 1092-1 TYPE A ¿ EF DN 80, PN 160 EN 1092-1 TYPE B2 ¡
DB DN 50, PN 25/40 EN 1092-1 TYPE A ¿ EG DN 80, PN 250 EN 1092-1 TYPE B2 ¡
DD DN 50, PN 63 EN 1092-1 TYPE B2 ¿ EH DN 80, PN 320 EN 1092-1 TYPE B2 ¡
DE DN 50, PN 100 EN 1092-1 TYPE B2 ¿ E J DN 80, PN 400 EN 1092-1 TYPE B2 ¡
DF DN 50, PN 160 EN 1092-1 TYPE B2 ¡ FA DN 100, PN 16 EN 1092-1 TYPE A
DG DN 50, PN 250 EN 1092-1 TYPE B2 ¡ FB DN 100, PN 25/40 EN 1092-1 TYPE A
DH DN 50, PN 320 EN 1092-1 TYPE B2 ¡ FD DN 100, PN 63 EN 1092-1 TYPE B2
DJ DN 50, PN 400 EN 1092-1 TYPE B2 ¡ FE DN 100, PN 100 EN 1092-1 TYPE B2
EA DN 80, PN 16 EN 1092-1 TYPE A ¿ FF DN 100, PN 160 EN 1092-1 TYPE B2 ¡
EB DN 80, PN 25/40 EN 1092-1 TYPE A FG DN 100, PN 250 EN 1092-1 TYPE B2 ¡
ED DN 80, PN 63 EN 1092-1 TYPE B2 FH DN 100, PN 320 EN 1092-1 TYPE B2 ¡
EE DN 80, PN 100 EN 1092-1 TYPE B2 FJ DN 100, PN 400 EN 1092-1 TYPE B2 ¡

¿ Confirm mounting conditions/nozzle diameter to ensure sufficient clearance.


¡ Only available with 3rd Digit 3 or 6

7
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 87


3.7.6 Single Cable Flexible Probe continued

6 | CONSTRUCTION CODES
0 Industrial
L ASME B31.3
M ASME B31.3 & NACE MR0175 / ISO 15156 & MR0103 — Available when digit 8 = A, F, or P
N NACE MR0175 / ISO 15156 & MR0103 — Available when digit 8 = A, F, or P

7 | FLANGE OPTIONS
0 None

8 | MATERIAL OF CONSTRUCTION - MFG/NUT/ROD/INSULATION


A 316 SS/316L SS
F Faced Flange, PFA Coated Wetted Surfaces — Available only with 3rd digit 1
P PFA Coated 316/316L SS Cable – Available only with 3rd digit 1
R 316 SS/316L SS with Carbon Steel Flange

9 | SPACER/WEIGHT MATERIAL
0 No Spacer — Not available with 3rd digit 3
1 PTFE Spacer — Available only with 3rd digit 3
4 Celazole® Spacer — Available only with 3rd digit 6
5 Metal Weight — Available only with 3rd digit 3

10 | O-RING MATERIALS/SEAL OPTIONS


0 Viton® GFLT
2 Kalrez 4079
8 Aegis PF 128 (NACE)
A Kalrez 6375
Glass Ceramic Alloy Dual Seal with annunciator fitting —
D
Available only with 3rd digit 3 or 6
N None/Glass Ceramic Alloy Dual Seal – Available only with 3rd digit 3 or 6

11 | PROBE SIZE/ELEMENT TYPE/FLUSHING CONNECTION


3 Flexible Cable Probe

12 | SPECIAL OPTIONS
Non-removable Probe Cable
0
Only available with 3rd digit 2 or 8th digit F
Removable Single-piece Probe Cable
1
Only available with 3rd digit 1, 3 and 6

13 14 15 | INSERTION LENGTH
feet (003 – 100)
XXX meters (001 – 030)

unit of measure determined by


2nd digit of model number

7 0 3
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

88 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


3.7.7 Segmented Probe Options
12th Digit of Model Number

One Two Three Four Five Six


Probe Model Segment Segments Segments Segments Segments Segments

Coaxial Models
7yD, 7yP and 7yT
24 – 72" 48 – 144" 72 – 216" 96 – 288" 120 – 360" 144 – 396"
(Enlarged versions only)
(60 – 182 cm) (120 – 365 cm) (180 – 548 cm) (240 – 731 cm) (305 – 914 cm) (365 – 999 cm)
(3", DN 80 Process
Connections and larger)

Caged Models 12 – 120" 24 – 240" 36 – 288" 48 – 288"


Not Available Not Available
7yG, 7yL and 7yJ (30 – 305 cm) (60 – 610 cm) (90 – 732 cm) (120 – 732 cm)

NOTE: Segments will be evenly divided over the length of the probe.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 89


3.8 Parts
3.8.1 Replacement Parts

8
5

TB1

J1
- +
3 6
CURRENT LOOP
R

1
4
R

Electronics:
Digit: 1 2 3 4 5 6 7 8 9 10
Part Number: 7 0 6 5 Serial Number: 7 7 7 7 0 6 7 7 7 7 7
X = product with a non-standard customer requirement See nameplate, always provide complete part number and
serial number when ordering spares.

