MATLAB programming tips 2 - Input and Output Commands

Sep 4, 2016Download as pptx, pdf4 likes1,780 views

This document provides an overview of several Matlab commands for input/output: 1) The input command prompts the user to enter a value and stores it in a variable. The sscanf command reads data as a string and converts it to other formats. 2) The disp command displays variable values or text without variable names. The fprintf command formats and displays data on screen or writes it to a file with control over formatting. 3) The fprintf command uses formatting operators like %d, %f, and %s to control the display of different data types when combined with conversion characters.

11
Matlab Programming Tips
Part 2– Input / Output Commands (Review)
by
Shameer Koya

input Command
 input - Prompt for user input.
 Input is the simple basic command to request the
user input.
 Displays a prompt text for the user to understand
what data to be entered and waits for the user to
input a value and press the Return key.
 i = input('Enter the current value:')
 str = input(‘text’,'s') returns the entered text as a MATLAB
string, without evaluating expressions.
2

sscanf Command
 Read data as string and convert to the other formats
based on the definition.
 X = sscanf(str, format, size)
 Reads data from the vector str, converts it according to the
format, and store the results in array X.
 Argument ‘size’ is optional.
3

disp Command
 disp - (display) command displays variable values
or text on screen
 Displays each time on new line.
 Doesn't print variable name
 disp(variable_name) or disp('text string')
4

fprintf Command
 fprintf - Means file print formatted
 'fprintf' is used to formats data and displays the
results on the screen and to write the data in to a text
file.
 Can write to screen or to a file
 Can mix numbers and text in output
 Have full control of output display
 Basic Syntax is
 fprintf('Text to display')
5

 >> fprintf( 'How are you' )
 How are you>>
 Problem – Command Window displays prompt (>>) at end of text,
not at start of next line!
 To make the prompt to appear on the start of a new line,
n at the end of the fprintf text
 >> fprintf( Electrical Engineeringn' )
 Electrical Engineering
 >>
 Use n in middle of text to make MATLAB display
remainder of text on next line
 >> fprintf(' Electrical nEngineering')
 Electrical
 Engineering
6
fprintf …

 To format the display data, the formatting operators
are used.
 A formatting operator starts with a percentage
sign, %, and ends with a conversion character.
 Common conversion specifiers:
 %f fixed point (decimal always between 1's and 0.1's place,
e.g., 3.14, 56.8
 %e scientific notation, e.g, 2.99e+008
 %d integers (no decimal point shown)
 %s string of characters
 >> fprintf( 'Joe is %d weighs %f kilos', age,
weight )
 >> fprintf( 'Joe weighs %f kilos', n1 )
7
fprintf to format the output

fprintf to format the output …
 Examples
 >> age = 35;
 >> weight = 75.25;
 >> fprintf( 'Joe is %d weighs %f kilosn', age, weight )
 Joe is 35 weighs 75.250000 kilos
 >> fprintf( 'Joe weighs %4.4f kilosn', weight )
 Joe weighs 75.2500 kilos
 >> fprintf( 'Joe weighs %4.2f kilosn', weight )
 Joe weighs 75.25 kilos
8

fprintf to format the output…
 To display a percent sign, use %% in the text
 To display a single quote, use ' ' in the text (two
sequential single quotes)
 To display a backslash, use in the text (two
sequential backslashes)
9

1. MATLAB is a software package for mathematical computation, numerical computation, algorithm development, data analysis, and more. It allows matrix manipulations, plotting of functions and data, implementation of algorithms, creation of user interfaces, and interfacing with programs in other languages. 2. The document introduces basic MATLAB operations like arithmetic operations, variables, matrices, plotting, scripts and functions. It also discusses flow control and logical operations like if/else statements and loops. 3. MATLAB can be used for scientific and engineering applications like modeling, simulation, and prototyping through its implementation of algorithms, data analysis tools, and graphical capabilities for visualizing data.

Basic MATLAB Programming PPT.pptxBajiBabu17

MATLAB is a programming language optimized for engineering and scientific calculations. It started as a program for matrix mathematics but has grown into a flexible system for solving technical problems. MATLAB implements the MATLAB programming language and provides functions to make programming tasks easier. The MATLAB command window is used to evaluate expressions and view results. MATLAB can be used as a calculator by typing mathematical expressions directly into the command window.

Matlab-Data types and operatorsLuckshay Batra

This document provides an overview of data types and operators in MATLAB. It discusses the main data types including matrices, vectors, strings, structures, cell arrays, and numeric precision. It describes how to create and manipulate different data types using vectors, indexing, and the colon operator. The document also covers common operators for arithmetic, relational, logical, and bitwise operations. Structures are highlighted as useful for passing arguments to functions or making code robust against changes.

Introduction to matlab lecture 1 of 4Randa Elanwar

Dynamic memory allocation in clavanya marichamy

This document discusses dynamic memory allocation in C. It explains that dynamic allocation allows memory to be allocated at runtime, unlike static allocation which requires defining memory sizes at compile time. The key functions covered are malloc() for allocating memory blocks, calloc() for arrays and structures, realloc() for resizing allocated blocks, and free() for releasing used memory to avoid memory leaks. Examples are provided to demonstrate how each function is used.

