SECTION 4

Page

4.40. Vehicle Tanks Used as Measures 4-3

4.41. Liquid Measures 4-7

4.42. Farm Milk Tanks 4-9

4.43. Measure-Containers 4-13

4.44. Graduates 4-15

4.45. Dry Measures 4-19

4.46. Berry Baskets and Boxes 4-21


 8GJKENG6CPMU7UGFCU/GCUWTGU

Sec. 4.40. Vehicle Tanks Used as Measures

A. Application compartments are full or empty, and whether or not the

delivery is through a manifold.
A.1. - This code applies to vehicle tanks when these are
used as commercial measures. S.1.4. Fill or Inspection Opening. - The fill or
inspection opening of a compartment shall be of such
A.2. - This code does not apply to the following devices: size and location that it can readily be determined by
visual inspection that the compartment has been properly
(a) Devices used solely for dispensing a product in filled or completely emptied and shall be so positioned
connection with operations in which the amount with respect to the ends of the compartment that the
dispensed does not affect customer charges. indicator may be positioned as required. In no case shall
the opening, if circular, have a diameter of less than
(b) Meters mounted on vehicle tanks (for which see Sec. 20 cm (7-5/8 in), or, if other than circular, have an
3.31; Code for Vehicle-Tank Meters). effective area of less than 290 cm2 (45 in2).

A.3. - Also see Sec. 1.10; General Code requirements. S.1.5. Dome Flange and Baffle Plates. - Any dome
flange extending into a compartment shall be provided
with sufficient perforations or openings flush with the
S. Specifications compartment shell to prevent any trapping of air. All
baffle plates in a compartment shall be so cut away at top
and bottom, and elsewhere as necessary, as to facilitate
S.1. Design of Compartments.
loading and unloading.
S.1.1. Compartment Distortion. - The shell and
bulkheads of a vehicle tank shall be so constructed that S.1.6. Compartment and Piping Capacities and
under any condition of liquid lading they will not become Emergency Valve. - If a compartment is equipped with
distorted sufficiently to cause a change in the capacity of an emergency (or safety) valve, this shall be positioned
any compartment (as determined by volumetric test) at the lowest point of outlet from the compartment, and
equal to more than 0.25 L per 750 L (0.5 pt per 200 gal), the compartment capacity or capacities shall be construed
or fraction thereof, of the nominal compartment capacity, as excluding the capacity of the piping leading
or to more than 0.5 L (1 pt), whichever is greater. (This therefrom. However, the capacity of the piping leading
specification prescribes a limit on permissible distortion from such a compartment shall be separately determined
only, and is not to be construed as setting up a secondary and reported, and may be separately marked as specified
tolerance on compartment capacities to be added to the in S.4.
values given in tolerance paragraph T.2.)
S.1.6.1. On Vehicle Tanks Equipped for Bottom
S.1.2. Venting. - During filling operations, effective Loading. - On equipment designed for bottom
venting of a compartment shall be provided to permit air loading, the compartment capacity shall include the
to escape from all spaces designed to be filled with liquid piping of a compartment to the valve located on the
and to permit the influx of air to the compartment during upstream side of the manifold and immediately
the discharge of liquid therefrom. Venting shall prevent adjacent thereto or, if not manifolded, to the outlet
any formation of air pockets. valve, provided that on or immediately adjacent to the
marking as specified in S.4. the following words or a
S.1.3. Completeness of Delivery. - A tank shall be so statement of similar meaning shall be affixed:
constructed that, when it is standing on a level surface, "Warning: Emergency valves must be opened before
complete delivery can be made from any compartment checking measurement."
through its delivery faucet or valve whether other


 8GJKENG6CPMU7UGFCU/GCUWTGU

S.1.7. Expansion Space. - When a compartment is S.2.6. Adjustable Indicators. - Adequate provision
filled to the level of the highest indicator in the shall be made for conveniently affixing a security seal or
compartment, there shall remain an expansion space of at seals:
least 0.75 percent of the nominal compartment capacity
as defined by that indicator. (a) to any indicator intended to remain adjustable, so
that no adjustment of the indicator can be made
S.2. Design of Compartment Indicators. without mutilating or destroying the seal, and

S.2.1. General. - An indicator shall be so designed that (b) to any removable part to which an indicator may be
it will distinctly and unmistakably define a capacity point attached, so that the part cannot be removed
of its compartment when liquid is in contact with the without mutilating or destroying the seal.
lowest portion of the indicator.
S.2.7. Sensitiveness. - The position of any indicator in
S.2.2. Number of Indicators. - In no case shall a com- its compartment shall be such that at the level of the in-
partment be provided with more than five indicators. dicator a change of 1.0 mm (0.04 in) in the height of the
(Amended 1972) liquid surface will represent a volume change of not
more than the value of the tolerance for the nominal
S.2.3. Identification of Multiple Indicators. - If a compartment capacity as defined by that indicator.
compartment is provided with multiple indicators, each
such indicator shall be conspicuously marked with an S.3. Design of Compartment Discharge Manifold. -
identifying letter or number. When two or more compartments discharge through a
common manifold or other single outlet, effective means
S.2.4. Location. - An indicator shall be located: shall be provided to ensure:

(a) midway between the sides of its compartment; (a) that liquid can flow through the delivery line leading
from only one compartment at one time and that flow
(b) as nearly as practicable midway between the ends of liquid from one compartment to any other is
of its compartment, and in no case offset by more automatically prevented, or
than 10 percent of the compartment space or 15 cm
(6 in), whichever is less; (b) that all compartments will discharge simultaneously.