(1) Electronic Module Replacement Part


Digit 5 Digit 6 Replacement Part (4) and (5) O-ring 012-2201-237
1 2 Z31-2849-001
(6) Housing Cover
2 0 Z31-2849-002
Digit 7 Digit 8 Digit 9 Replacement Part
3 0 Z31-2858-001
1 or A 004-9225-002
4 0 Z31-2849-001 0, 1 or 2 all
2 or B 004-9225-003
(2) Display Module 0, 1 or A 036-4413-005
1 or A
Digit 5 Digit 7 Replacement Part A, B or C 3, B, C or D 036-4413-001
0, 1 or 2 N/A all 2 or B 036-4413-002
1, 2, 3 or 4
A, B or C 089-9136-001
(7) Housing Cover
(3) Wiring PC Board Digit 9 Replacement Part
Digit 5 Digit 6 Replacement Part 1 or A 004-9225-002
1 2 Z30-9165-001 2 or B 004-9225-003
2 or 3 0 Z30-9166-002
(8) 705/706 Adapter
4 0 Z31-2859-001
Digit 9 Replacement Part
A or B 032-6923-001

90 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


Probe:
Digit: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
Part Number: 7
X = product with a non-standard customer requirement

Bottom Spacer for Single Rod GWR Probe (9) Bottom Spacer + Pin Kit
Digit 3 Digit 8 Replacement Part

A or R 089-9114-008

9 F or M B or S 089-9114-009

C or T 089-9114-010

A or R 089-9114-005

N B or S 089-9114-006
7yF, 7yM or 7yN single rod
C or T 089-9114-007

Cable Weight for Flexible GWR Probe

(10) Cable Weight Assembly

Digit 3 Replacement Part

1 089-9120-001

10

7y1 single cable

(11) Cable Weight

Digit 3 Replacement Part


11
2 004-8778-001

12
(12) Cable Clamp

Digit 3 Replacement Part

010-1731-001
2
(ordering quantity: 2)
7y2 single cable

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 91


4.0 Advanced Configuration/
Troubleshooting Techniques
This section contains information regarding some of the
advanced configuration and troubleshooting capability con-
tained within the Model 706 transmitter. These diagnostic
options are best suited for use with PACTware and the
Model 706 DTM, and should be implemented only after
contacting Magnetrol Technical Support.

4.1 End-of-Probe Analysis (EOPA)

Note that due to the operation of this method, End of


Probe Analysis cannot be applied with interface measure-
ment, applications with a "water" bottoms, or with stratify-
ing liquids. Therefore, EOPA will not be available when
Measurement Type = Interface & Level.
When EOPA is enabled and the calculated (inferred level) is
being used, a diagnostic warning shown as "Inferred Level”
will be present.

4.1.1 Enable EOPA using PACTware


Click on the Device Setup tab, and then select Advanced
Config. In the lower left corner select the correct Polarity
for the End of Probe pulse, then turn on the EoP Analysis.
The Eop Dielectric box will then appear. Fill in the correct
Dielectric of the process medium being measured.

92 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


4.1.2 Enable EOPA using keypad/LCD

From the MAIN MENU, select DEVICE SETUP and


press Enter.

Scroll down to Advanced Config, and then press Enter.

Scroll down to END of PROBE ANALYSIS, and then press


Enter.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 93


Enter the correct polarity for EoP Polarity, turn on EoP
Analysis, and then enter the correct value for EoP
Dielectric. EoP Dielectric is the dielectric constant of the
process medium being measured.

4.2 Sloped Threshold

The Sloped Threshold option contained in the Model 706


allows the user additional level detection capability by
allowing the threshold to be sloped (bent) around an
unwanted signal. The result is a convenient way to ignore
undesired signals.
The use of PACTware and the Model 706 DTM is recom-
mended for this option.
Using PACTware, click on the Device Setup tab, and then
select Advanced Config.
In the Threshold Settings section, select “Sloped” within in
the Lvl Tresh Mode dropdown box.
Then set the Sloped Start Value, Lvl Tresh Value, and
Sloped End Distance.

94 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


57-606 Eclipse Model 706 Guided Wave Radar Transmitter 95
4.3 Echo Rejection

Another way to ignore unwanted signals along the length of


the probe is by utilizing the Echo Rejection feature.

Setup using PACTware

Select the Diagnostics tab and then the Echo Curve tab.
Then click on New Rejection Curve

Click on OK at the loop warning message.

96 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


On the next screen, enter the actual process media location
and then hit OK.

A password window will then appear (unless the password


was previously entered). Enter the password and hit OK.
Then the system calculates the curve, and then saves it. Hit
OK to confirm.

A warning screen is then shown so that the loop can be


returned to automatic control.