MATLAB - Arrays and MatricesShameer Ahmed Koya

Operator precedence and associativityDr.Sandhiya Ravi

Operators take operands and perform computations. Operands and operators form expressions, which are evaluated based on operator precedence and context. Expressions can result in values or side effects. Statements specify actions and are usually executed sequentially. Operator precedence determines the order of operations in expressions and can affect results if not explicitly grouped with parentheses. Precedence levels conform to mathematical order with parentheses having highest precedence.

Matlab m files and scriptsAmeen San

The document discusses MATLAB files and functions. It describes that: 1) Functions and scripts are stored in .m files. The MATLAB workspace can be saved in .mat files for easy loading and efficient access. Plots can be saved in .fig files. 2) Scripts contain commands that run when the file is run. Functions have their own variables, accept inputs, and return outputs. 3) Comments start with % and help document code. Control flow includes conditional (if/else) and loop (for/while) statements. Functions terminate with return.

MATLAB Basics-Part1Elaf A.Saeed

Matlab is basically a high level language which has many specialized toolboxes for making things easier for us. Matlab stands for MATrix LABoratory. The first version of MATLAB was produced in the mid 1970s as a teaching tool. MATLAB started as an interactive program for doing matrix calculations. MATLAB has now grown to a high level mathematical language that can solve integrals and differential equations numerically and plot a wide variety of two and three Dimensional graphs. The expanded MATLAB is now used for calculations and simulation in companies and government labs ranging from aerospace, car design, signal analysis through to instrument control and financial analysis. In practice, it provides a very nice tool to implement numerical method. - The desktop includes these panels: Current Folder — Access your files. Command Window — Enter commands at the command line, indicated by the prompt (>>). Workspace — Explore data that you create or import from files. - what we learn: 1- Introduction to Matlab. 2- MATLAB InstallationVersion 2018. 3- Assignment. 4- Operations in MATLAB. 5- Vectors and Matrices in MATLAB.

Matlab1guest8ba004

This document provides an introduction to MATLAB. It discusses that MATLAB is a high-performance language for technical computing that integrates computation, visualization, and programming. It can be used for tasks like math and computation, algorithm development, modeling, simulation, prototyping, data analysis, and scientific graphics. MATLAB uses arrays as its basic data type and allows matrix and vector problems to be solved more quickly than with other languages. The document then provides examples of entering matrices, using basic MATLAB commands and functions, plotting graphs, and writing MATLAB code in M-files.

Loops in matlabTUOS-Sam

MatplotLib.pptxParas Intotech

Matlab practical and lab sessionDr. Krishna Mohbey

The document provides an overview of MATLAB, including what it is used for, its graphical user interface, help features, toolboxes, and how to connect to other programs. MATLAB is a numerical computing environment and programming language. It was originally designed for matrix manipulations but has been expanded to include tools for data analysis, signal processing, optimization, and more. Key aspects of MATLAB covered in the document include its command-line interface, workspace, command history, help system, built-in functions, matrices, plotting capabilities, and toolboxes for specialized tasks.

Matlab pptchestialtaff

MATLAB is a numerical computing environment and programming language. It allows matrix manipulations, plotting of functions and data, implementation of algorithms, and interfacing with programs in other languages. MATLAB can be used for applications like signal processing, image processing, control systems, and computational finance. It offers advantages like ease of use, platform independence, and predefined functions. However, it can sometimes be slow and is commercial software. The MATLAB interface includes a command window, current directory, workspace, and command history. Arrays are fundamental data types in MATLAB and can be vectors, matrices, or multidimensional. Variables are used to store information in the workspace and can represent different data types. Common operations include arithmetic, functions, and following the

PHP - Introduction to Object Oriented Programming with PHPVibrant Technologies & Computers

array of object pointer in c++Arpita Patel

The document discusses arrays of objects and pointers to objects in C++. It defines an array of objects as a collection of objects of the same type. Syntax for an array of objects is Class_name object_name[size]. It also defines a pointer to an object as a variable that stores the address of an object. A pointer can be used to access members of a class using dot (.) or arrow (->) operators. The document provides examples of an array of objects, a pointer to an object, and an array of object pointers in C++.

Data structure lab manualnikshaikh786

The document describes implementing a queue using an array. It provides algorithms for enQueue() and deQueue() operations. EnQueue() inserts elements at the rear by incrementing rear and checking for full. DeQueue() deletes elements from the front by incrementing front and checking for empty. The queue uses front and rear pointers to manage insertion and deletion of elements based on FIFO principle using an underlying fixed-size array.

Functions in discrete mathematicsRachana Pathak

This document discusses functions in discrete mathematical structures. It defines a function as mapping elements from one set to unique elements in another set. A function assigns a single element from the codomain to each element in the domain. An example of a string length function maps strings to their lengths. The document also defines related terms like domain, codomain, image, and pre-image. It provides an example of a grade function and asks the reader to identify the domain, codomain, and range based on given information. Finally, it concludes with discussing functions and provides references for further reading.