(c) so that it does not extend into, nor more than 15 cm If the discharge valves from two or more compartments are
(6 in) from, that section of the compartment defined automatically controlled so that they can only be operated
by a vertical projection of the fill opening; together, thus effectively connecting these compartments to
(Amended 1974) one another, such compartments shall, for purposes of this
paragraph, be construed to be one compartment.
(d) at a depth, measuring from the top of the dome
opening, not lower than 46 cm (18 in) for fill S.4. Marking of Compartments.
openings of less than 38 cm (15 in) in diameter, or,
if other than circular, an effective area of less than S.4.1. Compartment Identification. - Each
1130 cm2 (175 in 2), and not lower than 61 cm compartment of a multiple-compartment tank shall be
(24 in) for larger fill openings; and conspicuously identified by a letter or number marked on
the dome or immediately below the fill opening. Such
(e) to provide a clearance of not less than 5 cm (2 in) letters or numbers shall be in regular sequence from front
between indicators. to rear, and the delivery faucets or valves shall be marked
(Amended 1972) to correspond with their respective compartments.

S.2.5. Permanence. - Any indicator that is not intended S.4.2. Compartment Capacity, Single Indicator. - A
to remain adjustable and all brackets or supports shall be compartment provided with a single indicator shall be
securely welded in position. clearly, permanently, and conspicuously marked with a
statement of its capacity as defined by its indicator.


 8GJKENG6CPMU7UGFCU/GCUWTGU

S.4.3. Compartment Capacity, Multiple Indicators. - T. Tolerances

A compartment provided with two or more indicators
shall be clearly, permanently, and conspicuously marked T.1. Application.
with a statement identifying:
T.1.1. To Excess and to Deficiency. - The tolerances
(a) each indicator by a letter or number and, im- hereinafter prescribed shall be applied to errors in excess
mediately adjacent thereto, and in deficiency.

(b) the capacity of the compartment as defined by the T.2. Tolerance Values. - Maintenance and acceptance
particular indicator. tolerances shall be as shown in Table 1.

N. Notes
UR. User Requirements
N.1. Test Liquid. - Water or light fuel oil shall be used as
the test liquid for a vehicle-tank compartment. UR.1. Conditions of Use.

N.2. Evaporation and Volume Change. - Care shall be UR.1.1. Filling. - A vehicle shall stand upon a level
exercised to reduce to a minimum, evaporation losses and surface during the filling of a compartment.
volume changes resulting from changes in temperature of
the test liquid. UR.1.2. Delivering. - During a delivery, a vehicle shall
be so positioned as to assure complete emptying of a
N.3. To Deliver. - A vehicle-tank compartment shall be compartment. Each compartment shall be used for an
gauged "to deliver." If the compartment is gauged by individual delivery only; that is, an individual delivery
measuring the test liquid into the tank, the inside tank walls shall consist of the entire contents of a compartment or
shall first be thoroughly wetted. compartments.
(Amended 1976)
N.4. Gauging of Compartments. - When a compartment
is gauged to determine the proper position for an indicator
or to determine what a capacity marking should be, whether
on a new vehicle tank or following repairs or modifications
that might affect compartment capacities, tolerances are not
applicable, and the indicator shall be set and the
compartment capacity shall be marked as accurately as
practicable.

N.5. Adjustment and Remarking. - When a compartment

is found upon test to have an error in excess of the
applicable tolerance, the capacity of the compartment shall
be adjusted to agree with its marked capacity, or its marked
capacity shall be changed to agree with its capacity as
determined by the test.


8GJKENG6CPMU7UGFCU/GCUWTGU

6CDNG
/CKPVGPCPEGCPF#EEGRVCPEG6QNGTCPEGU
QP8GJKENG6CPM%QORCTVOGPVU

0QOKPCNECRCEKV[QHEQORCTVOGPV /CKPVGPCPEGCPFCEEGRVCPEGVQNGTCPEGU
ICNNQPU 'ZRTGUUGFKPSWCTVU 'ZRTGUUGFKPICNNQPU
QTNGUU  
VQKPENWUKXG  
VQKPENWUKXG  
VQKPENWUKXG  
VQKPENWUKXG  
QXGT #FFSWCTVRGTICNNQPU #FFICNNQPRGTICNNQPU
QTHTCEVKQPVJGTGQH QTHTCEVKQPVJGTGQH