At this point the echo rejection curve can be viewed by


selecting Rejection Curve as Curve 2 in the lower left corner
of the screen. The Rejection curve will then be displayed in
red as shown in the screenshot above.
Alternatively, you can follow the procedure below:
Select the Device Setup tab, and then select the Advanced
Config tab. Then click on New Rejection Curve.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 97


You will get a warning regarding the loop, hit OK. On the
next screen you need to enter the actual media location and
then hit OK.

Next a password window might appear if not already


entered. Then the system calculates the curve, and then
saves it. Hit OK to confirm.

98 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


A warning screen is shown that the loop can be returned to
automatic control.

At this point the echo rejection curve can be viewed by


selecting Rejection Curve as Curve 2 in the lower left corner
of the Echo Curve screen. The Rejection curve will then be
displayed in red as shown in the screenshot below.

4.4 Buildup Detection

A unique feature contained within the Model 706 can be


used to obtain an indication of build-up along the length of
the probe. This can be set as the HART SV or TV which
can be monitored in the control room. An algorithm com-
pares the buildup echo strength as compared to the Lvl
Thrsh Value, and outputs value in percent.

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 99


4.4.1 Buildup Detection Setup using PACTware

Buildup detection is a feature that needs to be turned on in


Advanced Config, see below.

Once turned on progress can be checked in the Advanced


Diagnostics screen, see below.

100 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


4.4.2 Buildup Detection Setup using the Keypad

From the menu select DEVICE SETUP and hit Enter.

Scroll down to ADVANCED CONFIG and hit Enter;


then, select On and hit Enter

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 101


Checking buildup can be done from the main display
screen. First the unit must be set up to display the Buildup
percentage. Go to the main menu and select DEVICE
SETUP then hit Enter.

Scroll down to DISPLAY CONFIG and hit Enter.

Scroll down to Probe Buildup and hit Enter, then select


View. From the main screen the Buildup percentage is now
shown.

102 57-606 Eclipse Model 706 Guided Wave Radar Transmitter


NOTES

57-606 Eclipse Model 706 Guided Wave Radar Transmitter 103


ASSURED QUALITY & SERVICE COST LESS

Service Policy Return Material Procedure


Owners of Magnetrol controls may request the return of So that we may efficiently process any materials that are
a control or any part of a control for complete rebuilding returned, it is essential that a “Return Material
or replacement. They will be rebuilt or replaced prompt- Authorization” (RMA) number be obtained from the
ly. Controls returned under our service policy must be factory prior to the material’s return. This is available
returned by prepaid transportation. through a Magnetrol local representative or by contacting
Magnetrol will repair or replace the control at no cost to the factory. Please supply the following information:
the purchaser (or owner) other than transportation if:
1. Company Name
1. Returned within the warranty period; and 2. Description of Material
2. The factory inspection finds the cause of the claim to 3. Serial Number
be covered under the warranty. 4. Reason for Return
If the trouble is the result of conditions beyond our con- 5. Application
trol; or, is NOT covered by the warranty, there will be
Any unit that was used in a process must be properly
charges for labor and the parts required to rebuild or
cleaned in accordance with OSHA standards, before it is
replace the equipment.
returned to the factory.
In some cases it may be expedient to ship replacement
parts; or, in extreme cases a complete new control, to A Material Safety Data Sheet (MSDS) must accompany
replace the original equipment before it is returned. If this material that was used in any media.
is desired, notify the factory of both the model and serial All shipments returned to the factory must be by prepaid
numbers of the control to be replaced. In such cases, credit transportation.
for the materials returned will be determined on the basis
of the applicability of our warranty. All replacements will be shipped F.O.B. factory.
No claims for misapplication, labor, direct or consequen-
tial damage will be allowed.

Maintenance Policy
With proper Eclipse Guided Wave Radar (GWR) probe selection, there is virtually no maintenance required for a Model
706 system. As explained in Section 3.3.5, application-related issues, such as coating or bridging on the probe can occur.
Therefore, although internal diagnostics can be utilized to proactively display overall system degradation, a periodic visu-
al inspection of he probe is recommended. Refer to Section 3.8 for replacement parts.
24/7 Technical Support assistance is available at 1-630-723-6730 or [email protected].

Eclipse Guided Wave Radar transmitters may be protected by one or more of the following U.S. Patent Nos. US 6,062,095:
US 6,247,362; US 6,588,272; US 6,626,038; US 6,640,629; US 6,642,807; US 6,690,320; US 6,750,808; US 6,801,157;
US 6,867,729; US 6,879,282; 6,906,662. May depend on model. Other patents pending.

705 Enterprise Street • Aurora, Illinois 60504-8149 USA


630.969.4000 • [email protected] • ametek-measurement.com
BULLETIN: 57-606.22
Copyright © 2023 AMETEK Magnetrol USA, LLC EFFECTIVE: December 2023
SUPERCEDES: September 2023

You might also like