Matlab plotingAmeen San

This document provides an overview of plotting functions in MATLAB. It discusses how to generate basic and 3D plots, customize plots using options like color, style and labels, and control the plot appearance using functions such as axis, title, legend. Examples are given to illustrate plotting a simple function, holding multiple plots, using subplots, and generating surface plots. The document also covers plotting in 3D using functions like surf, plot3 and manipulating axes properties.

Data Structures in PythonDevashish Kumar

Ppt on this and super keywordtanu_jaswal

Python unit 3 and Unit 4Anandh Arumugakan

This document discusses control flow and control structures in programming, including conditional structures like if/else statements and repetition structures like while and for loops. It provides examples of simple if statements, if/else statements, if/elif/else statements, and nested if statements. It also discusses indefinite loops with while and definite loops with for, and how to break and continue loops. Finally, it covers pass and return statements, local and global scopes, function composition, lambda functions, string slicing, string methods, and that strings are immutable in Python.

File in C languageManash Kumar Mondal

A file is a collection of related data that a computer treats as a single unit. Files allow data to be stored permanently even when the computer is shut down. C uses the FILE structure to store attributes of a file. Files allow for flexible data storage and retrieval of large data volumes like experimental results. Key file operations in C include opening, reading, writing, and closing files. Functions like fopen(), fread(), fwrite(), fclose() perform these operations.

Introduction TO Finite AutomataRatnakar Mikkili

This document provides an introduction to finite automata. It defines key concepts like alphabets, strings, languages, and finite state machines. It also describes the different types of automata, specifically deterministic finite automata (DFAs) and nondeterministic finite automata (NFAs). DFAs have a single transition between states for each input, while NFAs can have multiple transitions. NFAs are generally easier to construct than DFAs. The next class will focus on deterministic finite automata in more detail.

Matlab matrices and arraysAmeen San

This document discusses matrices and arrays in MATLAB. It defines matrices and vectors, and notes that MATLAB treats all variables as matrices. It explains how to enter matrices in MATLAB by listing elements separated by commas and semicolons. It also discusses built-in functions to generate matrices filled with zeros, ones, random values, or an identity matrix. The document covers operations on matrices like addition, subtraction, and multiplication. It explains how to extract sub-matrices and elements using indexing and introduces the colon operator.

Bayesian Networks - A Brief IntroductionAdnan Masood

- A Bayesian network is a graphical model that depicts probabilistic relationships among variables. It represents a joint probability distribution over variables in a directed acyclic graph with conditional probability tables. - A Bayesian network consists of a directed acyclic graph whose nodes represent variables and edges represent probabilistic dependencies, along with conditional probability distributions that quantify the relationships. - Inference using a Bayesian network allows computing probabilities like P(X|evidence) by taking into account the graph structure and probability tables.

Strings in pythonPrabhakaran V M

The document discusses strings in Python. It describes that strings are immutable sequences of characters that can contain letters, numbers and special characters. It covers built-in string functions like len(), max(), min() for getting the length, maximum and minimum character. It also discusses string slicing, concatenation, formatting, comparison and various string methods for operations like conversion, formatting, searching and stripping whitespace.

Constructors in C++RubaNagarajan

Constructor is a special member function that initializes objects of a class. Constructors have the same name as the class and do not have a return type. There are two types of constructors: default constructors that take no parameters, and parameterized constructors that allow passing arguments when creating objects. Constructors are automatically called when objects are created to initialize member variables, unlike regular member functions which must be explicitly called.

Conditional Control in MATLAB ScriptsShameer Ahmed Koya

In this lecture we discuss more about programming in MATLAB. One main section in programming is flow control. There are many flow control commands in MATLAB. In this lecture we discuss the conditional flow control commands. Conditional statements are commands that allows MATLAB to decide whether or not to execute some code that follows the statement Conditional statements use relational operators like ==,~=,>,< (Note that are all scalar tests)

Anonymous and Inline Functions in MATLABShameer Ahmed Koya

MATLAB's anonymous functions provide an easy way to specify a function. An anonymous function is a function defined without using a separate function file. It is a MATLAB feature that lets you define a mathematical expression of one or more inputs and either assign that expression to a function. This method is good for relatively simple functions that will not be used that often and that can be written in a single expression. The inline command lets you create a function of any number of variables by giving a string containing the function followed by a series of strings denoting the order of the input variables. It is similar to an Anonymous Function

More Related Content

What's hot (20)

MATLAB Basics-Part1Elaf A.Saeed

Matlab1guest8ba004

Loops in matlabTUOS-Sam

MatplotLib.pptxParas Intotech

Matlab practical and lab sessionDr. Krishna Mohbey

Matlab pptchestialtaff

PHP - Introduction to Object Oriented Programming with PHPVibrant Technologies & Computers

array of object pointer in c++Arpita Patel

Data structure lab manualnikshaikh786

Functions in discrete mathematicsRachana Pathak

Matlab plotingAmeen San

Data Structures in PythonDevashish Kumar

Ppt on this and super keywordtanu_jaswal

Python unit 3 and Unit 4Anandh Arumugakan

File in C languageManash Kumar Mondal

Introduction TO Finite AutomataRatnakar Mikkili

Matlab matrices and arraysAmeen San

Bayesian Networks - A Brief IntroductionAdnan Masood

Strings in pythonPrabhakaran V M

Constructors in C++RubaNagarajan

MATLAB Basics-Part1Elaf A.Saeed

Matlab1guest8ba004

Loops in matlabTUOS-Sam

MatplotLib.pptxParas Intotech

Matlab practical and lab sessionDr. Krishna Mohbey

Matlab pptchestialtaff

PHP - Introduction to Object Oriented Programming with PHPVibrant Technologies & Computers

array of object pointer in c++Arpita Patel

Data structure lab manualnikshaikh786

Functions in discrete mathematicsRachana Pathak

Matlab plotingAmeen San

Data Structures in PythonDevashish Kumar

Ppt on this and super keywordtanu_jaswal

Python unit 3 and Unit 4Anandh Arumugakan

File in C languageManash Kumar Mondal

Introduction TO Finite AutomataRatnakar Mikkili

Matlab matrices and arraysAmeen San

Bayesian Networks - A Brief IntroductionAdnan Masood

Strings in pythonPrabhakaran V M

Constructors in C++RubaNagarajan

Viewers also liked (6)

Conditional Control in MATLAB ScriptsShameer Ahmed Koya

Anonymous and Inline Functions in MATLABShameer Ahmed Koya

MATLAB Scripts - ExamplesShameer Ahmed Koya

User defined Functions in MATLAB Part 1Shameer Ahmed Koya

User Defined Functions in MATLAB Part-4Shameer Ahmed Koya

A MATLAB function that accepts another function as an input is called a function function. Function handles are used for passing functions to function functions. Syntax for function function is same as simple functions, but one or more input arguments will be function handles. Multiple functions within one function file is called local function. Name of function file should be name of main function. Main function can be called from the command window or any other function. Local functions are typed in any order after the main function. Local functions are only visible to other functions in the same file. A private function is a function residing in a sub directory with the name private. Private functions are visible only to functions in the parent directory.

Matlab IntroductionDaniel Moore

Conditional Control in MATLAB ScriptsShameer Ahmed Koya

Anonymous and Inline Functions in MATLABShameer Ahmed Koya

MATLAB Scripts - ExamplesShameer Ahmed Koya

User defined Functions in MATLAB Part 1Shameer Ahmed Koya

User Defined Functions in MATLAB Part-4Shameer Ahmed Koya

Matlab IntroductionDaniel Moore

Similar to MATLAB programming tips 2 - Input and Output Commands (20)

Introduction to matlabMohan Raj

MATLAB is a matrix-based programming language used for numerical computations, data analysis, and visualization. It allows matrix manipulations, functions for computation and visualization, toolboxes for different applications, and integrated development environment for programming. MATLAB can be used for engineering and scientific calculations with graphical output. It has built-in functions, user-defined functions, 2D and 3D graphics capabilities, GUI tools, and interfaces with other languages like C and Fortran.

Python variables in the computer science.pptxRajasekhar364622

POEPPSGNHwkejnkweoewnkenjwjewkjewoewkjewijewjkhanumanthumanideeph6

Functions of stdio conio Bhavik Vashi

This document discusses functions in the stdio.h and conio.h header files in C programming. It describes common input/output functions like printf(), scanf(), gets(), puts(), getchar(), and putchar() that are used for basic input from and output to the console. It also covers functions specific to conio.h like clrscr() and getch() that are used to clear the screen and get a character from the keyboard without echoing it.

miniLesson on the printf() functionChristine Wolfe

MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdfSowmyaJyothi3

Beginning with vi text editorJose Pla

vi is a text editor that allows users to: 1. Open, edit, and save text files from within the program using various commands like :w to write/save and :q to quit. 2. Navigate text using cursor keys, search with /pattern, and move between lines and screens using G, ctrl+D/U, and ctrl+B/F. 3. Insert, delete, change, and replace text using commands like i, a, dd, cw, s, and ~. 4. Cut/copy text to buffers using d and yank commands like yw and paste using p, search and replace with :s, and join lines with J.

1. Ch_1 SL_1_Intro to Matlab.pptxMOHAMMAD SAYDUL ALAM

Here is a MATLAB script to solve the quadratic equation with variable coefficients: % Script to solve the quadratic equation ax^2 + bx + c = 0 clear disp('Enter coefficients a, b, c: ') a = input('a = '); b = input('b = '); c = input('c = '); x = sym('x'); sol = solve(a*x^2 + b*x + c == 0, x); disp('The solutions are:') disp(sol) This script first clears any existing variables, then prompts the user to input the coefficients a, b, and c. It then defines x as a symbolic variable

Lecture 8- Data Input and OutputMd. Imran Hossain Showrov

Diploma ii cfpc u-4 function, storage class and array and stringsRai University

The document discusses various aspects of arrays and functions in C programming language. It explains that arrays allow storing multiple elements of the same type using a single name. One-dimensional and multi-dimensional arrays are described along with initialization and accessing of array elements. Common string handling functions like strcat(), strcmp(), strcpy() are also summarized. The document also provides the general forms of defining and calling functions in C and different categories of functions based on arguments and return values.

Introduction to Input/Output Functions in CThesis Scientist Private Limited

Input refers to accepting data while output refers to presenting data. Normally the data is accepted from keyboard and is outputted onto the screen. C language has a series of standard input-output (I/O) functions. Such I/O functions together form a library named stdio.h. Irrespective of the version of C language, user will have access to all such library functions. These library functions are classified into three broad categories. a) Console I/O functions : Functions which accept input from keyboard and produce output on the screen. b) Disk I/O functions : Functions which perform I/O operations on secondary storage devices like floppy disks or hard disks. c) Port I/O functions : Functions which perform I/O operations on various ports like printer port, mouse port, etc. Console I/

Lecture-2.pptxefygefyeyyegfygcyewvwvvcvywcyhamzah7958

Each n Every topic of C Programming.pptxsnnbarot

Mcai pic u 4 function, storage class and array and stringsRai University

Arrays allow storing multiple values of the same type under a common name. One-dimensional arrays use a single subscript to access elements, while multi-dimensional arrays use multiple subscripts. Strings are arrays of characters that end with a null character. Functions allow breaking programs into smaller, reusable parts. Functions can take arguments, return values, or do both. Variables declared inside functions have automatic storage, while those outside have external storage. Arrays and strings can be passed to functions. Recursion occurs when a function calls itself.

Input And OutputGhaffar Khan

Btech i pic u-4 function, storage class and array and stringsRai University

Arrays allow storing multiple values of the same type under a common name. One-dimensional arrays use a single subscript to access elements, while multi-dimensional arrays use multiple subscripts. Strings are arrays of characters terminated by a null character. Functions allow breaking programs into modular reusable units. Functions can take arguments, return values, or do both. Variables declared inside functions have automatic storage, while those outside have external storage. Arrays and strings can be passed to functions. Recursion occurs when a function calls itself.

Functions torage class and array and strings-aneebkmct

Arrays allow storing multiple values of the same type under a common name. One-dimensional arrays use a single subscript to access elements, while multi-dimensional arrays use multiple subscripts. Strings are arrays of characters terminated by a null character. Functions allow breaking programs into smaller, reusable parts. Functions can accept arguments, return values, or have no arguments and return nothing. Variables declared inside functions have automatic storage, while those outside have external storage.

function, storage class and array and stringsRai University

Matlab ch1 (5)mohsinggg

The chapter discusses inputting and managing data in MATLAB. It covers the MATLAB workspace, using script files to input data, displaying and saving output, and exchanging data with other programs. The key points are: 1) MATLAB stores variables in the workspace during a session and script files can access these variables. The workspace window allows viewing and editing variables. 2) Script files can input data by assigning values in the file, command window, or prompting the user. 3) The disp and fprintf commands display output, with fprintf offering more formatting control. Fprintf can write to files or the screen. 4) The save command saves workspace variables to a file, while load retrieves stored data

Unit-IV Strings.pptxsamdamfa

Strings are a sequence of characters that can be manipulated using built-in methods and functions in Python. The document discusses various string operations like concatenation, indexing, slicing, formatting and built-in string methods. It provides examples of using the string formatting operator (%), string methods like startswith(), find(), upper(), lower() and functions like len(), ljust(), rjust() to manipulate and check properties of strings.

Introduction to matlabMohan Raj

Python variables in the computer science.pptxRajasekhar364622

POEPPSGNHwkejnkweoewnkenjwjewkjewoewkjewijewjkhanumanthumanideeph6

Functions of stdio conio Bhavik Vashi

miniLesson on the printf() functionChristine Wolfe

MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdfSowmyaJyothi3

Beginning with vi text editorJose Pla

1. Ch_1 SL_1_Intro to Matlab.pptxMOHAMMAD SAYDUL ALAM

Lecture 8- Data Input and OutputMd. Imran Hossain Showrov

Diploma ii cfpc u-4 function, storage class and array and stringsRai University

Introduction to Input/Output Functions in CThesis Scientist Private Limited

Lecture-2.pptxefygefyeyyegfygcyewvwvvcvywcyhamzah7958

Each n Every topic of C Programming.pptxsnnbarot

Mcai pic u 4 function, storage class and array and stringsRai University

Input And OutputGhaffar Khan

Btech i pic u-4 function, storage class and array and stringsRai University

Functions torage class and array and strings-aneebkmct

function, storage class and array and stringsRai University

Matlab ch1 (5)mohsinggg

Unit-IV Strings.pptxsamdamfa

More from Shameer Ahmed Koya (7)

User Defined Functions in MATLAB part 2Shameer Ahmed Koya

Previous post we discussed what is a user defined function in MATLAB. This lecture we will discuss how to define a function and how to call the function in a script. Components of a function is discussed in the previous lecture. The first statement in a function must be function definition.The basic syntax of a function definition is: function[a, b, c]= basicmath(x,y) Basically a function accepts an input vector, perform the operation, and returns a result. The sample function given has two input variables and three output variables. But we can also have functions without input or/and output.

MATLAB Programming - Loop Control Part 2Shameer Ahmed Koya

Matlab Script - Loop ControlShameer Ahmed Koya

Introduction to Matlab ScriptsShameer Ahmed Koya

MATLAB Script or programs are sequences of MATLAB commands saved in plain text files. When you type the name of the script file at the MATLAB prompt the commands in the script file are executed as if you had typed them in command window. Code for a script is done in an Editor window and saved as m-file. In case your code has errors, MATLAB will show an error message in the command window, when you try to run the program . Error message will be hyperlinked to the line in the file that caused the error.

Matlab Programming Tips Part 1Shameer Ahmed Koya

Polynomials and Curve Fitting in MATLABShameer Ahmed Koya

This document discusses various polynomial functions in MATLAB. It covers defining and manipulating polynomials, including evaluation, finding roots, addition/subtraction, multiplication/division, derivatives, and curve fitting using polynomial regression. Polynomials in MATLAB are defined as row vectors of coefficients. Key functions include polyval for evaluation, roots for finding roots, conv for multiplication, deconv for division, and polyfit for curve fitting.

MATLAB - Aplication of Arrays and Matrices in Electrical SystemsShameer Ahmed Koya

This document discusses using matrices and linear algebra to analyze electrical systems. It explains how to represent sets of linear equations in matrix form as A*x=y and solve for x using the inverse of A. It also discusses calculating the rank of a matrix and condition number. Examples are given of using matrices to solve circuit problems involving node analysis, mesh analysis, and AC circuits. Solutions are found by taking the inverse of the matrix or using the backslash operator in MATLAB.

User Defined Functions in MATLAB part 2Shameer Ahmed Koya

MATLAB Programming - Loop Control Part 2Shameer Ahmed Koya

Matlab Script - Loop ControlShameer Ahmed Koya

Introduction to Matlab ScriptsShameer Ahmed Koya

Matlab Programming Tips Part 1Shameer Ahmed Koya

Polynomials and Curve Fitting in MATLABShameer Ahmed Koya

MATLAB - Aplication of Arrays and Matrices in Electrical SystemsShameer Ahmed Koya

Recently uploaded (20)

Herbs Used in Cosmetic Formulations .pptxRAJU THENGE

PHYSIOLOGY MCQS By DR. NASIR MUSTAFA (PHYSIOLOGY)Dr. Nasir Mustafa

How to Set warnings for invoicing specific customers in odooCeline George

How to Manage Purchase Alternatives in Odoo 18Celine George

Operations Management (Dr. Abdulfatah Salem).pdfArab Academy for Science, Technology and Maritime Transport

Link your Lead Opportunities into Spreadsheet using odoo CRMCeline George

LDMMIA Reiki News Ed3 Vol1 For Team and GuestsLDM Mia eStudios

Happy May and Taurus Season. ♥☽✷♥We have a large viewing audience for Presentations. So far my Free Workshop Presentations are doing excellent on views. I just started weeks ago within May. I am also sponsoring Alison within my blog and courses upcoming. See our Temple office for ongoing weekly updates. https://ldmchapels.weebly.com ♥☽About: I am Adult EDU Vocational, Ordained, Certified and Experienced. Course genres are personal development for holistic health, healing, and self care/self serve.

All About the 990 Unlocking Its Mysteries and Its Power.pdfTechSoup

BỘ ĐỀ TUYỂN SINH VÀO LỚP 10 TIẾNG ANH - 25 ĐỀ THI BÁM SÁT CẤU TRÚC MỚI NHẤT, ...Nguyen Thanh Tu Collection

How to Create Kanban View in Odoo 18 - Odoo SlidesCeline George

LDMMIA Reiki Yoga S5 Daily Living WorkshopLDM Mia eStudios

Happy May and Happy Weekend, My Guest Students. Weekends seem more popular for Workshop Class Days lol. These Presentations are timeless. Tune in anytime, any weekend. <<I am Adult EDU Vocational, Ordained, Certified and Experienced. Course genres are personal development for holistic health, healing, and self care. I am also skilled in Health Sciences. However; I am not coaching at this time.>> A 5th FREE WORKSHOP/ Daily Living. Our Sponsor / Learning On Alison: Sponsor: Learning On Alison: — We believe that empowering yourself shouldn’t just be rewarding, but also really simple (and free). That’s why your journey from clicking on a course you want to take to completing it and getting a certificate takes only 6 steps. Hopefully Before Summer, We can add our courses to the teacher/creator section. It's all within project management and preps right now. So wish us luck. Check our Website for more info: https://ldmchapels.weebly.com Get started for Free. Currency is Euro. Courses can be free unlimited. Only pay for your diploma. See Website for xtra assistance. Make sure to convert your cash. Online Wallets do vary. I keep my transactions safe as possible. I do prefer PayPal Biz. (See Site for more info.) Understanding Vibrations If not experienced, it may seem weird understanding vibes? We start small and by accident. Usually, we learn about vibrations within social. Examples are: That bad vibe you felt. Also, that good feeling you had. These are common situations we often have naturally. We chit chat about it then let it go. However; those are called vibes using your instincts. Then, your senses are called your intuition. We all can develop the gift of intuition and using energy awareness. Energy Healing First, Energy healing is universal. This is also true for Reiki as an art and rehab resource. Within the Health Sciences, Rehab has changed dramatically. The term is now very flexible. Reiki alone, expanded tremendously during the past 3 years. Distant healing is almost more popular than one-on-one sessions? It’s not a replacement by all means. However, its now easier access online vs local sessions. This does break limit barriers providing instant comfort. Practice Poses You can stand within mountain pose Tadasana to get started. Also, you can start within a lotus Sitting Position to begin a session. There’s no wrong or right way. Maybe if you are rushing, that’s incorrect lol. The key is being comfortable, calm, at peace. This begins any session. Also using props like candles, incenses, even going outdoors for fresh air. (See Presentation for all sections, THX) Clearing Karma, Letting go. Now, that you understand more about energies, vibrations, the practice fusions, let’s go deeper. I wanted to make sure you all were comfortable. These sessions are for all levels from beginner to review. Again See the presentation slides, Thx.

How to Manage Opening & Closing Controls in Odoo 17 POSCeline George

How to Manage Upselling in Odoo 18 SalesCeline George

How to Clean Your Contacts Using the Deduplication Menu in Odoo 18Celine George

APM Midlands Region April 2025 Sacha Hind Circulated.pdfAssociation for Project Management

APM event hosted by the Midlands Network on 30 April 2025. Speaker: Sacha Hind, Senior Programme Manager, Network Rail With fierce competition in today’s job market, candidates need a lot more than a good CV and interview skills to stand out from the crowd. Based on her own experience of progressing to a senior project role and leading a team of 35 project professionals, Sacha shared not just how to land that dream role, but how to be successful in it and most importantly, how to enjoy it! Sacha included her top tips for aspiring leaders – the things you really need to know but people rarely tell you! We also celebrated our Midlands Regional Network Awards 2025, and presenting the award for Midlands Student of the Year 2025. This session provided the opportunity for personal reflection on areas attendees are currently focussing on in order to be successful versus what really makes a difference. Sacha answered some common questions about what it takes to thrive at a senior level in a fast-paced project environment: Do I need a degree? How do I balance work with family and life outside of work? How do I get leadership experience before I become a line manager? The session was full of practical takeaways and the audience also had the opportunity to get their questions answered on the evening with a live Q&A session. Attendees hopefully came away feeling more confident, motivated and empowered to progress their careers

SCI BIZ TECH QUIZ (OPEN) PRELIMS XTASY 2025.pptxRonisha Das

APGAR SCORE BY sweety Tamanna Mahapatra MSc PediatricSweetytamannaMohapat

THE STG QUIZ GROUP D.pptx quiz by Ridip HazarikaRidip Hazarika

CBSE - Grade 8 - Science - Chemistry - Metals and Non Metals - WorksheetSritoma Majumder

Introduction All the materials around us are made up of elements. These elements can be broadly divided into two major groups: Metals Non-Metals Each group has its own unique physical and chemical properties. Let's understand them one by one. Physical Properties 1. Appearance Metals: Shiny (lustrous). Example: gold, silver, copper. Non-metals: Dull appearance (except iodine, which is shiny). 2. Hardness Metals: Generally hard. Example: iron. Non-metals: Usually soft (except diamond, a form of carbon, which is very hard). 3. State Metals: Mostly solids at room temperature (except mercury, which is a liquid). Non-metals: Can be solids, liquids, or gases. Example: oxygen (gas), bromine (liquid), sulphur (solid). 4. Malleability Metals: Can be hammered into thin sheets (malleable). Non-metals: Not malleable. They break when hammered (brittle). 5. Ductility Metals: Can be drawn into wires (ductile). Non-metals: Not ductile. 6. Conductivity Metals: Good conductors of heat and electricity. Non-metals: Poor conductors (except graphite, which is a good conductor). 7. Sonorous Nature Metals: Produce a ringing sound when struck. Non-metals: Do not produce sound. Chemical Properties 1. Reaction with Oxygen Metals react with oxygen to form metal oxides. These metal oxides are usually basic. Non-metals react with oxygen to form non-metallic oxides. These oxides are usually acidic. 2. Reaction with Water Metals: Some react vigorously (e.g., sodium). Some react slowly (e.g., iron). Some do not react at all (e.g., gold, silver). Non-metals: Generally do not react with water. 3. Reaction with Acids Metals react with acids to produce salt and hydrogen gas. Non-metals: Do not react with acids. 4. Reaction with Bases Some non-metals react with bases to form salts, but this is rare. Metals generally do not react with bases directly (except amphoteric metals like aluminum and zinc). Displacement Reaction More reactive metals can displace less reactive metals from their salt solutions. Uses of Metals Iron: Making machines, tools, and buildings. Aluminum: Used in aircraft, utensils. Copper: Electrical wires. Gold and Silver: Jewelry. Zinc: Coating iron to prevent rusting (galvanization). Uses of Non-Metals Oxygen: Breathing. Nitrogen: Fertilizers. Chlorine: Water purification. Carbon: Fuel (coal), steel-making (coke). Iodine: Medicines. Alloys An alloy is a mixture of metals or a metal with a non-metal. Alloys have improved properties like strength, resistance to rusting.

Lecture 1 Introduction history and institutes of entomology_1.pptxArshad Shaikh

Herbs Used in Cosmetic Formulations .pptxRAJU THENGE

PHYSIOLOGY MCQS By DR. NASIR MUSTAFA (PHYSIOLOGY)Dr. Nasir Mustafa

How to Set warnings for invoicing specific customers in odooCeline George

How to Manage Purchase Alternatives in Odoo 18Celine George

Operations Management (Dr. Abdulfatah Salem).pdfArab Academy for Science, Technology and Maritime Transport

Link your Lead Opportunities into Spreadsheet using odoo CRMCeline George

LDMMIA Reiki News Ed3 Vol1 For Team and GuestsLDM Mia eStudios

All About the 990 Unlocking Its Mysteries and Its Power.pdfTechSoup

BỘ ĐỀ TUYỂN SINH VÀO LỚP 10 TIẾNG ANH - 25 ĐỀ THI BÁM SÁT CẤU TRÚC MỚI NHẤT, ...Nguyen Thanh Tu Collection

How to Create Kanban View in Odoo 18 - Odoo SlidesCeline George

LDMMIA Reiki Yoga S5 Daily Living WorkshopLDM Mia eStudios

How to Manage Opening & Closing Controls in Odoo 17 POSCeline George

How to Manage Upselling in Odoo 18 SalesCeline George

How to Clean Your Contacts Using the Deduplication Menu in Odoo 18Celine George

APM Midlands Region April 2025 Sacha Hind Circulated.pdfAssociation for Project Management

SCI BIZ TECH QUIZ (OPEN) PRELIMS XTASY 2025.pptxRonisha Das

APGAR SCORE BY sweety Tamanna Mahapatra MSc PediatricSweetytamannaMohapat

THE STG QUIZ GROUP D.pptx quiz by Ridip HazarikaRidip Hazarika

CBSE - Grade 8 - Science - Chemistry - Metals and Non Metals - WorksheetSritoma Majumder

Lecture 1 Introduction history and institutes of entomology_1.pptxArshad Shaikh

MATLAB programming tips 2 - Input and Output Commands

1. 11 Matlab Programming Tips Part 2– Input / Output Commands (Review) by Shameer Koya

2. input Command  input - Prompt for user input.  Input is the simple basic command to request the user input.  Displays a prompt text for the user to understand what data to be entered and waits for the user to input a value and press the Return key.  i = input('Enter the current value:')  str = input(‘text’,'s') returns the entered text as a MATLAB string, without evaluating expressions. 2

3. sscanf Command  Read data as string and convert to the other formats based on the definition.  X = sscanf(str, format, size)  Reads data from the vector str, converts it according to the format, and store the results in array X.  Argument ‘size’ is optional. 3

4. disp Command  disp - (display) command displays variable values or text on screen  Displays each time on new line.  Doesn't print variable name  disp(variable_name) or disp('text string') 4

5. fprintf Command  fprintf - Means file print formatted  'fprintf' is used to formats data and displays the results on the screen and to write the data in to a text file.  Can write to screen or to a file  Can mix numbers and text in output  Have full control of output display  Basic Syntax is  fprintf('Text to display') 5

6.  >> fprintf( 'How are you' )  How are you>>  Problem – Command Window displays prompt (>>) at end of text, not at start of next line!  To make the prompt to appear on the start of a new line, n at the end of the fprintf text  >> fprintf( Electrical Engineeringn' )  Electrical Engineering  >>  Use n in middle of text to make MATLAB display remainder of text on next line  >> fprintf(' Electrical nEngineering')  Electrical  Engineering 6 fprintf …

7.  To format the display data, the formatting operators are used.  A formatting operator starts with a percentage sign, %, and ends with a conversion character.  Common conversion specifiers:  %f fixed point (decimal always between 1's and 0.1's place, e.g., 3.14, 56.8  %e scientific notation, e.g, 2.99e+008  %d integers (no decimal point shown)  %s string of characters  >> fprintf( 'Joe is %d weighs %f kilos', age, weight )  >> fprintf( 'Joe weighs %f kilos', n1 ) 7 fprintf to format the output

8. fprintf to format the output …  Examples  >> age = 35;  >> weight = 75.25;  >> fprintf( 'Joe is %d weighs %f kilosn', age, weight )  Joe is 35 weighs 75.250000 kilos  >> fprintf( 'Joe weighs %4.4f kilosn', weight )  Joe weighs 75.2500 kilos  >> fprintf( 'Joe weighs %4.2f kilosn', weight )  Joe weighs 75.25 kilos 8

9. fprintf to format the output…  To display a percent sign, use %% in the text  To display a single quote, use ' ' in the text (two sequential single quotes)  To display a backslash, use in the text (two sequential backslashes) 9

MATLAB programming tips 2 - Input and Output Commands

Recommended

More Related Content

What's hot (20)

Viewers also liked (6)

Similar to MATLAB programming tips 2 - Input and Output Commands (20)

More from Shameer Ahmed Koya (7)

Recently uploaded (20)

MATLAB programming tips 2 - Input and Output Commands